PHOSPHATIDYLSERINE TARGETING FUSION MOLECULES AND METHODS FOR THEIR USE
20200181221 ยท 2020-06-11
Inventors
- Sergei V. Kotenko (East Brunswick, NJ, US)
- Raymond B. Birge (New York, NY, US)
- Viralkumar Rameshkumar Davra (Keasbey, NJ, US)
Cpc classification
C07K2319/033
CHEMISTRY; METALLURGY
C07K2319/01
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
Fusion molecules of a cytokine or portion thereof and a polypeptide which targets the fusion protein to phosphatidylserine, pharmaceutical compositions thereof, and methods for their use in targeting a cytokine or portion thereof to a pathological site and treating a disease or condition responsive to cytokine treatment are provided.
Claims
1. A fusion molecule comprising a cytokine or portion thereof and a polypeptide which targets the fusion molecule to phosphatidylserine (PS).
2. The fusion molecule of claim 1, wherein the polypeptide comprises a PS-binding ligand of Tyro3, Axl and Mer (TAM) receptors.
3. The fusion molecule of claim 1 wherein the polypeptide comprises a PS-binding type domain of growth arrest-specific gene 6 (GAS6) or protein S(Pros1).
4. The fusion molecule of claim 1 wherein the polypeptide comprises an N-terminal Gla domain of Gas6.
5. The fusion molecule of claim 4 wherein the polypeptide further comprises a domain which promotes oligomerization of the PS-binding domain upon binding with PS and/or an epidermal growth factor (EGF)-like domain.
6. (canceled)
7. The fusion molecule of claim 1 wherein the cytokine or portion thereof is an immune-stimulatory cytokine or portion thereof.
8. The fusion protein of claim 7 wherein the immune-stimulatory cytokine or portion thereof is an interferon or portion thereof.
9. The fusion molecule of claim 8 wherein the interferon is selected from interferon-, interferon-, interferon-1, interferon-2, interferon-3 or a combination or portion thereof.
10. The fusion molecule of claim 1 wherein the cytokine or portion thereof is an immune-suppressive cytokine or portion thereof.
11. The fusion molecule of claim 1, further comprising a linker between the cytokine or portion thereof and the polypeptide which targets the fusion molecule to PS.
12. A pharmaceutical composition comprising the fusion molecule of claim 1 and a pharmaceutically acceptable carrier.
13. A method for targeting a cytokine or portion thereof to a pathological site in a subject, said method comprising administering to the subject the pharmaceutical composition of claim 12.
14. The method of claim 13 wherein the pathological site is a PS-rich area.
15. The method of claim 13 wherein the cytokine or portion thereof is an immune-stimulatory cytokine or portion thereof.
16. The method of claim 15 wherein the pathological site comprises cancer, infection or inflammation.
17. The method of claim 13 wherein immunosuppression which occurs from PS recognition by endogenous PS ligands and receptors at a pathological site in a subject is inhibited.
18. The method of claim 13 wherein one or more cytokine-specific biological activities are activated at the pathological site.
19. The method of claim 13 wherein systemic action of the cytokine or portion thereof is minimized.
20. A method for treating a disease, disorder or condition responsive to cytokine treatment, said method comprising administering to a subject in need of treatment the pharmaceutical composition of claim 12 thereby treating the subject's disease or condition.
21. The method of claim 20, wherein the disease, disorder or condition responsive to cytokine treatment is cancer, infection or an inflammatory condition or disorder.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
DETAILED DESCRIPTION
[0049] While the immune system has the potential to eliminate pathogenic cells such as tumor cells, viruses and inflammatory cells involved in inflammatory disorders, a major barrier to effective immunotherapy is the ability to elicit a clinically meaningful response. To do so, the host must be capable of overcoming the intrinsic suppressive mechanisms that limit the development of effective immune responses.
[0050] Cytokines are powerful regulators of a variety of immune functions and can be used to treat a broad range of pathological conditions, including cancer, infections, and immune and inflammatory disorders. Due to undesirable side effects that accompany systemic administration of many cytokines, targeting cytokines to the sites with pathologies to achieve localized action of cytokines is highly preferable.
[0051] Externalization of phosphatidylserine (PS) is a hallmark of cancer cells themselves, and dys-regulated PS externalization in the tumor microenvironment (TME) has been observed in a wide range of human cancers making it a hallmark of all solid cancers. Dys-regulated PS in the TME can occur on a variety of cell types including apoptotic tumor cells, stressed tumor and various tumor-infiltrating cells resulting from hypoxia and nutrient deprivation, and stressed vascular endothelial cells at the tumor site.
[0052] Further, cells undergoing stress due to hypoxia and nutrient deprivation due to infections and/or inflammatory conditions also externalize PS. Moreover, enveloped viruses expose PS on their surfaces.
[0053] Therefore, targeting cytokines to PS-rich areas serves as a way of delivering cytokines to tumor sites, sites of viral infection and sites of inflammation, while minimizing their systemic action.
[0054] PS concentration on the cell surface appears to reflect the cellular stress level; and the changes in the PS concentration are sensed by a group of receptors collectively known as TAMs (Tyro3, Axl and Mer), which are activated by PS-binding TAM ligands Gas6 and Pros1. These ligands serve as bridging molecules, which interact with PS through their N-terminal Gla domains, and bind and activate TAMs through their C-terminal LG domains. Activation of TAMs is strictly PS-dependent and PS concentration acts as a rheostat for the intensity of TAM activation.
[0055] The present invention provides engineered bifunctional PS-targeting-cytokine fusion immunobiologics and methods for their use in targeting cytokines to tumor sites, sites of viral infection and sites of inflammation. Unlike PS-targeting mAbs that bind PS and passively block PS interactions with cognate receptors on tumor and myeloid cells, the fusion molecules of the present invention are designed to be able to tune the intensity of immunostimulatory cytokine signaling to PS concentration in the PS-rich microenvironment. Therefore, in the presence of PS, these PS-targeting-cytokine fusion molecules induce stronger and sustained cytokine receptor activation resulting in enhanced biological activities of the PS-targeting-cytokine fusion molecules in comparison to unmodified cytokines.
[0056] Moreover, activation of PS receptors, which can be triggered by direct binding to PS or by PS-interacting ligands, leads to the state of immunosuppression that is commonly established and maintained during, for example, tumor development.
[0057] The PS-targeting-cytokine fusion molecules of the present invention are expected to revert and redirect the state of immunosuppression by providing immune activation through cytokine-specific activities and by competing for PS binding with endogenous PS ligands and receptors, therefore blocking their ability to induce immunosuppressive state.
[0058] Accordingly, the bi-functional PS-targeting-cytokine fusion molecules of the present invention are expected to bind PS on stressed cells and localize immunostimulatory cytokine signaling to regions of high-externalized PS density. In doing so, the fusion molecules of the present invention are expected to redirect tolerogenic signals, which are generated through continuous engagement of immunosuppressive PS receptors, into immunogenic signals from the PS->cytokine receptor axis.
[0059] Thus, provided by the present invention are fusion molecules comprising a cytokine or portion thereof and a polypeptide which targets the fusion protein to PS. The developed fusion molecules of the present invention feature three unique characteristics in that they provide PS-targeted localized cytokine delivery; they block PS recognition by endogenous PS ligands and receptors; and by activating cytokine-specific biological activities, they actively change the immune activation balance from PS-induced immunosuppression to immune-activation that is tuned to the levels of PS. Accordingly, also provided by the present invention are pharmaceutical compositions comprising these fusion molecules as well as methods for use of the fusion molecules and pharmaceutical compositions in targeting a cytokine to a pathological site in a subject, inhibiting immunosuppression which occurs from PS recognition by endogenous PS ligands at a pathological site in a subject, activating one or more cytokine-specific biological activities at a pathological site, minimizing systemic action of a cytokine, and/or treating a disease, disorder or condition responsive to cytokine treatment. In one nonlimiting embodiment, the disease, disorder or condition targeted and/or treated with the present invention is cancer, infection or an inflammatory condition or disorder.
[0060] For purposes of the present invention, the terms fusion protein and fusion molecule are used interchangeably and are meant to encompass polypeptides, proteins and/or molecules made of parts from different sources. Such fusion molecules are created through the joining of two or more genes or fragments thereof that originally coded for separate proteins or portions thereof. Translation of these fused genes or portions thereof results in single or multiple polypeptides with functional properties derived from each of the original proteins. In one nonlimiting embodiment, the fusion molecules or proteins are created artificially by recombinant DNA technology for use in biological research or therapeutics.
[0061] For purposes of the present invention, by portion thereof it is meant a fragment shorter in length than the full length cytokine protein and which maintains at least a portion of the functional activity to the full length protein and/or binding to at least one of the receptor subunits.
[0062] Various immunostimulatory or immunosuppressive cytokines or portions thereof known to those skilled in the art can be included in the fusion molecules of the present invention. In a one nonlimiting embodiment, the cytokine selected has a desired activity at a pathogenic PS-rich site. In one nonlimiting embodiment, the cytokine is an interferon (IFN) or portion thereof. IFNs are pluripotent cytokines and play important roles in the establishment of a multifaceted antiviral response and anti-tumor response. Examples of cytokines which can be included in the fusion molecules of the present invention include, but are in no way limited to, interferon- (IFN-), interferon- (IFN-), interferon-2\1 (IFN-1), interferon-2 (IFN-2), interferon-3 (IFN-3), interferon (IFN-), interleukin 2 (IL-2), interleukin 10 (IL-10), interleukin 12 (IL-12), interleukin 15 (IL-15), interleukin 22 (IL-22), interleukin 33 (IL-33), amphiregulin (AREG), a combination thereof or a portion thereof. Some cytokines such as IFN-, IFN-1, IFN--2 and IFN-3 have unpaired Cys residues that can be substituted to improve folding and purification of the fusion molecules. Variants of cytokines with lower affinity to their corresponding receptors can be also used for the generation of the fusion PS-targeting cytokine proteins to reduce their signaling capabilities though their receptor complexes, and allowing enhancement of their activities in the presence of PS through the PS-mediated oligomerization of cytokine receptor complexes when activated by the fusion PS-targeting cytokines.
[0063] The fusion molecules of the present invention further comprise a polypeptide which targets the fusion molecule to PS. Various polypeptides targeting the fusion molecule to PS can be included in these fusion molecules. Examples of PS-targeting polypeptides which can be included in the fusion molecules of the present invention include, but are in no way limited to PS-binding domains of brain angiogenesis inhibitor 1 (BAI1), annexins, particularly annexin A5 and B12, T cell immunoglobulin and mucin receptor 1, 3 and 4 (TIM-1, TIM-3 and TIM-4), stabilin 1 and 2, and milk fat globule-EGF factor 8 protein (MFGE8). In one nonlimiting embodiment, the fusion molecule comprises a polypeptide comprising a PS-binding ligand of Tyro3, Axl and/or Mer (TAM) receptors. In one nonlimiting embodiment, the fusion molecule comprises a polypeptide comprising a PS-binding type domain of growth arrest-specific gene 6 (GAS6) or protein S (Pros1). In one nonlimiting embodiment, the fusion molecule comprises a polypeptide comprising an N-terminal Gla domain of Gas6 or Pros1. Nonlimiting examples of polypeptides useful in the fusion molecules of the present invention include:
TABLE-US-00001 GladomainofmouseGas6withSignalPeptide andpro-domain: (SEQIDNO:1) MPPPPGPAAALGTALLLLLLASESSHTVLLRAREAAQFLRPRQRRA YQVFEEAKQGHLERECVEEVCSKEEAREVFENDPETEYFYPRYQE; GladomainofmouseGas6withpro-domain withoutSignalPeptide: (SEQIDNO:2) TVLLRAREAAQFLRPRQRRAYQVFEEAKQGHLERECVEEVCSKEEA REVFENDPETEYFYPRYQE; GladomainofmouseGas6withoutSignal peptideandpro-domain: (SEQIDNO:3) AYQVFEEAKQGHLERECVEEVCSKEEAREVFENDPETEYFYPRYQE; GladomainofhumanGas6withSignalPeptide andpro-domain: (SEQIDNO:4) MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQ RRAFQVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRY LD; GladomainofhumanGas6withpro-domain withoutSignalPeptide: (SEQIDNO:5) ALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELCSREEAR EVFENDPETDYFYPRYLD; GladomainofhumanGas6withoutSignal Peptideandpro-domain: (SEQIDNO:6) AFQVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRYLD; GladomainofhumanPros1withSignalPeptide andpro-domain: (SEQIDNO:7) MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLL EETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLV; GladomainofhumanPros1withpro-domain withoutSignalPeptide: (SEQIDNO:8) NFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEARE VFENDPETDYFYPKYLV; and GladomainofhumanPros1withoutSignal Peptideandpro-domain: (SEQIDNO:9) ANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLV.
[0064] Further, in some embodiments, the polypeptide which targets the fusion molecule to PS may further comprise a domain which promotes oligomerization of the PS-binding domain upon binding with PS. A nonlimiting example of a domain which promotes oligomerization of the PS-binding domain upon binding with PS which can be included in the fusion molecules of the present invention is epidermal growth factor (EGF)-like domains of GAS6 or Pros1. Nonlimiting examples include:
TABLE-US-00002 EGF-likedomainsofhumanGAS6 (SEQIDNO:10) CINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFF CLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL SSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKA CRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCE; and EGF-likedomainsofhumanPros1 (SEQIDNO:11) CLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSC KDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGS YHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECEC PEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKL AQDQKSCE.
[0065] Accordingly, in one nonlimiting embodiment, a fusion molecule of the present invention may comprise a polypeptide comprising an N-terminal PS-binding type domain and EGF-like oligomerization domains of GAS6 or Pros1. Nonlimiting examples of such fusion molecules include:
TABLE-US-00003 GladomainandEGF-likedomainsofhumanGas6 withSignalPeptideandpro-domain: (SEQIDNO:12) MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQR RAFQVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRYLD CINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFF CLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL SSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKA CRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCE; GladomainandEGF-likedomainsofhumanGas6 withpro-domainwithoutSignalPeptide: (SEQIDNO:13) ALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELCSREEARE VFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPNP CDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQIC HNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGS YSCLCDEGFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGR GGLKLSQDMDTCE; GladomainandEGF-likedomainsofhumanGas6 withoutSignalPeptideandpro-domain: (SEQIDNO:14) AFQVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRYLDC INKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFC LCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELS SDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKAC RDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCE: GladomainandEGF-likedomainsofhumanPros1 withSignalPeptideandpro-domain: (SEQIDNO:15) MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLE ETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLVCLRSFQT GLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASF TCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKN GFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYN LKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSC E: GladomainandEGF-likedomainsofhumanPros1 withpro-domainwithoutSignalPeptide: (SEQIDNO:16) NFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEAREV FENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIP DQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPS NINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSIC GTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNY PGGYTCYCDGKKGFKLAQDQKSCE; and GladomainandEGF-likedomainsofhumanPros1 withoutSignalPeptideandpro-domain: (SEQIDNO:17) ANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLVC LRSFQTGLETAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCK DGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSY HCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECP EGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLA QDQKSCE.
[0066] In some nonlimiting embodiments of the present invention, the fusion molecule comprises type I and type III IFN proteins or portions thereof. Type I IFN proteins for use in the fusion molecule of the invention include but are not limited to IFN- (alpha), IFN- (beta), IFN- (kappa), IFN- (epsilon), and IFN- (omega) or portions thereof. Nonlimiting exemplary mature type I IFN proteins are:
TABLE-US-00004 humanIFN-2a: (SEQIDNO:SEQIDNO:18) CKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFP QEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYT ELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEK KYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE; and humanIFN-: (SEQIDNO:19) MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQL QQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQ INHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHC AWTIVRVEILRNFYFINRLTGYLRN.
[0067] Type III IFNs include IFN-1, IFN-2, IFN-3 and IFN-4 and portions thereof. Nonlimiting exemplary type III IFN proteins are:
TABLE-US-00005 humanIFN-1: (SEQIDNO:20) PVPTSKPTPTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWS CSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVL DQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKES AGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST; and humanIFN-3: (SEQIDNO:21) VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKD CKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEASADTDPAL GDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLYRLQEAP KKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV.
[0068] In some embodiments of the present invention, the fusion molecule may further comprise a linker between the cytokine and the polypeptide which targets the fusion molecule to PS. Linkers of use in the instant fusion molecule are preferably flexible and have a length in the range of 5-50 amino acids, or more preferably 10-30 amino acids. In certain embodiments, the linker element is a glycine/serine linker, i.e. a peptide linker substantially composed of the amino acids glycine and serine. Amino acids threonine or alanine can be also used within the linker. It will be clear to the skilled person that in cases in which the cytokine such as IFN on the N-terminal end of the fusion molecule already terminates with, e.g., a Gly, such a Gly may form the first Gly of the linker in the linker sequence. Likewise, in cases in which a cytokine such as IFN begins on the C-terminal with, e.g., a Pro, such a Pro residue may form the last Pro of the linker in the linker sequence. Examples of specific linker sequences are listed in Table 1. In particular embodiments, the linker of the fusion molecule of this invention is set forth in SEQ ID NO:42.
TABLE-US-00006 TABLE1 LinkerSequence SEQIDNO: GSSGSSGSSGS 22 GSNGGFDSSEGG 23 SSGSSGSSGS 24 GSSGGSGGSGGG 25 GSSSDSDSSAGS 26 GSNDSSGGSEGG 27 GSIRWSGLSGGD 28 GSRGGSVYSEGG 29 GSSEGSSDFGGD 30 GSIVVSCSSEGG 31 GSNWDSGCSREG 32 GSNWDSGCSREC 33 GSSGCTGDAGGS 34 GSNWDSGCSRQC 35 GSIAGCGDAGEG 36 GSNWDSGCSRE 37 GSNWDSGCSREG 38 NWDSGCSREG 39 IAGCGDAGEG 40 SRRASGSSGGSSGTSGSSGGSSGTSTDP 41 ASGSSGGSSGTSGSSGGSSGTS 42 ASGSSGGSSGTSGSSGGSSGTSTDP 43 GGGGS 44 GGGGSGGGGS 45 GGGGSGGGGSGGGGS 46 GSSGSSGSSGSGSSGSSGSSGS 47 ASGSSGGSSGTS 48
[0069] Accordingly, in one nonlimiting embodiment, the fusion molecule of the present invention comprises a polypeptide comprising an N-terminal PS-binding type domain with Signal Peptide and pro-domain and EGF-like oligomerization domains of murine GAS6 fused to murine IFN- and murine IFN-2 protein.
TABLE-US-00007 Gas6(Gla+EGF)-linker-IFN--linker-IFN-2 (Gas6(Gla+EGF)-IFN--IFN-2): (SEQIDNO:49) MPPPPGPAAALGTALLLLLLASESSHTVLLRAREAAQFLRPRQRRAY QVFEEAKQGHLERECVEEVCSKEAREVFENDPETEYFYPRYQECMRK YGRPEEKNPDFAKCVQNLPDQCTPNPCDKKGTHICQDLMGNFFCVCT DGWGGRLCDKDVNECVQKNGGCSQVCHNKPGSFQCACHSGFSLASDG QTCQDIDECTDSDTCGDARCKLPGSYSCLCDEGYTYSSKEKTCQDVD ECQQDRCEQTCVNSPGSYTCHCDGRGGLKLSPDMDTCEASGSSGGSS GTSGSSGGSSGTSINYRQLQLQERTNIRKSQELLEQLNGKINLTYRA DFKIPMEMTEKMQKSYTAFAIQEMLQNVELVFRNNFSSTGWNETIVV RLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYL KLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQNASGSSGGSSGTSGS SGGSSGTSTDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDA IEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWE NMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRW LHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV.
[0070] In another nonlimiting embodiment, the fusion molecule of the present invention comprises a polypeptide comprising an N-terminal PS-binding type domain with Signal Peptide and pro-domain and EGF-like oligomerization domains of human GAS6 fused to human IFN- and human IFN-3 protein.
TABLE-US-00008 Gas6(Gla+EGF)-linker-IFN--linker-IFN-2 (Gas6(Gla+EGF)-IFN--IFN-2): (SEQIDNO:50) MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQR RAFQVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRYLD CINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFF CLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL SSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKA CRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEASGS SGGSSGTSGSSGGSSGTSMSYNLLGFLQRSSNFQCQKLLWQLNGRLE YCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSS TGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLK RYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRNASGS SGGSSGTSGSSGGSSGTSTDPVARLRGALPDARGCHIAQFKSLSPQE LQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEA ELALTLKVLEASADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTA GPRTRGRLHHWLYRLQEAPKKESPGCLEASVTENLERLLTRDLNCVA SGDLCV.
[0071] Nonlimiting embodiments of various fusion molecules of the present invention are depicted in
[0072]
[0073]
[0074] The PS targeting molecules of the present invention were designed to bind PS, but rather than engaging immunosuppressive pathways through TAM receptors, they activate IFN receptors to induce host anti-tumor and antiviral immunity (
[0075] A series of 12 murine Gas6-IFN fusion molecules containing either Gla domain alone or both Gla and EGF-like domains (Gla+EGF) of Gas6 have been cloned and sequenced. Six murine Gas6-IFN fusion molecules are depicted in
[0076] Further, mouse model of mammary tumor growth, in which murine breast cancer EO771 cells orthotopically transplanted into mammary fat pads, demonstrated that EO771 tumor cells constitutively expressing and secreting Gas6(Gla+EGF)-IFN-2 (see
[0077] Antiviral activity of the PS-targeting IFN fusion molecules of the present invention were either comparable to the native protein (
[0078] The fusion molecules of the invention can be produced by conventional recombinant expression methodologies using known expression systems including, but not limited to, E. coli, yeast, baculovirus, insect, plant or mammalian protein expression systems. The fusion molecule may be recovered and purified from recombinant cell cultures in any effective manner. For example, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. See, e.g., Lin, et al. (1986) Meth. Enzymol. 119: 183-192. Most preferably, high performance liquid chromatography (HPLC) is employed for purification. Further methods that may be used for production and isolation of the fusion molecule of the present invention are disclosed in U.S. Pat. No. 6,433,145.
[0079] In addition, fusion molecules of the present invention can be chemically synthesized using any effective technique (see, e.g., Creighton (1983) Proteins: Structures and Molecular Principles, W.H. Freeman & Co., NY; Hunkapiller, et al. (1984) Nature 310:105-111). For example, the fusion molecule or fragments of fusion molecule can be synthesized with a peptide synthesizer.
[0080] The invention also encompasses a fusion molecule, which has been modified during or after translation, e.g., by -carboxylation, glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. Any of numerous chemical modifications may be carried out by known techniques, including but not limited to, specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH4; acetylation, formylation, oxidation, reduction; metabolic synthesis in the presence of tunicamycin, etc.
[0081] Additional post-translational modifications encompassed by the invention include, for example, e.g., -carboxylation, N-linked or O-linked carbohydrate chains, processing of N-terminal or C-terminal ends), attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N-terminal methionine residue as a result of prokaryotic host cell expression. The fusion molecule may also be modified with a detectable label, such as an enzymatic, fluorescent, isotopic or affinity label to allow for detection and isolation of the protein.
[0082] Also provided by the invention are chemically modified derivatives of the fusion molecule of the present invention, which may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity (see U.S. Pat. No. 4,179,337). The chemical moieties for derivatization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like. The polypeptides may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.
[0083] The polymer may be of any molecular weight, and may be branched or unbranched. For polyethylene glycol, the preferred molecular weight is between about 1 kDa and about 100 kDa (the term about indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing. Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog). For example, the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000, 13,500, 14,000, 14,500, 15,000, 15,500, 16,000, 16,500, 17,000, 17,500, 18,000, 18,500, 19,000, 19,500, 20,000, 25,000, 30,000, 35,000, 40,000, 50,000, 55,000, 60,000, 65,000, 70,000, 75,000, 80,000, 85,000, 90,000, 95,000, or 100,000 kDa.
[0084] As noted above, the polyethylene glycol may have a branched structure. Branched polyethylene glycols are described, for example, in U.S. Pat. No. 5,643,575; Morpurgo, et al. (1996) Appl. Biochem. Biotechnol. 56:59-72; Vorobjev, et al. (1999) Nucleosides Nucleotides 18:2745-2750; and Caliceti, et al. (1999) Bioconjug. Chem. 10:638-646.
[0085] Polyethylene glycol molecules (or other chemical moieties) should be attached to the fusion molecule with consideration of effects on functional or antigenic domains of the protein. There are a number of attachment methods available to those skilled in the art, see, e.g., EP 0 401 384, which teaches coupling of PEG to G-CSF, and Malik, et al. (1992) Exp. Hematol. 20:1028-1035, which describes pegylation of GM-CSF using tresyl chloride. For example, polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group. Reactive groups are those to which an activated polyethylene glycol molecule may be bound. The amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue. Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules. Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.
[0086] As suggested above, polyethylene glycol may be attached to proteins via linkage to any of a number of amino acid residues. For example, polyethylene glycol can be linked to a protein via covalent bonds to lysine, histidine, aspartic acid, glutamic acid, or cysteine residues. One or more reaction chemistries may be employed to attach polyethylene glycol to specific amino acid residues (e.g., lysine, histidine, aspartic acid, glutamic acid, or cysteine) of the protein or to more than one type of amino acid residue (e.g., lysine, histidine, aspartic acid, glutamic acid, cysteine and combinations thereof) of the protein.
[0087] One may specifically desire proteins chemically modified at the N-terminus. Using polyethylene glycol as an illustration, one may select from a variety of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to protein (polypeptide) molecules in the reaction mix, the type of pegylation reaction to be performed, and the method of obtaining the selected N-terminally pegylated protein. The method of obtaining the N-terminally pegylated preparation (i.e., separating this moiety from other monopegylated moieties if necessary) may be by purification of the N-terminally pegylated material from a population of pegylated protein molecules. Selective proteins chemically modified at the N-terminus modification may be accomplished by reductive alkylation which exploits differential reactivity of different types of primary amino groups (lysine versus the N-terminal) available for derivatization in a particular protein. Under the appropriate reaction conditions, substantially selective derivatization of the protein at the N-terminus with a carbonyl group containing polymer is achieved.
[0088] As indicated above, pegylation of the fusion molecule of the invention may be accomplished by any number of means. For example, polyethylene glycol may be attached to the protein either directly or by an intervening linker. Linkerless systems for attaching polyethylene glycol to proteins are described in Delgado et al. (1992) Crit. Rev. Thera. Drug Carrier Sys. 9:249-304; Francis, et al. (1998) Intern. J. Hematol. 68:1-18; U.S. Pat. Nos. 4,002,531; 5,349,052; WO 95/06058; and WO 98/32466.
[0089] The number of polyethylene glycol moieties attached the fusion molecule of the invention (i.e., the degree of substitution) may also vary. For example, the pegylated protein of the invention may be linked, on average, to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20, or more polyethylene glycol molecules. Similarly, the average degree of substitution within ranges such as 1-3, 2-4, 3-5, 4-6, 5-7, 6-8, 7-9, 8-10, 9-11, 10-12, 11-13, 12-14, 13-15, 14-16, 15-17, 16-18, 17-19, or 18-20 polyethylene glycol moieties per protein molecule. Methods for determining the degree of substitution are discussed, for example, in Delgado, et al. (1992) Crit. Rev. Thera. Drug Carrier Sys. 9:249-304.
[0090] The fusion molecules of this invention can be used for the treatment of various cancers, viral diseases and other indications, in particular indications where the pathological site is rich in PS.
[0091] Accordingly, the present invention also provides pharmaceutical compositions and methods for targeting a cytokine or portion thereof to a pathological site in a subject, inhibiting immunosuppression which occurs from PS recognition by endogenous PS ligands and receptors at a pathological site in a subject, activating one or more cytokine-specific biological activities at a pathological site in a subject, minimizing systemic action of a cytokine in a subject, and/or treating a disease, disorder or condition responsive to cytokine treatment in a subject via administration of an effective amount of the fusion molecule or pharmaceutical composition comprising the fusion molecule to a subject. In one nonlimiting embodiment, the disease, disorder or condition targeted and/or treated with the present invention is cancer, infection or an inflammatory condition or disorder.
[0092] For the purposes of the present invention, a subject is intended to include a mammal, e.g., a human, non-human primate (e.g., baboon, orangutan, monkey), mouse, pig, cow, goat, cat, rabbit, rat, guinea pig, hamster, horse, monkey, sheep, or other non-human mammal; or a non-mammal, including, e.g., a non-mammalian vertebrate, such as a bird (e.g., a chicken or duck) or a fish, and a non-mammalian invertebrate.
[0093] In accordance with the method of the invention, an effective amount means a dosage or amount of the fusion molecule or pharmaceutical composition comprising the fusion molecule sufficient to produce a desired result. The desired result may include an objective or subjective improvement in the subject receiving the dosage or amount. In particular, an effective amount is an amount that prevents, ameliorates, reduces, or eliminates one or more signs or symptoms associated with the disease or condition. Treatment can include therapy of an existing condition or prophylaxis of anticipated infections, including but not limited to common recurring infections such as influenza, and circumstances requiring emergency prophylaxis, such as a bioweapon attack.
[0094] In some nonlimiting embodiments, the method of the invention is of use in the treatment of chronic and acute viral infections, such as, but not limited to, Chronic Hepatitis C infection, Chronic Hepatitis B infection, herpes virus, papilloma virus, influenza A virus, influenza B virus, respiratory syncytial virus, rhinovirus, coronavirus, rotavirus, norovirus, enterovirus, Zika virus, Ebola virus, Dengue virus, chikungunya virus, hantavirus and AIDS/HIV; cancer, including, but not limited to, solid tumors including sarcomas, carcinomas, and lymphomas of the breast, bone, liver, kidney, lung, neck and throat, skin, colon, prostate, bladder and pancreas; and inflammatory and/or autoimmune conditions or disorders such as, but not limited to, Crohn's Disease, Multiple Sclerosis and arthritis, asthma, psoriasis, dermatitis, autoimmune pulmonary or gastrointestinal inflammation, Condylomata Acuminata. In particular nonlimiting embodiments, the fusion molecules and method of the invention are of use in the treatment of a viral infection or cancer.
[0095] Any effective amount of the fusion molecule of the present invention may be administered to a subject in need thereof, e.g., a subject with a disease or condition or at risk of acquiring the disease or condition. As a general proposition, the total pharmaceutically effective amount administered parenterally per dose will be in the range of about 1 g/kg/day to 10 mg/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion. More preferably, this dose is at least 0.01 mg/kg/day, and most preferably for humans between about 0.01 and 1 mg/kg/day. If given continuously, the composition is typically administered at a dose rate of about 1 g/kg/hour to about 50 g/kg/hour, either by 1-4 injections per day or by continuous subcutaneous infusions, for example, using a mini-pump. An intravenous bag solution may also be employed. The length of treatment needed to observe changes and the interval following treatment for responses to occur may vary depending on the desired effect.
[0096] For therapeutic purposes, the fusion molecule of the invention is preferably provided as a pharmaceutical composition containing the fusion molecule in admixture with a pharmaceutically acceptable carrier. The term pharmaceutical composition means a composition suitable for pharmaceutical use in a subject, including an animal or human. A pharmaceutical composition generally comprises an effective amount of an active agent and a carrier, including, e.g., a pharmaceutically acceptable carrier such as a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
[0097] Pharmaceutical compositions containing the fusion molecule of the invention may be administered by any effective route, including, for example, orally, rectally, parenterally, intracistemally, intravaginally, intraperitoneally, topically (as by powders, ointments, drops or transdermal patch), bucally, or as an oral or nasal spray.
[0098] The term parenteral as used herein refers to any effective parenteral mode of administration, including modes of administration such as intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intraarticular injection and infusion.
[0099] The compositions may also suitably be administered by sustained-release systems. Suitable examples of sustained-release compositions include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules. Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al. Biopolymers 1983 22:547-556), poly (2-hydroxyethyl methacrylate) (Langer et al. J. Biomed. Mater. Res. 1981 15:167-277; Langer Chem. Tech. 1982 12:98-105), ethylene vinyl acetate or poly-D-()-3-hydroxybutyric acid (EP 133,988).
[0100] Sustained-release compositions also include liposomally entrapped polypeptides. Liposomes containing a polypeptide of the present invention are prepared by methods known in the art DE 3,218,121; Epstein, et al. Proc. Natl. Acad. Sci. USA 1985 82:3688-3692; Hwang, et al. Proc. Natl. Acad. Sci. USA 1980 77:4030-4034; EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; JP 83-118008; U.S. Pat. Nos. 4,485,045; 4,544,545; and EP 102,324. Ordinarily, the liposomes are of the small (about 200-800 Angstroms), unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for effective polypeptide therapy.
[0101] When used as an immunooncological (ICI), the fusion molecules of the present invention may be used alone or in combination with other ICIs. In one nonlimiting embodiment, the fusion molecule of the present invention may be used in combination with an anti-PD-1 therapeutic. This combination is particularly attractive, since type I and type III IFNs can induce up-regulation of PD-L1 and this effect may reduce the anti-tumor efficacy of the fusion molecules.
[0102] When used as an antiviral, the fusion molecule of the present invention may be administered alone, or in combination with other known anti-viral, immunomodulatory and anti-proliferative therapies, such as IL-2, KDI, Ribavirin and temozolomide.
[0103] The invention also provides a pharmaceutical pack or kit including one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention. Associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration. In addition, the fusion molecule of the present invention may be employed in conjunction with other therapeutic compounds.
[0104] The following nonlimiting examples are provided to further illustrate the present invention.
EXAMPLES
Example 1: Methods for Synthesis of the Fusion Molecules
[0105] To generate fusion molecules for biological evaluation, HEK293T cells were transiently transfected with mammalian plasmids expressing intact unmodified GAS6, IFN-2, IFN-, and a fusion IFN molecule IFN--IFN-2 (controls) and six GAS6-IFN fusion molecules, Gas6(Gla)-IFN-2, Gas6(Gla)-IFN-, Gas6(Gla)-IFN--IFN-2, Gas6(Gla+EGF)-IFN-2, Gas6(Gla+EGF)-IFN- and Gas6(Gla+EGF)-IFN--IFN-2. Plasmids expressing His-tagged and phosphorylatable versions of the fusion molecules were also created and transfected into HEK293 cells. Conditioned media containing secreted intact or fusion proteins was collected after 48 hours post transfection.
Example 2: Immunoblotting Methods
[0106] The condition media containing various intact Gas6 and IFN molecules, as well as Gas6(Gla), or Gas6(Gla+EGF) IFN fusion molecules was resolved by SDS-PAGE, transferred to the membrane and the -carboxylation was assessed by immunoblotting with -carboxylation and His-tag specific antibodies.
Example 3: Assessing -Carboxylation and Cytokine Activity
[0107] The activity of the fusion Gas6(Gla), or Gas6(Gla+EGF) IFN fusion proteins was evaluated by treating IFN-R-R1 reporter cell line. The reporter cells were treated with recombinant IFN-2 used as a control, or HEK293T cell supernatant containing Gas6(Gla) and Gas6(Gla+EGF) IFN fusion molecules with or without apoptotic cells for 30 minutes. Cell lysates were prepared and Stat1 phosphorylation was measured by immunoblotting with antibodies specific for tyrosine phosphorylated Stat1 (pStat1) as a readout for IFN- receptor activation. The pStat1 immunoblots showed phosphatidylserine binding dependent enhancement of activation of the IFN- receptor by the fusion molecules. Moreover, binding to apoptotic cells of -carboxylated Gas6-IFN fusion molecule was demonstrated by co-precipitation of IFN activity with apoptotic cells.
Example 4: Anti-Viral Activity
[0108] An equal number of human retinal pigment epithelium ARPE19 cells, or murine intestinal epithelial cells (mIECs) was plated in DMEM media with 10% FCS in all wells of 96 well microtiter plate and treated with recombinant IFN-2 at various concentrations ranging from 300 ng/ml to 0.002 ng/ml or with three fold serial dilutions of HEK293T cell supernatant containing Gas6(Gla)-IFN-2 and Gas6(Gla+EGF)IFN-2 fusion molecules, or IFN--IFN-2 and Gas6(Gla+EGF)-IFN--IFN-2, respectively. After 24 hours of pretreatment, the cells were challenged with vesicular stomatitis virus (VSV) added to the wells at the concentration of 0.1 pfu/cell and the cells were further incubated for 24 hours to analyze the anti-viral activity of the fusion molecules. Cell viability was measured using the MTT assay following manufacturer's protocol (Millipore/Sigma).
[0109] ARPE-19 cells or mIECs were also plated in 6 well plates in DMEM media with 10% FCS and were left untreated or treated with recombinant IFN-2 (100 ng/ml) or with 1/10 dilution of HEK293T cell supernatant containing Gas6(Gla)-IFN-2, Gas6(Gla+EGF)-IFN-2, IFN--IFN-2 or Gas6(Gla+EGF)-IFN--IFN-2 fusion molecules for 72 hours. Cells were then collected and cell surface levels of MHC class I antigen expression, calreticulin expression or PD-L1 expression were measured by flow cytometry.
Example 5: Anti-Tumor Activity
[0110] Immunocompetent syngeneic 6-8 week old C57BL/6 mice (Jackson Laboratory) were injected with 10.sup.5 EO771 mock cells (EO771 cells transfected with empty vector) IFN--IFN-2 Gas6(Gla+EGF)-IFN-,Gas6(Gla+EGF)-IFN-2 or Gas6(Gla+EGF)-IFN--IFN-2 fusion molecule secreting cells (EO771 cells transfected with vectors expressing various fusion molecules) into the mammary fat-pad. Mice were checked for tumor growth by palpation of the injection site every 1 to 2 days and the tumor volume (V) was calculated by measuring tumor length (L) and width (W) using clipper and then applying a formula V=(LWW)/2.
Example 6: Evaluation of the Ability of Fusion Molecule to be Recruited to and Localize in the Tumor Micro-Environment
[0111] To investigate whether the fusion molecules of the present invention retain the capacity to be recruited to and localize in the tumor micro-environment, an evaluation is performed to determine whether the fusion molecules can be specifically delivered to the tumor site. For these studies, Mx2-luciferase reporter transgenic (TG) mice, described by Pulverer, J. E. et al. (Journal of Virology 2010 84:8626-8638), where the expression of luciferase is controlled by the IFN-inducible Mx2 promoter are used. These reporter mice, when injected intravenously with either type I or type III IFNs express luciferase in tissue-specific manner: type I IFNs induce luciferase expression predominantly in liver, whereas type III IFNs trigger luciferase expression in the gastro-intestinal tract (McElrath, C. et al. Cytokine 2016 87:141-141). His-tagged proteins are produced in HEK293 cells and purified to homogeneity. Intact and fusion IFN proteins are first injected into the reporter mice at various concentrations and the location and the duration of luciferase expression is monitored in live animals with the use of, for example, an Xenogen IVIS 200 Imaging System. Next, female mice are injected into mammary fat-pads with EO771 cells and after the tumors are established, the mice are injected with intact or Gas6 fusion IFN molecules and luciferase expression is evaluated in live animals. Under physiological conditions, uncleared apoptotic cells and PS-positive stressed cells are rarely observed, even in tissues with high rates of cellular turnover such as the thymus and spleen. This is because cells undergoing apoptosis as a part of normal homeostasis are very efficiently and robustly efferocytosed and PS is not detected in healthy tissues. Therefore, the PS-targeting of the fusion molecules of the present invention determined by this study is indicative of localized delivery of the designed fusion molecules to the sites where PS is up-regulated as a part of stress response and cancer, viral infection or inflammation.
Example 7: Evaluation of the Ability of Fusion Molecule to be Recruited to and Localize in the Tumor Micro-Environment and Virus Infection Site
[0112] Following purification to homogeneity, phosphorylatable IFN fusion molecules are radioactively labeled in vitro and injected through tail-vein or SQ injection into tumor bearing mice and mice infected with either respiratory influenza A virus or gastro-intestinal rotovirus, and the in vivo distribution of the labeled proteins is monitored by x-ray imaging and by measuring radioactivity distribution in various dissected tissues.
Example 8: Anti-Tumor Efficacies of Fusion Molecules in Two Mouse Models
[0113] The properties of fusion molecules of the present invention in altering the tumor microenvironment are compared in two independent and genetically amenable orthotopic transplantation models of breast cancer growth. These models include a 4T1 cell model (for the BALB/c mouse strain) and an EO771 cell model (for the C57BL/6 mouse strain). Both models reflect aggressive triple negative tumor breast models that recapitulate aspects of human breast cancer, including a low immunogenic potential and spontaneous metastasis to the lung. Moreover, both 4T1 and EO771 cells are believed to express all three TAMs, making these cancer models suitable to study tumors expressing PS receptors. 4T1 and EO771 cells constitutively expressing various intact or Gas6 fusion IFN molecules have been generated. Cell populations expressing comparable levels of IFN molecules are selected. The growth kinetics of the modified cells is first compared in vitro. For animal studies, 8 week-old syngeneic wild-type C57BL/6 (EO771) or BALB/c (4T1) female virgin mice are injected with 10.sup.5 murine breast cancer cell lines (re-suspended in 50% Matrigel) centrally in the right #4 inguinal mammary fat pad (n=12 mice/group). The volume of primary tumors is evaluated every other day and recorded. When primary tumors reach 1 cm.sup.3 volume, the mice are sacrificed and the lung metastasis is quantified. Lungs, bones, brain and other major organs are weighed and half snap-frozen and half fixed for further biochemical and histological analyses to study proliferation (Ki67), apoptosis (Tunnel), micro-vessels (CD31) and PASR staining. Laser micro-capture techniques will be used if needed to dissect the potential spontaneous metastases and perform biochemical analysis.
Example 9: Assessment of Effects of Fusion Molecule on Immune Cell Frequencies in the TME
[0114] Examining the subsets of immune cells in the TME and how they are altered by fusion molecules of the present invention offers mechanistic insight into their role in altering immune responses. It is expected that the fusion molecules will reverse inhibitory signals that impinge on host anti-tumor responses and reprogram the TME towards a more immune competitive milieu. To address these issues experimentally, a combination of Nanostring and IHC-based methods are used to probe the cellular frequency of PMNs, DCs, MPhs, NK and T cells in the TME and at the tumor margins. As such, when primary tumors are removed, portions are used to examine the margins by IHC and then enzymatically digested to isolate tumor and tumor-infiltrating cells to profile F4/80+ MPhs, GR1+ neutrophils, CD11+ DCs and T cells, myofibroblasts and endothelial cells (PECAM+ cells). Leukocyte (DCs, MPhs, NKs and T cells) infiltration and DC maturation status at the tumor site by immuno-staining cells followed by FACS analysis (BD LSR II) with specific markers such as CD86 (Alexa 350 labeling) for DCs, F4/80 (Alexa 405 labeling) for MPhs, and CD4+(PE-Cy7 labeling) and CD8+(Alexa 649 labeling) for T cells are also assessed. In addition, tumor-associated cytokines and chemokines are quantified by MSD-cytokine arrays (Meso Scale Diagnostics, Rockville, Md.).
Example 10: Assessment of Therapeutic Effects of Fusion Molecules in Animal Models of Tumor Growth
[0115] Fusion molecules demonstrating the strongest anti-tumor efficacy in the above-described models will be further tested as anti-cancer therapeutics. For these experiments, the fusion molecule will be produced and purified endotoxin-free with the use of His tag purification techniques in amounts sufficient for animal testing. For these experiments, parental 4T1 and EO771 tumors will be allowed to establish and grow to 0.3 cm.sup.3 volume and animals will be injected intravenously everyday with 1 ug of the selected purified fusion molecule. When effective tumor suppression is achieved, low doses and frequency of administration of the recombinant protein will be also tested.
Example 11: Assessment of Therapeutic Effects of Fusion Molecules in Animal Models of Virus Infection
[0116] Antiviral potency of PS-targeting IFN fusion molecules is tested using a mouse model of influenza A infection. Potencies are compared with intact IFNs. As a prophylaxis, mice are injected SQ or intranasally (IN) with various doses (0.1, 0.3, 1, 3, 10 g per adult 20 mg eight-week old mouse; PBS is used as a control mock treatment) 8 or 24 hours preceding infection of mice with 1 LD.sub.50 of influenza A virus strain PR8, WSN, Udorn or other strains. Survival and weight loss are monitored daily. In addition, in a separate experiment, viral titers and lung histopathology at days 3, 6, and 9 post infection are assessed. Histopathology is used to assess pathology. IHC staining for viral antigen is used to determine whether treatment has altered the pattern of virus spread. Optimal IFN treatment for enhancing survival post infection is also assessed. In this experiment, the effects of treatment after infection with influenza A virus (1 LD50 strain PR8, WSN, Udorn or other strains) is tested with multiple dosing regimens. As above, mice are treated with IFN fusion molecules, single IFN or their combination injected SQ or intranasally (IN) with various doses (0.1, 0.3, 1, 3, 10 g per adult 20 mg eight-week old mouse; PBS will be used as a control mock treatment). Infected mice are treated according to the following schedules: days 1, 3, 5; 1-4; 2, 4, 6; 2-5. Mice are analyzed as above, to gauge antiviral protection as well as disease progression.
Example 12: Evaluation of the Ability of Fusion Molecules to Inhibit Signaling of Intact TAM Ligands Through TAM Receptors
[0117] TAM reporter cell lines (Tyro3/IFN-R1, Axl/IFN-R1 and Mertk/IFN-R1) are treated with intact -carboxylated Gas6 and Prost in the presence or absence of the Gas6-IFN fusion molecules given in excess. The ability of the fusion molecules to block TAM receptor activation by endogenous intact ligands is assessed by measuring reduction in Stat1 activation (pStat1).