Composition and Application of Arginine-depleting Agents for Cancer, Obesity, Metabolic Disorders, and Related Complications and Comorbidities
20200181597 ยท 2020-06-11
Inventors
Cpc classification
A61P29/00
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
C12N9/78
CHEMISTRY; METALLURGY
C07K2319/31
CHEMISTRY; METALLURGY
A61P5/50
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
C12N9/78
CHEMISTRY; METALLURGY
A61P29/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61P5/50
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
Abstract
The present disclosure relates to arginase albumin binding domain (ABD) fusion proteins and methods of preparation and use thereof. Also provided are methods involving arginine depletion for the treatment of obesity, metabolic disorders, and related complications and comorbidities.
Claims
1. A fusion protein comprising an albumin binding domain (ABD) polypeptide and an arginase polypeptide.
2. The fusion protein of claim 1, wherein the ABD polypeptide comprises a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 66, SEQ ID NO: 67, or SEQ ID NO: 68.
3. The fusion protein of claim 1, wherein the arginase polypeptide comprises a polypeptide sequence having at least 95% sequence homology with SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, or SEQ ID NO: 72.
4. The fusion protein of claim 1, wherein the ABD polypeptide comprises a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 66, SEQ ID NO: 67, or SEQ ID NO: 68 and the arginase polypeptide comprises a polypeptide sequence having at least 95% homology with SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, or SEQ ID NO: 72.
5. The fusion protein of claim 4, wherein the ABD polypeptide comprises a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 66 and the arginase polypeptide comprises a polypeptide sequence having at least 95% sequence homology with SEQ ID NO: 69.
6. The fusion protein of claim 5, further comprising a peptide linker connecting the C-terminal of the ABD polypeptide and N-terminal of the arginase polypeptide, wherein the peptide linker is a linear polypeptide having between 1-20 amino acids.
7. The fusion protein of claim 6, wherein the peptide linker comprises a polypeptide sequence having at least 90% sequence homology with SEQ ID NO: 73 or SEQ ID NO: 74.
8. The fusion protein of claim 6, wherein the ABD polypeptide comprises a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 67 and the arginase polypeptide comprises a polypeptide sequence having at least 95% homology with SEQ ID NO: 72.
9. The fusion protein of claim 8, wherein the peptide linker is a poly-histidine linker having between 4-8 histidine amino acids.
10. The fusion protein of claim 1, wherein the fusion protein comprises a polypeptide sequence having at least 98% sequence homology with SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 75, or SEQ ID NO: 76.
11. The fusion protein of claim 1, wherein the fusion protein comprises a polypeptide sequence having at least 98% sequence homology with SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 75, and SEQ ID NO: 76.
12. The fusion protein of claim 1, wherein the fusion protein comprises a polypeptide selected from the group consisting of SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 75, and SEQ ID NO: 76.
13. A pharmaceutical composition comprising the fusion protein of claim 1 and a pharmaceutically acceptable carrier, excipient, or combination thereof.
14. A method of treating cancer in a subject in need thereof comprising the step of administering a therapeutically effective amount of a fusion protein of claim 1 to the subject.
15. A method of treating at least one condition selected from the group consisting of obesity, a metabolic disorder, and a related complication in a subject in need thereof comprising the step of administering a therapeutically effective amount of an arginine depleting agent to the subject.
16. The method of claim 15, wherein the metabolic disorder is selected from the group consisting of obesity, glucose intolerance, hyperglycemia, diabetes mellitus and the related complication is one or more conditions selected from the group consisting of diabetic nephropathy, diabetic retinopathy, diabetic vasculopathy, diabetic neuropathy, hypercholesterolemia, dyslipidemia, steatosis, steatohepatitis, fibrosis, cirrhosis, inflammation, hypertension, cardiovascular disease, and whitening of brown fat.
17. The method of claim 15, wherein the metabolic disorder is insulin resistance.
18. The method of claim 15, wherein the treatment of obesity comprises at least one of preventing fat mass gain and reducing fat mass.
19. The method of claim 15, wherein the metabolic disorder is selected from the group consisting of hepatic steatosis, renal steatosis, pancreatic steatosis and cardiac steatosis.
20. The method of claim 15, wherein the arginine concentration in the subject's serum is maintained below 50 M.
21. The method of claim 15, wherein the arginine depleting agent is an arginine catabolic enzyme.
22. The method of claim 21, wherein the arginine catabolic enzyme is an arginase protein, an arginine deiminase protein, or an arginine decarboxylase protein.
23. The method of claim 22, wherein the arginase protein, arginine deiminase protein, or arginine decarboxylase protein further comprises one or more polyethylene glycol (PEG) groups.
24. The method of claim 23, wherein the arginase protein comprises a polypeptide having SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, or SEQ ID NO: 104.
25. The method of claim 22, wherein the arginase protein, arginine deiminase protein, or arginine decarboxylase protein further comprises an albumin binding domain Or human serum albumin, or a human IgG Fc domain.
26. The method of claim 25, wherein the arginine catabolic enzyme is a fusion protein comprising an ABD polypeptide and an arginase polypeptide; an ABD polypeptide and an arginine deiminase polypeptide; or an ABD polypeptide and an arginine decarboxylase polypeptide.
27. The method of claim 26, wherein the arginine catabolic enzyme is the fusion protein of claim 1.
28. The method of claim 27, wherein the arginine catabolic enzyme comprises a polypeptide having at least 98% sequence homology with SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 75, or SEQ ID NO: 76.
29. A method of treating at least one condition selected from the group consisting of viral infections, multiple sclerosis, rheumatoid arthritis, autoimmune diseases, congenital hyperargininemia, graft-versus-host disease (GvHD) and inflammation in a subject in need thereof comprising the step of administering a therapeutically effective amount of a fusion protein of claim 1 to the subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0040] The above and other objects and features of the present disclosure will become apparent from the following description of the invention, when taken in conjunction with the accompanying drawings, in which:
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
DETAILED DESCRIPTION
[0116] The present disclosure generally relates to fusion proteins comprising an arginase polypeptide and an ABD polypeptide and methods of use and preparation thereof. The fusion proteins provided herein are highly effective arginine depleting agents, and due to fusion with an ABD polypeptide, exhibit a vastly extended half-life in comparison with known arginase and arginase derivatives. The disclosed fusion proteins are useful for treating diseases and conditions in which depletion of arginine results in a therapeutic effect, such as in the treatment of cancer, viruses, multiple sclerosis, rheumatoid arthritis, autoimmune diseases, congenital hyperargininemia, graft-versus-host disease (GvHD), inflammation, obesity, metabolic disorders, and related complications and comorbidities.
[0117] The present disclosure also generally relates to methods of treating obesity, metabolic disorders, and related complications and comorbidities in a subject in need thereof by depleting the level of arginine in the subject. Depletion of arginine in the subject results in reduction of weight and fat mass, improvement of glucose tolerance and insulin responsiveness, normalization of blood glucose levels, endocrine and metabolic profiles, and alleviation of inflammation, steatosis, and fibrosis. Any agent capable of depleting arginine in a subject can be used in the methods of treating obesity, metabolic disorders, and related complications and comorbidities described herein.
Definition of Terms
[0118] The definitions of terms used herein are meant to incorporate the present state-of-the-art definitions recognized for each term in the field of biotechnology. Where appropriate, exemplification is provided. The definitions apply to the terms as they are used throughout this specification, unless otherwise limited in specific instances, either individually or as part of a larger group.
[0119] As used herein, the term half-life or -life refers to the time that would be required for the concentration of an agent, e.g., a fusion protein or arginine depleting agent as described herein, to fall by half in vitro or in vivo, for example, after injection into a mammal. In certain instances, the concentration of plasma arginine, after injection, is used herein as a proxy indicator of the half-life of the agent. In such instances, the term therapeutic duration is used to refer to the length of time a specified dosage of the arginine depleting agent is able to maintain the plasma concentration of arginine below a specified threshold concentration that a desired therapeutic effect is observed. In certain embodiments, the threshold concentration of plasma arginine is below 50 M, below 40 M, below 30 M, below 20 M, below 10 l\4, below 5 M, below 3 M, or at a concentration below the detection limit of conventional analytical instrumentation. For example, depletion of plasma arginine to concentrations below the detection limit of the Biochrom 30 Amino Acid Analyzer (detection limit is 3 M) for 7 days upon injection of an arginine catabolic enzyme described herein indicates a therapeutic duration of 7 days and a half-life, e.g., on the order of around 7 days.
[0120] The term attach or attached as used herein, refers to connecting or uniting by a bond or non-bonding interaction in order to keep two or more compounds together, which encompasses either direct or indirect attachment such that for example where a first polypeptide is directly bound to a second polypeptide or other molecule, and the embodiments wherein one or more intermediate compounds (e.g., a linker), such as a polypeptide, is disposed between the first polypeptide and the second polypeptide or other molecule.
[0121] The term protein or polypeptide as used herein indicates an organic polymer composed of two or more amino acid monomers and/or analogs thereof. The term polypeptide includes amino acid polymers of any length including full length proteins and peptides, as well as analogs and fragments thereof. A polypeptide of three or more amino acids is also called an oligopeptide. As used herein, the term amino acid, amino acidic monomer, or amino acid residue refers to any of the twenty naturally occurring amino acids including synthetic amino acids with unnatural side chains and including both D and L optical isomers. The term amino acid analog refers to an amino acid in which one or more individual atoms have been replaced, either with a different atom, isotope, or with a different functional group but is otherwise identical to its natural amino acid analog.
[0122] As used herein, the term unnatural amino acid refers to any amino acid, modified amino acid, and/or amino acid analogue that is not one of the 20 common naturally occurring amino acids, seleno cysteine or pyrrolysine.
[0123] As used herein, the term fusion protein refers to a chimeric protein containing proteins or functional protein fragments (e.g., arginase or variants thereof) having different origins that are covalently linked, e.g., by an amide, ester, urea, carbamate, ether, and/or disulfide bond.
[0124] As used herein, the term variant refers to a polynucleotide or nucleic acid differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to the reference nucleic acid or polypeptide.
[0125] A variant can, for example, comprise the amino acid sequence of the parent polypeptide sequence with at least one conservative amino acid substitution. Alternatively or additionally, the variant can comprise the amino acid sequence of the parent polypeptide sequence with at least one non-conservative amino acid substitution. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with or inhibit the biological activity of the functional variant. The non-conservative amino acid substitution may enhance the biological activity of the variant, such that the biological activity of the variant is increased as compared to the parent polypeptide.
[0126] The term functional fragment when used in reference to a polypeptide refers to any part or portion of the subject polypeptide, which part or portion retains the biological activity of the polypeptide of which it is a part (the parent polypeptide). The functional fragment can be any fragment comprising contiguous amino acids of the polypeptide of which it is a part, provided that the functional fragment still exhibits at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% or has substantially the same or even higher biological activity of the parent polypeptide. In reference to the parent polypeptide, the functional fragment can comprise, for instance, about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or more, of the parent polypeptide.
[0127] The functional fragment can comprise additional amino acids at the amino or carboxy terminus, or at both termini, e.g., amino acids not found in the amino acid sequence of the parent polypeptide.
[0128] Amino acid substitutions of the described polypeptides can be conservative amino acid substitutions. Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties. For instance, the conservative amino acid substitution can be an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, Ile, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.), a basic/positively charged polar amino acid substituted for another basic/positively charged polar amino acid (e.g. Lys, His, Arg, etc.), an uncharged amino acid with a polar side chain substituted for another uncharged amino acid with a polar side chain (e.g., Asn, Gln, Ser, Thr, Tyr, etc.), an amino acid with a beta-branched side-chain substituted for another amino acid with a beta-branched side-chain (e.g., Ile, Thr, and Val), an amino acid with an aromatic side-chain substituted for another amino acid with an aromatic side chain (e.g., His, Phe, Trp, and Tyr), etc.
[0129] The terms percentage homology and percentage sequence identity, when used in reference to a polypeptide or polynucleotide sequence, are used interchangeably herein to refer to comparisons among polynucleotides and polypeptides, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Homology is evaluated using any of the variety of sequence comparison algorithms and programs known in the art. Such algorithms and programs include, but are by no means limited to, TBLASTN, BLASTP, FASTA, TFASTA, and CLUSTALW [Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85(8):2444-2448; Altschul et al., 1990, J. Mol. Biol. 215(3):403-410; Thompson et al., 1994, Nucleic Acids Res. 22(2):4673-4680; Higgins et al. 1996, Methods Enzymol. 266:383-402; Altschul et al., 1990, J. Mol. Biol. 215(3):403-410; Altschul et al., 1993, Nature Genetics 3:266-272]. In certain embodiments, protein and nucleic acid sequence homologies are evaluated using the Basic Local Alignment Search Tool (BLAST) which is well known in the art (see, e.g., Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA 87:2267-2268; Altschul et al., 1990, J. Mol. Biol. 215:403-410; Altschul et al., 1993, Nature Genetics 3:266-272; Altschul et al., 1997, Nuc. Acids Res. 25:3389-3402).
[0130] As used herein, the terms treat, treating, treatment, and the like refer to reducing or ameliorating a disorder/disease and/or symptoms associated therewith. It will be appreciated, although not precluded, treating a disorder or condition does not require that the disorder, condition, or symptoms associated therewith be completely eliminated. In certain embodiments, treatment includes prevention of a disorder or condition, and/or symptoms associated therewith. The term prevention or prevent as used herein refers to any action that inhibits or at least delays the development of a disorder, condition, or symptoms associated therewith. Prevention can include primary, secondary and tertiary prevention levels, wherein: a) primary prevention avoids the development of a disease; b) secondary prevention activities are aimed at early disease treatment, thereby increasing opportunities for interventions to prevent progression of the disease and emergence of symptoms; and c) tertiary prevention reduces the negative impact of an already established disease by restoring function and reducing disease-related complications.
[0131] As used herein the term catabolism or catabolic refers to the chemical reaction of a molecule into other, e.g., smaller, molecules. For example, arginine catabolic enzymes refer to any enzyme capable of reacting with arginine thereby transforming it into other molecules, such as ornithine, citrulline, and agmatine.
[0132] As used herein, the term subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, and rodents.
[0133] As used herein the term body mass index or BMI means the ratio of weight in Kg divided by the height in meters, squared.
[0134] As used herein the term overweight refers to a BMI between 25 and 30 in adult humans. For people under 20 overweight is defined as a BMI between the 85th and 95th percentile compared to people of the same age.
[0135] As used herein the term obesity refers to a BMI between 30 and 40 in adult humans. For people under 20 obesity is defined as a BMI above the 95th percentile compared to people of the same age. As used herein, the term can include both obesity and morbid obesity.
[0136] As used herein the term morbid obesity refers to a BMI greater than 40 in adult humans.
[0137] As used herein, the term steatosis refers to the condition in which fat accumulates in tissues, such as liver tissue, kidney tissue, pancreas tissue, heart muscle tissue or other muscle tissues.
[0138] As used herein, the term fibrosis refers to the condition in which there is excess deposition of fibrous connective tissue, including collagen, in an organ or tissue, such as liver tissue, kidney tissue, pancreas tissue or heart tissue.
[0139] The term hypercholesterolemia, as used herein, refers to a condition in which levels of blood cholesterol are elevated in comparison to the normal average level of blood cholesterol in a respective reference subject of the same ethnic background, age, and gender. With regard to humans the term in particular refers to blood levels of total cholesterol above about 200, in particular above about 240 mg/dL.
[0140] The terms dyslipidemia and hyperlipidemia as used herein, refers to a condition in which the level of lipids/fats including cholesterol, cholesterol esters, phospholipids, triglycerides and/or lipoproteins in the blood stream are respectively abnormal and elevated in comparison to the normal average level of blood lipids/fats in a respective reference subject of the same ethnic background, age, and gender.
[0141] The fusion proteins provided herein comprise an arginase polypeptide. The arginase polypeptide can be derived from an arginase protein expressed by any organism that expresses arginase. Exemplary arginases include those that are produced by bacteria, such as bacilli, agrobacteria, cyanobacteria, and mycobacteria, and mammals, such as bovine, porcine, sheep, goat, rodents and humans. When the arginase polypeptide is derived from human arginase, it can be arginase type 1 (ARG1) or arginase type 2 (ARG2).
[0142] The arginase polypeptide can comprise a full length arginase polypeptide or a functional fragment and/or variant thereof.
[0143] Arginase is a manganese-containing enzyme. As demonstrated in the Example 32, when one or more of the manganese ions present in the fusion proteins described herein are replaced with one or more divalent cationic metal, such as Co.sup.2+ or Ni.sup.2+, the catalytic activity of the fusion protein can increase. Accordingly, in certain embodiments, the fusion proteins described herein comprise one or more divalent metals, other than manganese, such as Co.sup.2+ or Ni.sup.2+. In certain embodiments, the fusion protein comprises one or more metals selected from Co.sup.2+ and Ni.sup.2+. In certain embodiments, the fusion protein comprises two Co.sup.2+ ions or two Ni.sup.2+ ions. In other embodiments, the fusion protein comprises two Mn.sup.2+ ions.
[0144] In certain embodiments, the arginase polypeptide is wild type human ARG1. In certain embodiments, the arginase polypeptide comprises a sequence with at least 95% sequence homology to SEQ ID NO: 69. For example, the arginase polypeptide can comprise at a polypeptide sequence with at least 96%, 97%, 98%, 99%, 99.1%, 99.4% or 99.7% homology to SEQ ID NO: 69. In certain embodiments, the sequence of the arginase polypeptide can differ from SEQ ID NO: 69 by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or 30 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the arginase polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0145] In certain embodiments, the arginase polypeptide is Bacillus caldovelox arginase (BCA). In certain embodiments, the arginase polypeptide comprises a sequence with at least 95% sequence homology to SEQ ID NO: 70. For example, the arginase polypeptide can comprise at a polypeptide sequence with at least 96%, 97%, 98%, 99%, 99.3%, or 99.7% homology to SEQ ID NO: 70. In certain embodiments, the sequence of the arginase polypeptide can differ from SEQ ID NO: 70 by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or 30 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the arginase polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0146] In certain embodiments, the arginase polypeptide is BCA, wherein serine 161 is replaced by a cysteine as presented in SEQ ID NO: 71 and SEQ ID NO: 72. The substitution of serine with a cysteine allows for the sited directed incorporation of chemical moieties that can further improve the properties of the fusion protein. For example, the side chain of cysteine 161 can be reacted with an appropriately activated PEG moiety thereby forming a PEGylated arginase, which can be incorporated into the resulting fusion protein. PEGylation of the fusion protein has the ability to further enhance the retention time of the fusion proteins described herein by further protecting them against various degrading mechanisms active inside a tissue or cell, which consequently improves their therapeutic potential. Accordingly, in certain embodiments the arginase polypeptide comprises a sequence with at least 95% sequence homology to SEQ ID NO: 71 or SEQ ID NO: 72. For example, the arginase polypeptide can comprise at a polypeptide sequence with at least 96%, 97%, 98%, 99%, 99.3%, or 99.7% homology to SEQ ID NO: 71 or SEQ ID NO: 72. In certain embodiments, the sequence of the arginase polypeptide can differ from SEQ ID NO: 71 or SEQ ID NO: 72 by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or 30 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the arginase polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0147] In instances where the fusion proteins described herein are PEGylated, the PEG group can have a molecular weight of about 5,000 to about 20,000 amu, about 5,000 to about 15,000 amu, about 5,000 to about 12,000 amu, about 7,000 to about 12,000 amu, or about 7,000 to about 10,000 amu. In certain embodiments, the PEG group has a molecular weight of about 4,000 amu to 10,000 amu. In certain embodiments, the PEG group is PEG4,000 or PEG7,000.
[0148] The PEG group can be covalently attached directly to the fusion protein or via a linker. PEG group can be covalently attached to the fusion protein by reaction of a cysteine or lysine side chain present on the protein with a PEGylation reagent. Alternatively, the PEG group can be covalently attached to the N-terminal amine of the protein.
[0149] In certain embodiments, the fusion protein is covalently attached via a propionic acid linker to PEG. In other embodiments, the fusion protein is covalently attached via a C2-C10, C2-C9, C2-C8, C2-C7, C2-C6, C2-C5, or C2-C4 straight or branched chain carboxylic acid linker to PEG. In certain embodiments, the PEG group is attached to the arginase polypeptide.
[0150] The fusion proteins described herein also comprise an albumin binding domain (ABD) polypeptide. A number of studies have demonstrated the potential of albumin binding to achieve longer half-lives of therapeutic proteins. However, the design of fusion proteins including ABD polypeptides can be challenging, because fusion of the ABD polypeptide to the protein therapeutic has the potential to affect both the efficacy of the protein therapeutic, the binding affinity of the ABD polypeptide, and the solubility of the fusion protein. Accordingly, the selection of the ABD polypeptide, its site of attachment, and the construction of any necessary linkers is not a straight forward process and often times requires trial and error in order to arrive at a fusion property with the desired properties. For example,
[0151] Longer action of a drug is generally desirable. The linker type, length, flexibility, and fusion of the bioactive peptide or protein to the C or N terminus of the half-life-extension module, can have profound effects on the activity of a fusion protein. In the present disclosure, various arginases were fused to ABD molecules via a suitable linker so that both the arginase enzymatic activity and the albumin binding ability of ABD can be retained. Good stability and solubility are also essential. This is very difficult and challenging to achieve. Unlike the common HSA or Fc fusions, very little is known about the ABD fusions. The present disclosure provides examples of the linker design that can be used to generate functional arginase-ABD fusions. The activity of the engineered arginase fusion proteins (N-ABD094-rhArg, N-ABD-rhArg, etc) have been optimized in the present disclosure either through linker engineering or the position of the bioactive protein (arginase) with respect to the half-life-extension module (ABD), or both.
[0152] In many cases, protein engineering can be used to overcome the loss of activity. In one example, linker engineering was used to regain activity lost upon fusion of IFN-2b to HSA [Prot Exp Purif. 2008; 61:73-7]. A direct fusion of IFN-2b to HSA resulted in an unstable protein with very little biological activity. In a fusion format, the effects of various linkers on the activity of IFN-2b were tested. Peptide linkers are known to have an influence on the expression, activity, and pharmacokinetics of fusion proteins [Adv Drug Deliv Rev. 2013; 65:1357-69]. The two major types of peptide linkers are: (i) flexible linkers (e.g., (G4S)n, where n=1-4); (ii) rigid linkers such as the -helical linker [A(EAAAK)nA]x (where n=2-4 and x=1 or 2), and XPn (where X is either A, K or E). For flexible linkers, one advantage is that the flexibility may be required to obtain proper orientation of the bioactive portion of the molecule with respect to its cognate receptor. However, flexible linkers do not give a lot of space between the fusion partner and the bioactive protein. On the other hand, rigid linkers provide more space but lack the flexibility. In the case of the IFN-2b-HSA fusion protein, the flexible linker resulted in approximately 39% activity as compared with that of native IFN-2b, whereas the rigid XP linker and the -helical linker resulted in 68 and 115% of the activity of native IFN-2b, respectively [Prot Exp Purif. 2008; 61:73-7].
[0153] Certain linkers can have a negative impact on fusion protein properties. For example, granulocyte colony-stimulating factor (G-CSF) was fused to transferrin (Tf). The use of a short leucine-glutamate (LE) linker resulted in only approximately 10% of the activity of native G-CSF. Insertion of a (G4S)3 or -helical [A(EAAAK)nA]m (n=2-4, m=1 or 2) linker significantly increased the activity of the fusion proteins over that of G-CSF-LE-Tf. The fusion protein constructed with the linker (A(EAAAK)4ALEA-(EAAAK)4A) resulted in biological activity near to that of native G-CSF [Pharm Res. 2006; 23:2116-21]. In another example, while the C-terminus of the Fc moiety may be directly linked to the N-terminus of the IFN- moiety via a peptide bond, Gillies et al. [U.S. Pat. No. 7,670,595 B2] additionally connects the Fc moiety and the IFN- moiety via a linker peptide. The linker peptide is located between the C-terminus of the Fc moiety and the N-terminus of the mature IFN- moiety. In this case, the linker peptide is preferably composed of serine and glycine residues such as the amino acid sequence G4SG4SG3SG. All these findings demonstrate the importance of testing linker technology for the success of fusion protein research and development programs.
[0154] Using a different approach, the importance of fusion position for activity has been demonstrated [Curr Pharmaceut Biotechnol. 2014; 15:856-63]. The brain natriuretic peptide (BNP) was fused to either the N or C terminus of HSA in various formats. The results showed that BNP-HSA, BNP2-HSA (two copies of BNP), and BNP4-HSA, all fused to the N terminus of HSA, were not active. However, HSA-BNP2, fused to the C-terminus of HSA, was as active as native BNP and long-lasting.
[0155] These examples demonstrate the importance of having a significant effort in lead optimization of fusion proteins to optimize the activity either through linker engineering, the position of the bioactive protein or peptide with respect to the half-life-extension module, or both. Importantly, the present invention used a new ABD fusion approach to join an ABD and an arginase together so that arginase activity can be retained. Stable and soluble arginase-ABD fusion molecules that can bind to FcRn in a pH-dependent manner were successfully generated, allowing for efficient endosomal recycling. For example, the present disclosure surprisingly found that for the rhArg fused to ABD, the terminal half-life in circulation of the protein dramatically increased from a few minutes to 4 days in mice. Taken together, a variety of different approaches are available for fine-tuning the pharmacokinetic properties of arginases, ensuring appropriate residence time in circulation for different disease conditions. Another key issue in the development of any therapeutic protein is to minimize immunogenicity to avoid adverse effects. Thus, the observed low immunogenicity of human arginase and the successful deimmunization of ABD (e.g. ABD094), which was also used in the present disclosure as gene fusion partner to extend the in vivo half-life, are important.
[0156] The albumin binding protein is a three-helical protein domain found in various surface proteins expressed by Gram positive bacteria. The albumin binding protein derived from Streptococcal protein G has 214 amino acids and contains three albumin binding domains (ABD1-3), which are used to bind to human serum albumin and evade the immune system of a host. ABD3 corresponds to a 46 amino acid sequence, which has been demonstrated to bind to human serum albumin and has been the subject of a number of studies and affinity maturation for human serum albumin to develop. ABD polypeptides with differing properties, such as binding affinity and binding selectivity. Such studies have generated a substantial number of ABD polypeptides with widely varying properties.
[0157] Albumin binding proteins are found in other bacteria. For example, naturally occurring albumin binding proteins include certain surface proteins from Gram positive bacteria, such as Streptococcal M proteins (e.g. M1/Emml, M3 Emm3, M12/Emm12, EmmL55/Emm55, Emm49/EmmL49 and Protein H), streptococcal proteins G, MAG and ZAG, and PPL and PAB from certain strains of Finegoldia magna.
[0158] In certain embodiments, the fusion proteins described herein comprise an ABD polypeptide that is derived from a Streptococcal protein G albumin binding domain. In certain embodiments, the ABD polypeptide is the full Streptococcal protein G albumin binding domain 3 or a functional fragment and/or variant thereof.
[0159] In certain embodiments, the fusion protein comprises an ABD polypeptide comprising a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 66. For example, the ABD polypeptide can comprise at a polypeptide sequence with at least 94%, 96%, or 98% homology to SEQ ID NO: 66. In certain embodiments, the sequence of the ABD polypeptide can differ from SEQ ID NO: 66 by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the ABD polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0160] In certain embodiments, the fusion protein comprises an ABD polypeptide comprising a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 67. For example, the ABD polypeptide can comprise at a polypeptide sequence with at least 94%, 96%, or 98% homology to SEQ ID NO: 67. In certain embodiments, the sequence of the ABD polypeptide can differ from SEQ ID NO: 67 by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the ABD polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0161] In certain embodiments, the fusion protein comprises an ABD polypeptide comprising a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 68. For example, the ABD polypeptide can comprise at a polypeptide sequence with at least 93%, 95%, or 97% homology to SEQ ID NO: 68. In certain embodiments, the sequence of the ABD polypeptide can differ from SEQ ID NO: 68 by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid modifications (e.g., insertion, substitution, deletion, etc.). In certain embodiments, the ABD polypeptide comprises a polypeptide with conservative amino acid replacements, non-conservative amino acid replacements, or a combination thereof.
[0162] The relative position of the ABD polypeptide and arginase polypeptide can vary. For example, the ABD polypeptide can precede the arginase polypeptide (e.g., the arginase polypeptide can be attached either directly or indirectly from the C-terminal of the ABD polypeptide) or the arginase polypeptide can precede the ABD polypeptide (e.g., the ABD polypeptide can be attached either directly or indirectly from the C-terminal of the arginase polypeptide).
[0163] In certain embodiments, the fusion protein can include one or more arginase polypeptides and/or one or more ABD polypeptides. For example, the fusion protein can have the general structure ABD-rhArg-ABD, ABD094-rhArg-ABD094, ABD-BCA-ABD, ABD094-BCA-ABD094, rhArg-ABD-rhArg, rhArg-ABD094-rhArg, BCA-ABD-BCA, or BCA-ABD094-BCA.
[0164] The ABD polypeptide and the arginase polypeptide can be attached by direct covalent attachment or indirectly attached via a peptide linker.
[0165] The peptide linker or linker is a polypeptide typically ranging from about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids in length, which is designed to facilitate the functional connection of the ABD polypeptide and arginase polypeptide into a linked fusion protein. The term functional connection denotes a connection that facilitates proper folding of the polypeptides into a three dimensional structure that allows the linked fusion protein to exhibit some or all of the functional aspects or biological activities of the protein(s) from which its polypeptide constituents are derived.
[0166] The polypeptide linker can be disposed between the N-terminal of the ABD polypeptide and the C-terminal of the arginase polypeptide or alternatively disposed between the N-terminal of the arginase polypeptide and the C-terminal of the ABD polypeptide.
[0167] The peptide linker can comprise naturally occurring amino acids, unnatural amino acids, and combinations thereof.
[0168] In certain embodiments, the peptide linker can comprise glycine, serine, asparagine, or a combination thereof. Exemplary peptide linkers include linkers containing poly-glycine, (GS).sub.n, and (GGS).sub.n, wherein n is 1-30 Additional exemplary peptide linkers include flexible linkers (e.g., (G.sub.4S).sub.n, wherein n=1-4), or rigid linkers (e.g., the alpha-helical linker [A(EAAAK).sub.nA].sub.x, wherein n=2-4 and x=1 or 2; and XPn, wherein X is either A, K or E and n=1-10). In certain embodiments, the peptide linker is (A(EAAAK).sub.4ALEA-(EAAAK).sub.4A) (SEQ ID NO: 105), G.sub.4SG.sub.4SG.sub.3SG (SEQ ID NO: 106), GS(N).sub.nGSG, where n=1-10, and GS(Q).sub.nGSG, where n=1-10, and the like. In certain embodiments, the peptide linker comprises a polypeptide sequence having at least 90% sequence homology with SEQ ID NO: 73. For example, peptide linker can comprise a polypeptide having at least a 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence homology or is identical to SEQ ID NO: 73.
[0169] In certain embodiments, the peptide linker can comprise glycine, serine, asparagine, or a combination thereof. In certain embodiments, the peptide linker comprises a polypeptide sequence having at least 90% sequence homology with SEQ ID NO: 74. For example, peptide linker can comprise a polypeptide having at least a 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence homology or is identical to SEQ ID NO: 74.
[0170] Purification tags can be used to improve the ease of purifying the fusion protein, such as by affinity chromatography. A well-known purification tag is the hexa-histidine (6His) tag, which is a sequence of six histidine residues. Thus, in certain embodiments, the fusion protein further comprises a poly-histidine comprising 4-8 histidine amino acids, e.g., the 6 His tag. The poly-histidine can be present at the C-terminal of the fusion protein, the N-terminal of the fusion protein, or disposed in between ABD polypeptide and the arginase polypeptide.
[0171] When the poly-histidine is disposed in between the ABD polypeptide and the arginase polypeptide it can act as a peptide linker or can be included in addition to the peptide linker. For example, the fusion protein of SEQ ID NO 75 includes a six histidine polypeptide linker at position 300-305, which serves to link the ABD polypeptide and the arginase polypeptide and advantageously can be used to purify the fusion protein by affinity chromatography.
[0172] The poly-histidine tag can be optionally removed after purification is complete using techniques generally known in the art. For example, exopeptidases can be used to remove N-terminal poly-histidine tags (e.g., Qiagen TAGZyme) and C-terminal poly-histidine tags can be preceded by a suitable amino acid sequence that facilitates a removal of the poly-histidine-tag using endopeptidases. Thus, fusion proteins excluding the N-terminal and/or C-terminal poly-histidine tag are encompassed within the scope of this disclosure.
[0173] In certain embodiments, the ABD polypeptide comprises a polypeptide sequence having at least 93% sequence homology with SEQ ID NO: 66, SEQ ID NO: 67, or SEQ ID NO: 68 and the arginase polypeptide comprises a polypeptide sequence having at least 95% homology with SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, or SEQ ID NO: 72. For example, the ABD polypeptide comprises a polypeptide sequence having at least 94%, 95%, 96%, 97%, 98%, or 99% sequence homology or is identical with SEQ ID NO: 66, SEQ ID NO: 67, or SEQ ID NO: 68 and the arginase polypeptide comprises a polypeptide sequence having at least 96%, 97%, 98%, or 99% sequence homology or is identical with SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, or SEQ ID NO: 72.
[0174] In certain embodiments, the ABD polypeptide comprises a polypeptide sequence having at least 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence homology or is identical with SEQ ID NO: 66 and the arginase polypeptide comprises a polypeptide sequence having at least 95%, 96%, 97%, 98%, or 99% sequence homology or is identical with SEQ ID NO: 69.
[0175] In certain embodiments, the fusion protein further comprises a peptide linker comprising a polypeptide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence homology or identical with SEQ ID NO: 73 or SEQ ID NO: 74.
[0176] Exemplary fusion proteins include fusion proteins having at least 95%, 96%, 97%, 98%, or 99% homology or are identical with SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 75, and SEQ ID NO: 76.
[0177] The therapeutic duration of the fusion protein's effect on the concentration of plasma arginine is dependent on the amount of the fusion protein administered and can be about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15 days or more. In certain embodiments, the therapeutic duration of the fusion protein is between about 5 days to about 20 days, about 5 days to about 19 days, about 5 days to about 18 days, about 5 days to about 17 days, about 5 days to about 16 days, about 5 days to about 15 days, about 6 days to about 15 days, about 7 days to about 15 days, about 7 days to about 14 days, about 7 days to about 13 days, about 7 days to about 12 days, about 7 days to about 11 days, or about 8 days to about 11 days.
[0178] In certain embodiments, the half-life of the fusion protein is about 1 day to about 10 days, about 1 day to about 9 days, about 1 day to about 8 days, about 1 day to about 7 days, about 1 day to about 6 days, about 1 day to about 5 days, about 1 day to about 4 days, about 1 day to about 3 days, or about 1 day to about 2 days. In the other embodiments, the half-life of the fusion protein is about 6 hours to about 30 hours.
[0179] The arginase activity of the fusion proteins described herein can be substantially the same, lower, or higher than the activity of the arginase polypeptide from which it is derived. One unit of arginase activity is defined as the amount of fusion protein [e.g., BHA (SEQ ID NO; 75), BAH (SEQ ID NO: 76), N-ABD-rhArg (SEQ ID NO: 49), or N-ABD094-rhArg (SEQ ID NO: 50)] or arginase [e.g., BCA (SEQ ID NO: 70)] that catalyzes the production of 1 mol of urea per min under standard assay conditions. The specific activity of the enzyme is expressed as activity units per mg of protein. Under standard diacetylmonoxime (DAMO) assay conditions (37 C., pH 7.4), the fusion proteins can have a specific activity that is about 5%, about 10%, about 15%, about 20%, about 25% about 30%, about 35% or about 40% lower or higher than the corresponding arginase polypeptide which it incorporates. In certain embodiments, fusion proteins can have a specific activity that is about 5% to about 40%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 20% to about 30%, about 20% to about 35%, about 15% to about 30%, about 15% to about 25%, or about 10% to about 20% lower or higher than the corresponding arginase polypeptide which it incorporates.
[0180] In certain embodiments, the arginase activity of the fusion proteins is substantially unaffected by the presence of HSA. This is advantageous, because binding of the ABD fusion proteins to HSA can have a deleterious effect on the activity of the fusion protein.
[0181] Also provided are polynucleotide sequences encoding the fusion proteins described herein as isolated polynucleotides or as portions of expression vectors or as portions of linear DNA sequences, including linear DNA sequences used for in vitro transcription/translation, vectors compatible with prokaryotic or eukaryotic expression, secretion and/or display of the compositions. Certain exemplary polynucleotides are disclosed herein, however, other polynucleotides which, given the degeneracy of the genetic code or codon preferences in a given expression system, encode the fusion proteins described herein are also within the scope of this disclosure.
[0182] The polynucleotides described herein may be produced by chemical synthesis, such as solid phase polynucleotide synthesis on an automated polynucleotide synthesizer and assembled into complete single or double stranded molecules. Alternatively, the polynucleotides of the invention may be produced by other techniques, such as a PCR followed by routine cloning. Techniques for producing or obtaining polynucleotides of a given known sequence are well known in the art.
[0183] The polynucleotides of the described herein may comprise at least one non-coding sequence, such as a promoter or enhancer sequence, intron, polyadenylation signal, and the like. The polynucleotide sequences may also comprise additional sequences encoding additional amino acids that encode for example a marker or a tag sequence, such as a poly-histidine (6His) or an HA tag to facilitate purification or detection of the protein, a signal sequence, a fusion protein partner, such as cDNA encoding a bioactive agent, and the like.
[0184] In another embodiment, provided herein is a vector comprising at least one of the polynucleotides described herein. Such vectors may be plasmid vectors, viral vectors, vectors for baculovirus expression, transposon based vectors or any other vector suitable for introduction of the polynucleotides of the invention into a given organism or genetic background by any means. Such vectors may be expression vectors comprising nucleic acid sequence elements that can control, regulate, cause or permit expression of a polypeptide encoded by such a vector. Such elements may comprise transcriptional enhancer binding sites, RNA polymerase initiation sites, ribosome binding sites, and other sites that facilitate the expression of encoded polypeptides in a given expression system. Such expression systems may be cell-based, or cell-free systems well known in the art.
[0185] In many bacterial expression systems, the start codon typically codes for methionine, which consequently produces proteins initiated with a N-terminal methionine in these expression systems. However, it is well known that certain bacterial enzymes, such as methionine aminopeptidase (MetAP) and the like, can catalyze the hydrolytic cleavage of the N-terminal methionine from newly synthesized polypeptides. This is commonly observed in instances in which the next amino acid is, e.g., Gly, Ala, Ser, or Thr [In vivo processing of N-terminal methionine in E. coli, FEBS Lett. 1990 Jun. 18; 266(1-2):1-3]. Accordingly, in certain embodiments of the fusion proteins described herein include variants in which the N-terminal methionine of the protein is not present.
[0186] The fusion proteins described herein can be isolated using separation procedures well known in the art for capture, immobilization, partitioning, or sedimentation, and purified to the extent necessary for commercial applicability.
[0187] For therapeutic use, the fusion proteins described herein may be prepared as pharmaceutical compositions containing a therapeutically effective amount of a fusion protein described herein as an active ingredient in a pharmaceutically acceptable carrier. The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the active compound is administered. Such vehicles can be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. For example, 0.9% saline and 0.3% glycine can be used. These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration). The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc. The concentration of the fusion protein in such pharmaceutical formulation can vary widely, e.g., from less than about 0.5%, usually at or at least about 1% to as much as 15 or 20% by weight and will be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected. Suitable vehicles and formulations are described, for example, in Remington: The Science and Practice. of Pharmacy, 21st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
[0188] The mode of administration for therapeutic use of the fusion protein described herein may be any suitable route that delivers the agent to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary; transmucosal (oral, intranasal, intravaginal, rectal); using a formulation in a tablet, capsule, solution, suspension, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art. Site specific administration may be achieved by for example intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.
[0189] The fusion proteins described herein can be used as arginine depleting agents. Such agents are useful in the treatment of any disease or condition in which arginine depletion in a subject results in a therapeutic effect, such as in the treatment of cancer, certain viruses, multiple sclerosis, rheumatoid arthritis, autoimmune diseases, congenital hyperargininemia, graft-versus-host disease (GvHD) and, as described in detail herein, obesity, metabolic disorders, and related complications and comorbidities.
[0190] Arginine auxotrophic tumors are reliant on extracellular arginine, due to the downregulation of ASS or OTC and are reliant on extracellular sources of arginine for survival. Arginine depleting agents have been shown to be cytotoxic to arginine auxotrophic tumors and their use in cancer treatment are currently being investigated in clinical trials.
[0191] The fusion proteins described herein can thus be used in the treatment of cancer, such as pancreatic cancer, leukemia, melanoma, head and neck cancer, colorectal cancer, lung cancer, breast cancer, prostate cancer, cervical cancer, liver cancer, nasopharyngeal cancer, esophageal cancer, sarcoma, stomach cancer, mesothelioma, lymphoma, bladder cancer, bone cancer, endometrial cancer, ovarian cancer, kidney cancer, eye cancer, neuroblastoma, glioblastoma, malignant peripheral nerve sheath tumor (MPNST), and brain cancer. The cancer can be an arginine auxotrophic cancer, e.g., a cancer characterized by downregulation of at least one of ASS and OTC.
[0192] The fusion proteins described herein can also be used in the treatment of viral infections, such as human immunodeficiency virus (HIV), hepatitis B virus (HBV), hepatitis C virus (HCV), herpes simplex virus (HSV), human papillomavirus (HPV), Epstein-Barr virus (EBV), herpes viruses, Varicella zoster virus, and influenza.
[0193] As described in detail herein, the fusion proteins provided herein can also be used in the treatment of at least one condition selected from the group consisting of obesity, a metabolic disorder, and a related complication and/or comorbidity.
[0194] As demonstrated in the experiments below, arginine depletion can dramatically reduce adiposity. Here we have investigated the therapeutic potential of arginine deprivation using ABD arginase fusion proteins or PEGylated arginase, such as N-ABD094-rhArg (SEQ ID NO: 50), PEGylated His-rhArg (SEQ ID NO: 101), and N-ABD094-rhArg-Co.sup.2+ [SEQ ID NO: 50 (cobalt substituted)] in treating obesity and associated metabolic disorders. The data presented herein demonstrates that arginine depletion with, e.g., N-ABD094-rhArg (SEQ ID NO: 50), can significantly reduce fat mass, suppress lipogenesis and increase insulin sensitivity in normal lean mice and obese mice. It was found that arginine deprivation, e.g., with N-ABD094-rhArg (SEQ ID NO: 50), can prevent and reduce obesity, metabolic disorders, and related complications and comorbidities, including insulin resistance.
[0195] The effects of arginine depletion presented herein are surprising and unexpected, because numerous studies have shown that increasing dietary intake of some amino acids (AAs), including arginine, has significant effects on glucose and lipid metabolism and AA supplementation could be used to reduce body weight. Moreover, since arginine is a semi-essential amino acid, its depletion does not result in deleterious effects on the subject.
[0196] The high-fat diet-induced obesity (DIO) mouse model was employed. Lean mice starting a high-fat diet were concurrently treated with N-ABD094-rhArg (SEQ ID NO: 50) to test its efficacy on preventing development of DIO and associated metabolic disorders. Mice with pre-existing DIO were treated with N-ABD094-rhArg (SEQ ID NO: 50) to test its efficacy on reducing obesity, metabolic disorders, and related complications and comorbidities.
[0197] As demonstrated in the examples below, treatment with N-ABD094-rhArg (SEQ ID NO: 50) resulted in reduction of weight and fat mass, improvement of glucose tolerance and insulin responsiveness, normalization of endocrine and metabolic profiles, and alleviation of inflammation, steatosis, and fibrosis, and prevent or reverse whitening of brown fat.
[0198] Provided herein is a method for treating obesity and/or a metabolic disorder in a subject in need thereof comprising the step of administering a therapeutically effective amount of an arginine depleting agent to the subject.
[0199] The arginine depleting agent can be any arginine depleting agent known in the art that is capable of reducing plasma and/or cellular levels of arginine in a subject. The arginine depleting agent can be a small molecule or protein.
[0200] The protein can be a fusion protein and/or a chemically modified protein, such as a PEGylated protein. Exemplary proteins include those that are capable of catalyzing the catabolism of arginine to other products, such as proteins having arginase, arginine deiminase, arginine decarboxylase, or arginine 2 monooxygenase activity.
[0201] The arginase can be any arginase known in the art, such as those produced by bacteria, fungi, fish, human, bovine, swine, rabbit, rodent, primate, sheep and goat. For example, Bacillus caldovelox arginase, Thermus thermophilus arginase, Capra hircus arginase I, Heterocephalus glaber arginase I, Bos taurus arginase I, Sus scrofa arginase I, Plecoglossus altivelis arginase I, Salmo salar arginase I, Oncorhynchus mykiss arginase I, Osmerus mordax arginase I, Hyriopsis cumingii arginase I, Rattus norvegicus arginase I, Mus musculus arginase I, Homo sapiens (human) arginase I, Pan troglodytes arginase I, Oryctolagus cuniculus arginase I, Rattus norvegicus arginase II, Mus musculus arginase II, Homo sapiens (human) arginase II, Bostaurus arginase II, Heterocephalus glaber arginase II, Pan troglodytes arginase II, Oryctolagus cuniculus arginase II, Delftia arginase, Bacillus coagulans arginase, Hoeflea phototrophica arginase and Roseiflexus castenholzii arginase. Other examples include arginases from Bacillus methanolicus, Bacillus sp. NRRL B-14911, Planococcus donghaensis, Paenibacillus dendritiformis, Desmospora sp., Methylobacter tundripaludum, Stenotrophomonas sp., Microbacterium laevaniformans, Porphyromonas uenonis, Agrobacterium sp., Octadecabacter arcticus, Agrobacterium tumefaciens, Anoxybacillus flavithermus, Bacillus pumilus, Geobacillus thermoglucosidasius, Geobacillus thermoglucosidans, Brevibacillus laterosporus, Desulfotomaculum ruminis, Geobacillus kaustophilus, Geobacillus thermoleovorans, Geobacillus thermodenitrificans, Staphylococcus aureus, Halophilic archaeon DL31, Halopigerxanaduensis, Natrialba magadii, Plasmodium falciparum, Helicobacter pylori, and the like.
[0202] The arginine deiminase can be any arginine deiminase known in the art, such as those produced from Mycoplasma, Lactococcus, Pseudomonas, Steptococcus, Escherichia, Mycobacterium or Bacillus microorganisms. Exemplary arginine deiminase include, but are not limited, to those produced by Mycoplasma hominis, Mycoplasma arginini, Mycoplasma arthritidis, Clostridium perfringens, Bacillus licheniformis, Borrelia burgdorferi, Borrelia afzellii, Enterococcus faecalis, Lactococcus lactis, Bacillus cereus, Streptococcus pyogenes, Steptococcus pneumoniae, Lactobacillus sake, Giardia intestinalis, Mycobacterium tuberculosis, Pseudomonas plecoglossicida, Pseudomonas putida, Pseudomonas aeruginosa, and the like.
[0203] The arginine decarboxylase can be any arginine decarboxylase known in the art, such as those produced by Escherichia coli., Salmonella typhimurium, Chlamydophila pneumoniae, Methanocaldococcus jannaschii, Paramecium bursaria Chlorella virus 1, Vibrio vulnificus YJO16, Campylobacter jejuni subsp., Trypanosoma cruzi, Sulfolobus solfataricus, Bacillus licheniformis, Bacillus cereus, Carica papaya, Nicotianatobacum, Glycine max, Lotus coniculata, Vibrio vulnificus, Vibrio cholerae, Mus musculus, Thermotoga, Rattus norvegicus, Homo sapiens, Bos taurus, Susscrofa, Thermus thermophiles, Thermus parvatiensis, Thermus aquaticus, Thermus thermophilus, Thermus islandicus, Arabidopsis thaliana, Avena sativa, and the like.
[0204] The arginine 2-monooxygenase can be any arginine 2-monooxygenase known in the art, such as those produced from Arthrobacter globiformis IFO 12137, Arthrobacter simplex IFO 12069, Brevibacterium helvolum IFO 12073, Helicobacter cinaedi CCUG 18818, Streptomyces griseus, and the like.
[0205] The arginine decarboxylase, arginine deiminase, arginine 2-mono-oxygenase, and arginase can be the full protein or a functional fragment and/or variant thereof. The arginine decarboxylase, arginine deiminase, arginine 2-mono-oxygenase, and arginase can be modified to improve their pharmacokinetic properties, such as by fusion of the protein or functional fragment and/or variant thereof with human serum albumin, an albumin binding domain, an Fc region of immunoglobulin, a PEG group, or a combination thereof.
[0206] The arginine catabolic enzymes described herein can be engineered to include specific sites on the enzyme where PEG can be selectively attached. The selected PEGylation sites are preferably located at a site removed from the active site of the enzyme, and generally exposed to solvent to allow reaction with PEGylation reagents.
[0207] For example, Cys.sup.45-human arginase I (HAI) and Cys.sup.161-Bacillus caldovelox arginase (BCA) can be produced to react with thiol-specific PEG molecules. Conjugation between the single, free cysteine residue of the modified arginase and a maleimide group (MAL) attached to a PEG compound can result in a covalent bond between the PEG compound and the free cysteine of the modified arginase. SEQ ID NOs: 102 and 104 include mutant (C168S/C303S) designed for Cys.sup.45 site-directed PEGylation and thus can optionally be PEGylated. SEQ ID NO: 89 also includes mutant (S161C) designed for Cys.sup.161 site-directed PEGylation and thus can optionally be PEGylated.
[0208] In certain embodiments the arginase can comprise SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, or SEQ ID NO: 104, wherein SEQ ID NO: 102 and SEQ ID NO: 104 optionally comprise a polyethylene glycol group (PEG).
[0209] Any PEGylation reagent known in the art can be used to covalently attach PEG to the arginine catabolic enzymes described herein. Exemplary PEGylation reagents include, but are not limited to mPEG-ALD (methoxypolyethylene glycol-propionaldehyde); mPEG-MAL (methoxypolyethylene glycol-maleimide); mPEG-NHS (methoxypolyethylene glycol-N-hydroxy-succinimide); mPEG-SPA (methoxypolyethylene glycol-succinimidyl propionate); and mPEG-CN (methoxypolyethylene glycol-cyanuric chloride).
[0210] The PEG group can have a molecular weight of about 5,000 to about 20,000 amu, about 5,000 to about 15,000 amu, about 5,000 to about 12,000 amu, about 7,000 to about 12,000 amu, or about 7,000 to about 10,000 amu. In certain embodiments, the PEG group has a molecular weight of about 2,000 amu to 10,000 amu. In certain embodiments, the PEG group is PEG4,000, PEG5,000, PEG6,000, or PEG7,000.
[0211] The PEG group can be covalently attached directly to the arginase or via a linker. In certain embodiments, the arginase is covalently attached via a propionic acid linker to PEG. In other embodiments, the arginase is covalently attached via a C2-C10, C2-C9, C2-C8, C2-C7, C2-C6, C2-05, or C2-C4 straight or branched chain carboxylic acid linker to PEG.
[0212] In alternative embodiments, the method of treating at least one condition selected from the group consisting of obesity, a metabolic disorder, and a related complication and/or comorbidity in a subject in need thereof comprises administering a low arginine or substantially arginine-free diet to the subject.
[0213] The method of treating at least one condition selected from the group consisting of obesity, a metabolic disorder, and a related complication and/or comorbidity can also include the prevention of at least one condition selected from the group consisting of obesity, a metabolic disorder, and a related complication and/or comorbidity.
[0214] The metabolic disorder can include obesity, hypercholesterolemia, dyslipidemia, steatosis, insulin resistance, glucose intolerance, hyperglycemia, and diabetes or combinations thereof and related complications and/or comorbidities can include diabetic retinopathy, diabetic nephropathy, diabetic vasculopathy, diabetic neuropathy, steaohepatitis, fibrosis, cirrhosis, inflammation, hypertension, cardiovascular disease, and whitening of brown fat or a combination thereof.
[0215] In certain embodiments, the metabolic disorder is the treatment and/or prevention of insulin resistance, e.g., in subjects having type I or particularly type II diabetes. As the examples demonstrate below, arginine depletion results in an increase in insulin sensitivity of a subject.
[0216] The method of treating obesity can include reducing fat mass or preventing the gain of fat mass in a subject. Treatment of a subject with an arginine depleting agent can result in the reduction of mRNA expression levels of several adipogenic transcription factor and lipogenic enzymes in visceral white adipose tissue (WAT), liver and skeletal muscle, such as Pparg, Srebp1c, Acc, and Scd1 as compared with untreated subjects on a high fat diet. In certain embodiments, the expression level of the reduction of mRNA expression levels of regulators of lipogensis is reduced by, e.g., at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, or about 90% of corresponding mRNA expression levels in an untreated subject on a high fat diet. In certain embodiments, treatment of a subject with an arginine depleting agent results in the reduction of mRNA expression of one or more genes selected from the group consisting of Pparg, Srebplc, Acc, and Scd1 in the WAT, liver and/or skeletal muscles of the subject.
[0217] Obesity can be the result of and/or associated with a metabolic disorder (such as, hyperglycemia, hyperinsulinemia) and/or other factors, such as over eating, lack of physical exercise, etc.
[0218] The metabolic disorder can also include the treatment and/or prevention of steatosis in a subject, such as cardiac steatosis, hepatic steatosis, renal steatosis, pancreatic steatosis, and muscular steatosis.
[0219] The metabolic disorder can also include the treatment and/or prevention of fibrosis in a subject, such as hepatic fibrosis, renal fibrosis, pancreatic fibrosis and cardiac fibrosis.
[0220] The metabolic disorder may also involve the treatment of hypercholesterolemia, dyslipidemia, e.g., by the reduction of plasma total cholesterol, LDL cholesterol, apolipoprotein B and/or triglyceride levels.
[0221] Treatment of a subject with an arginine depleting agent can reduce the concentration of plasma leptin, e.g., at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, or about 70% of the corresponding concentration of plasma leptin in an untreated subject on a HFD. In certain embodiments, the concentration of plasma leptin can be reduced by about 10% to about 70%, about 10% to about 60%, about 10% to about 50%, about 10% to about 40%, about 10% to about 30% of the corresponding concentration of plasma leptin in an untreated subject on a HFD.
[0222] Treatment of a subject with an arginine depleting agent can reduce the concentration of plasma triglycerides by, e.g., at least about 20%, about 30%, or about 40% of the corresponding concentration of plasma triglycerides in an untreated subject on a HFD. In certain embodiments, the concentration of plasma triglycerides can be reduced by about 5% to about 40%, about 5% to about 30%, or about 5% to about 20% of the corresponding concentration of plasma triglycerides in an untreated subject on a HFD.
[0223] Treatment of a subject with an arginine depleting agent can reduce the concentration of plasma total cholesterol by, e.g., at least about 5%, about 10%, or about 15% of the corresponding concentration of plasma total cholesterol in an untreated subject on a HFD. In certain embodiments, the concentration of plasma total cholesterol can be reduced by about 5% to about 15%, about 5% to about 10%, or about 10% to about 15% of the corresponding concentration of plasma total cholesterol in an untreated subject on a HFD.
[0224] Treatment of a subject with an arginine depleting agent can reduce the concentration of plasma free fatty acids by, e.g., at least about 5%, about 10%, about 15%, or about 20% of the corresponding concentration of plasma free fatty acids in an untreated subject on a HFD. In certain embodiments, the concentration of plasma free fatty acids can be reduced by about 5% to about 20%, about 5% to about 15%, or about 5% to about 10% of the corresponding concentration of plasma free fatty acids in an untreated subject on a HFD.
[0225] The concentration of plasma arginine in the subject needed to observe a therapeutic effect can vary based on numerous factors, including the condition of the subject and the type and severity of the disease and/or medical condition and/or diet composition. The selection of the target plasma arginine levels is well within the skill of a person of ordinary skill in the art. In certain embodiments, the concentration of plasma arginine is below about 100 M, about 90 M, about 80 M, about 70 M, about 60 M, about 50 M, about 40 M, about 30 M, about 20 M, about 10 M, or about 5 M. In certain embodiments, the concentration of plasma arginine is about 0.1 M to about 100 M, about 0.1 M to about 90 M, about 0.1 M to about 80 M, about 0.1 M to about 70 M, about 0.1 M to about 60 M, about 0.1 M to about 50 M, about 0.1 M to about 40 M, about 0.1 M to about 30 M, about 0.1 M to about 20 M, or about 0.1 M to about 10 M. In certain embodiments, the level of arginine is below the detection limit of the Biochrom 30 Amino Acid Analyzer (e.g., below about 3 M) and/or below the detection limit of the Agilent 6460 Liquid Chromatography/Electrospray Ionization Triple Quadrupole Mass Spectrometer (e.g., lower than about 0.3 M).
[0226] The determination of the duration of treatment, e.g., the duration of time the plasma arginine concentrations are maintained in a depleted state in the subject, is well within the skill of a person of ordinary skill in the art. In certain embodiments, the duration of treatment is about 1, about 2, about 3, about 4, about 8, about 12, about 16, about 20, about 24, about 28, about 32, about 36, about 40, about 44, about 48, about 52, about 56 weeks, or longer.
[0227] Depletion of arginine has been shown to be an effective treatment of a number of conditions, including but not limited to viral infections (U.S. Pat. No. 8,507,245 herein incorporated by reference in its entirety), multiple sclerosis, rheumatoid arthritis, autoimmune diseases (U.S. Pat. No. 9,789,169, herein incorporated by reference in its entirety), congenital hyperargininemia (ClinicalTrials.gov Identifier: NCT02488044), graft-versus-host disease (GvHD) (Hallet W., et al., Exploiting arginase to prevent GVHD, Blood 2010 116:5440-5441), inflammation (Sahin E., et al., Macrophage PTEN regulates expression and secretion of arginase I modulating innate and adaptive immune responses, J Immunol. 2014 Aug. 15; 193(4):1717-27), and retinal neurovascular degeneration (Fouda A Y. et al., Arginase 1 promotes retinal neurovascular protection from ischemia through suppression of macrophage inflammatory responses Cell Death Dis. 2018 Sep. 25; 9(10):1001).
[0228] Accordingly, also provided herein is a method of treating at least one condition selected from the group consisting of viral infections, multiple sclerosis, rheumatoid arthritis; autoimmune diseases, congenital hyperargininemia, graft-versus-host disease (GvHD) and inflammation in a subject in need thereof comprising the step of administering a therapeutically effective amount of a fusion protein described herein.
[0229] Additional objects, advantages, and novel features of this disclosure will become apparent to those skilled in the art upon examination of the following examples thereof, which are not intended to be limiting.
Example 1: Construction of ABD and ABD094 Fusion Genes
[0230] The gene of N-ABD for N-terminal fusion was constructed by mixing primers 01-08 (SEQ ID NO: 1-8) listed in Table 1 in a PCR reaction with each primer to a concentration of 20 nM, together with 1 reaction buffer of iProof DNA polymerase (Bio-rad), 0.2 mM dNTP and 0.5 unit iProof DNA polymerase (Bio-rad) in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 15 s; (4) repeat (1) to (3) 35 times. Then 1 L of PCR reaction product was added to a new PCR reaction together with 1 reaction buffer of iProof DNA polymerase (Bio-rad), 0.2 mM dNTP, 0.2 M primer (N-ABDNde-F): 5-GATCTTAAGCATATGCATCATCACCATC-3 (SEQ ID NO: 9), primer (N-ABDHind-R): 5-ACAGCTAAAAGCTTATCAGCCTAGGATCCGCCGCTACCATTG-3 (SEQ ID NO: 93) and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 15 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The construction of N-ABD094 gene was the same as the procedures for the N-ABD gene construction except that primers 09-16 (SEQ ID NO: 9-16) listed in Table 1 were used instead of primers 01-08 (SEQ ID NO: 1-8) listed in Table 1.
[0231] The gene of C-ABD for C-terminal fusion was constructed by mixing primers 17-24 listed in Table 1 in a PCR reaction with each primer to a concentration of 20 nM, together with 1 reaction buffer of iProof DNA polymerase, 0.2 mM dNTP and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 15 s; (4) repeat (1) to (3) 35 times. Then 1 L of PCR reaction product was added to a new PCR reaction together with 1 reaction buffer of iProof DNA polymerase, 0.2 mM dNTP, 0.2 M primer (C-ABDNde-F): 5-TAGCTGATCATATGTTATGCGATGGATCCAGTAACAAC-3 (SEQ ID NO: 91), 0.2 M primer (C-ABDHind-R): 5-GACCCTAAAAGCTTAATGGTGATGGTGATGATG-3 (SEQ ID NO: 92) and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 15 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The construction of C-ABD094 gene was the same as the procedures for the C-ABD gene construction except that primers 25-32 (SEQ ID NO: 25-32) listed in Table 1 were used instead of primers 17-24 (SEQ ID NO: 17-24) listed in Table 1.
[0232] Either the PCR fragment N-ABD, N-ABD094, C-ABD or C-ABD094 was digested with restriction enzymes Nde I and Hind III and ligated into vector pRSET-lac pre-digested with the same enzymes and transformed into Escherichia coli Top10 to generate plasmid pN-ABD, pN-ABD094, pC-ABD and pC-ABD094 respectively. Plasmid pRSET-lac was modified from pRSET-A (Invitrogen) by replacing the T7 promoter with lac promoter from pGEMT-Easy Vector (Promega).
[0233] N-ABD or N-ABD094 fusion of the human arginase I gene was constructed by mixing 0.2 M primer HARGBam-F (5-TTAGCTGGGGATCCGCCAAGTCCAGAACCATAGG-3) (SEQ ID NO: 93), 0.2 M primer HARGHind-R (5-GAGATCAAAGCTTACTTAGGTGGGTTAAGGTAGTC-3) (SEQ ID NO: 94) together with 1 reaction buffer of iProof DNA polymerase, 0.2 mM dNTP, 100 ng cDNA of human arginase I and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 30 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The PCR fragment human arginase I gene was digested with restriction enzymes BamH I and Hind III and ligated into vector pN-ABD or pN-ABD094 pre-digested with the same enzymes and transformed into Escherichia coli ER2566 (NEB) to generate plasmid pN-ABD-rhArg and pN-ABD094-rhArg respectively.
[0234] C-ABD or C-ABD094 fusion of the human arginase I gene was constructed by mixing 0.2 M primer HARGNde-F (5-TAGGCTGCATATGAGCGCCAAGTCCAGAACCATAG-3) (SEQ ID NO: 95), 0.2 M primer HARGBam-R (5-ATCAGCTAGGATCCCTTAGGTGGGTTAAGGTAGTCAATAGG-3) (SEQ ID NO: 96) together with 1 reaction buffer of iProof DNA polymerase (Bio-rad), 0.2 mM dNTP, 100 ng cDNA of human arginase I and 0.5 unit iProof DNA polymerase (Bio-rad) in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 30 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The PCR fragment human arginase I gene was digested with restriction enzymes Nde I and BamH I and ligated into vector pC-ABD or pC-ABD094 pre-digested with the same enzymes and transformed into Escherichia coli ER2566 (NEB) to generate plasmid pC-ABD-rhArg and pC-ABD094-rhArg respectively.
[0235] N-ABD or N-ABD094 fusion of the Bacillus caldovelox arginase (BCA) gene was constructed by mixing 0.2 M primer BCABam-F (5-ATGCTAGTGGATCCATGAAGCCAATTTCAATTATCG-3) (SEQ ID NO: 97), 0.2 M primer BCAHind-R (5-TCAGCCTAAAGCTTACATGAGTTTTTCACCAAACAACG-3) (SEQ ID NO:) together with 1 reaction buffer of iProof DNA polymerase, 0.2 mM dNTP, 100 ng genomic DNA of Bacillus caldovelox and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 30 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The PCR fragment Bacillus caldovelox arginase gene was digested with restriction enzymes BamH I and Hind III and ligated into vector pN-ABD or pN-ABD094 pre-digested with the same enzymes and transformed into Escherichia coli ER2566 (NEB) to generate plasmid pN-ABD-BCA and pN-ABD094-BCA respectively.
[0236] C-ABD or C-ABD094 fusion of the Bacillus caldovelox arginase (BCA) gene was constructed by mixing 0.2 M primer BCANde-F (5-ATGCTAGCCATATGAAGCCAATTTCAATTATCGGG-3) (SEQ ID NO: 99), 0.2 primer BCABam-R (5-TCAGCTAAGGATCCCATGAGTTTTTCACCAAACAACG-3) (SEQ ID NO: 100) together with 1 reaction buffer of iProof DNA polymerase 0.2 mM dNTP, 100 ng genomic DNA of Bacillus caldovelox and 0.5 unit iProof DNA polymerase in a 50 L reaction volume. PCR program was set as: (1) 98 C., 10 s; (2) 50 C., 20 s; (3) 72 C., 30 s; (4) repeat (1) to (3) 35 times; (5) 72 C., 5 minutes. The PCR fragment Bacillus caldovelox arginase gene was digested with restriction enzymes Nde I and BamH I and ligated into vector pC-ABD or pC-ABD094 pre-digested with the same enzymes and transformed into Escherichia coli ER2566 (NEB) to generate plasmid pC-ABD-BCA and pC-ABD094-BCA respectively.
TABLE-US-00001 TABLE1 DNAprimersusedinABDandABD094gene synthesis. Number Sequences 01 5-GGAGATGGACATATGCATCATCACCATCACCATGAT GAAGCCGTGGATGC-3(SEQIDNO:1) 02 5-GCTAAGACTTTAGCTTCAGCTAAGGAATTCGCATCC ACGGCTTCATCATG-3(SEQIDNO:2) 03 5-CCTTAGCTGAAGCTAAAGTCTTAGCTAACAGAGAAC TTGACAAATATGGA-3(SEQIDNO:3) 04 5-TAGGTTCTTGTAATAGTCACTTACTCCATATTTGTC AAGTTCTCTGTTAG-3(SEQIDNO:4) 05 5-GGAGTAAGTGACTATTACAAGAACCTAATCAACAAT GCCAAAACTGTTGA-3(SEQIDNO:5) 06 5-AAATTTCATCTATCAGTGCTTTTACACCTTCAACAG TTTTGGCATTGTTG-3(SEQIDNO:6) 07 5-GTAAAAGCACTGATAGATGAAATTTTAGCTGCATTA CCTTCGGGTAGTAA-3(SEQIDNO:7) 08 5-TCCGCCGCTACCATTGTTATTATTGTTGTTACTACC CGAAGGTAATGCAG-3(SEQIDNO:8) 09 5-GATCTTAAGCATATGCATCATCACCATCACCATGAT GAAGCGGTGGA-3(SEQIDNO:9) 10 5-GCTTCTTTCGCTTCCGCCAGGCTGTTCGCATCCACC GCTTCATCATG-3(SEQIDNO:10) 11 5-GCGGAAGCGAAAGAAGCGGCGAACGCGGAACTGGAT AGCTATGGCGTGAG-3(SEQIDNO:11) 12 5-TTATCAATCAGGCGTTTATAAAAATCGCTCACGCCA TAGCTATCCAGTTC-3(SEQIDNO:12) 13 5-GATTTTTATAAACGCCTGATTGATAAAGCGAAAACC GTGGAAGGCGTGGA-3(SEQIDNO:13) 14 5-CGGCAGCGCCGCCAGAATCGCATCTTTCAGCGCTTC CACGCCTTCCACGGT-3(SEQIDNO:14) 15 5-TTCTGGCGGCGCTGCCGTCGGGTAGTAACAACAATA ATAACAATGGTAGC-3(SEQIDNO:15) 16 5-GGATCCGCCGCTACCATTGTTATTATTGTTGTTACT ACC-3(SEQIDNO:16) 17 5-CATATGTTAGCTGATGGATCCAGTAACAACAATAAT AACAATGGTAGCGG-3(SEQIDNO:17) 18 5-AATTCGCATCCACGGCTTCATCACCGCCGCTACCAT TGTTATTATTGTTG-3(SEQIDNO:18) 19 5-GAAGCCGTGGATGCGAATTCCTTAGCTGAAGCTAAA GTCTTAGCTAACAG-3(SEQIDNO:19) 20 5-CTTACTCCATATTTGTCAAGTTCTCTGTTAGCTAAG ACTTTAGCTTCAGC-3(SEQIDNO:20) 21 5-GAGAACTTGACAAATATGGAGTAAGTGACTATTACA AGAACCTAATCAAC-3(SEQIDNO:21) 22 5-TACACCTTCAACAGTTTTGGCATTGTTGATTAGGTT CTTGTAATAGTCAC-3(SEQIDNO:22) 23 5-GCCAAAACTGTTGAAGGTGTAAAAGCACTGATAGAT GAAATTTTAGCTGC-3(SEQIDNO:23) 24 5-ATGGTGATGGTGATGATGAGGTAATGCAGCTAAAAT TTCATCTATCAGTG-3(SEQIDNO:24) 25 5-CATATGTTATGCGATGGATCCAGTAACAACAATAAT AACAATGGTAGCGG-3(SEQIDNO:25) 26 5-TGTTCGCATCCACCGCTTCATCACCGCCGCTACCAT TGTTATTATTGTTG-3(SEQIDNO:26) 27 5-GAAGCGGTGGATGCGAACAGCCTGGCGGAAGCGAAA GAAGCGGCGAACGC-3(SEQIDNO:27) 28 5-AAAATCGCTCACGCCATAGCTATCCAGTTCCGCGTT CGCCGCTTCTTTCG-3(SEQIDNO:28) 29 5-CTATGGCGTGAGCGATTTTTATAAACGCCTGATTGA TAAAGCGAAAACCG-3(SEQIDNO:29) 30 5-TCGCATCTTTCAGCGCTTCCACGCCTTCCACGGTTT TCGCTTTATCAATC-3(SEQIDNO:30) 31 5-GAAGCGCTGAAAGATGCGATTCTGGCGGCGCTGCCG CATCATCACCATCA-3(SEQIDNO:31) 32 5-CTAAAAGCTTAATGGTGATGGTGATGATGCGGCA G-3(SEQIDNO:32)
Example 2: Expression and Purification of ABD-rhArg or ABD094-rhArg Fusion Protein by Fermentation
[0237] To produce N-ABD-rhArg (SEQ ID NO: 49) fusion protein, Escherichia coli ER2566 transformed with pN-ABD-rhArg was grown in 50 mL seed medium (1.5 g yeast extract, 0.25 g NaCl and 5 mg ampicillin) at 30 C. in an orbital shaker at 250 rpm for 16 hours. The seed culture was then transferred to the 1 L fermentation medium (10 g yeast extract, 16 g tryptone, 6.7 g Na.sub.2HPO.sub.4.7H.sub.2O, 3.41 g KH.sub.2PO.sub.4, 2.41 g NH.sub.4Cl, 0.67 g (NH.sub.4).sub.2SO.sub.4, 10 g glycerol, 1 g glucose, MgSO.sub.4.7H.sub.2O, 1 mM CaCl.sub.2 and 0.1 g ampicillin) and grown at 28 C. supplied with 1 L/min air and with a minimum rate of 500 rpm, pH was maintained at 7.4. The stir rate was increased automatically in order to maintain the minimum dissolved oxygen pO.sub.2 at least 20%. When the absorbance at 600 nm wavelength of the culture reached an optical density (OD) of 15, 500 mL medium (10 g yeast extract, 16 g tryptone, 2.41 g NH.sub.4Cl, 0.67 g (NH.sub.4).sub.2SO.sub.4, 20 g glycerol) was fed at the rate of 31.25 mL/hr for a continuous 16 hours. The cells were collected by centrifugation and the protein was purified by a Ni-IDA sepharose column. Usually more than 1 g/L of culture of purified protein was obtained. Endotoxin was then removed from the purified protein by Triton X-114 method [Aida Y. and Pabst M. J. (1990) Journal of Immunological Methods. 132: 191-195, herein incorporated by reference]. The procedures for the production of fusion proteins N-ABD094-rhArg (SEQ ID NO: 50), C-ABD-rhArg (SEQ ID NO: 51), C-ABD094-rhArg (SEQ ID NO: 52), N-ABD-BCA (SEQ ID NO: 53), N-ABD094-BCA (SEQ ID NO: 54), C-ABD-BCA (SEQ ID NO: 55) and C-ABD094-BCA (SEQ ID NO: 56) were the same as the production procedures for N-ABD-rhArg (SEQ ID NO: 49) except that the cells were transformed with the respective plasmid accordingly.
TABLE-US-00002 TABLE 2 The N-ABD094-rhArg protein was prepared and 990 mg pure protein was obtained. Vol. Conc. Total Specific Act. (mL) (mg/mL) (mg) (U/mg) N-ABD094- 50 19.81 990 184 rhArg
Example 3: Construction and Cloning of the N-ABD094-rhArg Gene (SEQ ID NO: 38)
[0238] The N-ABD094-rhArg (SEQ ID NO: 38) gene was synthesized by overlapping extension PCR based on the N-ABD-rhArg gene (SEQ ID NO: 37). Two PCR reactions were performed. First of all, pRSET/lac plasmid with N-ABD094-rhArg gene (SEQ ID NO: 38) was used. The rhArg region was isolated and amplified in the first PCR reaction by ABD094-0F (SEQ ID NO: 57) and HuArgHinBam-R (SEQ ID NO: 64). The PCR product was isolated and purified by 0.7% agarose gel (Biorad) with 100 V for 30 min and gel band purification kit (GE Healthcare Life Science). ABD094 was then added to the PCR product via the second PCR reaction. A 20 diluted primers mixture, including ABD094-0F, ABD094-1F, ABD094-2F, ABD094-3F, ABD094-4F and ABD094-5F (SEQ ID NO: 57-62) was first prepared with sterilized milli-Q water. The primer mixture and the abdNde-F overlap to each other. The second PCR reaction was performed by abdNde-F (SEQ ID NO: 63), HuArgHinBam-R (SEQ ID NO: 64), and 20 diluted primers mixture. The PCR product was isolated and purified by same methods described above. The sequences of the primers are shown in Table 3. The binding locations of the primers are illustrated in
TABLE-US-00003 TABLE3 ListofprimersforcloningN-ABD094-rhArg gene(SEQIDNO:38) Primer name Sequence ABD094-0F 5-ATTCTGGCAGCGCTGCCGTCGGGTAG TAACAACAATAATAACAATGGTAG-3 (SEQIDNO:57) ABD094-1F 5-AACCGTGGAAGGTGTGGAAGCGCTGA AAGATGCGATTCTGGCAGCGCTGC-3 (SEQIDNO:58) ABD094-2F 5-GATTTTTATAAACGTCTGATTGATAA AGCGAAAACCGTGGAAGGTGTGGA-3 (SEQIDNO:59) ABD094-3F 5-CTGGATAGCTATGGCGTGAGCGATTT TTATAAACGTCTGATTGATAAAGC-3 (SEQIDNO:60) ABD094-4F 5-GCGGAAGCGAAAGAAGCAGCAAACGC GGAACTGGATAGCTATGGCGTGAG-3 (SEQIDNO:61) ABD094-5F 5-ACCATGATGAAGCCGTGGATGCGAAT TCCCTGGCGGAAGCGAAAGAAGCA-3 (SEQIDNO:62) abdNde-F 5-GGAGATATACATATGCATCATCACCA TCACCATGATGAAGCCGTGG-3 (SEQIDNO:63) HuArgHinBam-R 5-TGACTACCTTAACCCACCTAAGTAAG CTTGGATCCTGTAACG-3 (SEQIDNO:64)
[0239] The PCR product and the pRSET/lac vector were double digested by BamHI-HF and NdeI (New England BioLabs) at 37 C. for 2 h. Both insert and vector were isolated and purified by 0.7% agarose gel (Biorad) with 100 V for 30 min and gel band purification kit (GE Healthcare Life Science). The insert and vector were then ligated by T4 ligase (New England BioLabs) at room temperature for 20 min. The competent cells were transformed by the recombinant DNA and spread on the LB plate with 50 g/mL kanamycin. The LB plate was incubated at 37 C. overnight. 8 colonies were picked and checked for the presence of N-ABD094-rhArg by PCR with the abdNde-F and HuArgHinBam-R. The colonies with positive result in PCR were further grown in 5 mL 2 TY with 50 g/mL kanamycin at 30 C. overnight. The bacterial broth was centrifuged down in 1.7 mL microcentrifuge tube at 16,100g for 1 min. The bacterial pellets were resuspended in solubilization buffer (50 mM Tris-HCl, 0.1 M NaCl, 1 mM MnCl.sub.2, pH 7.4) and broken by repeating freeze and thaw in liquid nitrogen. The cell lysate was centrifuged down to obtain protein solution. Arginase activity assay by DAMO was performed to test the presence of arginase.
Example 4: Construction of BCA Expression Vector
[0240] The gene encoding BCA (Pubmed accession no.: U48226) was ordered from GenScript where it was synthesized by de novo and inserted into pUC57 cloning vector. The single cysteine residue was introduced by site-directed mutagenesis while the six-histidine tag was added to the C-terminus to facilitate the protein purification process. The engineered BCA gene was subcloned into the pET-3a vector and transformed into BL21(DE3) competent cells for BCA expression. Crystal structure of BCA (PDB: 2CEV) can be retrieved from the protein data bank. The protein sequence of the engineered BCA (S161C)-His (SEQ ID NO: 89) is shown in
Example 5: Construction of BCA-ABD Expression Vector
[0241] A pair of primers encoding the albumin binding domain (ABD) were constructed and amplified by overlap PCR. Briefly, 200 ng of primers was used as template and amplified by 1 unit of iProof High-Fidelity DNA Polymerase (Bio-Rad). The primers were incubated at 98 C. for 30 s while 15 cycles of amplification including heat denaturation at 98 C. for 10 s, annealing at 60 C. for 30 s and extension at 72 C. for 15 s.
TABLE-US-00004 5-Sense-ABD (SEQIDNO:77) GCGCAGCATGATGAAGCCGTGGATGCGAACAGCTTAGCTGAAGCTAAAGT CTTAGCTAACAGAGAACTTGACAAATATGGAGTAAGTGACTATTACAAGA ACC (SEQIDNO:78) 5-Anti-sense-ABD TTAAGGTAATGCAGCTAAAATTTCATCTATCAGTGCTTTTACACCTTCAA CAGTTTTGGCATTGTTGATTAGGTTCTTGTAATAGTCACTTACTCCAT
[0242] The ABD encoding gene constructed by this pair of primers was amplified by 2 different sets of primers so as to construct BCA-6His-ABD (also referred to as BHA) (SEQ ID NO: 75) and BCA-ABD-6His (also referred to as BAH) (SEQ ID NO: 76). For the construction of BHA, the ABD was first amplified by the following pair of primers for which the forward primer was designed for the overlap PCR with the BCA via the six-Histidine tag while BamH I restriction site and stop codon were introduced for the ligation to pET-3a vector using the reverse primer:
TABLE-US-00005 ForwardprimerforcloningABD: (SEQIDNO:79) 5-GCATCACCATCACCATCACGCGCAGCATGATGAAG-3 ReverseprimerforcloningABD: (SEQIDNO:80) 5-cgGGATCCTTAAGGTAATGCAGCTAAAATTTCATCTAT-3
[0243] The PCR product from the amplification of ABD was subjected to 1.5% agarose gel electrophoresis and the PCR products were purified. While the engineered BCA with an extra mutation (V20P) was cloned using the following pair of primers for which the stop codon was deleted:
TABLE-US-00006 ForwardprimerforcloningBCA: (SEQIDNO:81) 5-ggaattccCATATGAAGCCAATTTCAATTATCG-3 ReverseprimerforcloningBCA: (SEQIDNO:82) 5-GTGATGGTGATGGTGATGCA-3
[0244] The BCA amplified by the above primers was subjected to 1% agarose gel electrophoresis and the PCR products were purified. The above PCR products of BCA and ABD was tethered by overlap PCR. Similarly, 200 ng of BCA and ABD was used as template and amplified by 1 unit of iProof High-Fidelity DNA Polymerase. The BCA and ABD were incubated at 98 C. for 30 s while 15 cycles of amplification including heat denaturation at 98 C. for 10 s, annealing at 60 C. for 30 s and extension at 72 C. for 30 s. The product from overlap PCR was used as template for further amplification using the following pair of primers:
TABLE-US-00007 ForwardprimerforcloningBHA: (SEQIDNO:83) 5-ggaattccCATATGAAGCCAATTTCAATTATCG-3 ReverseprimerforcloningBHA: (SEQIDNO:84) 5-cgGGATCCTTAAGGTAATGCAGCTAAAATTTCATCTAT-3
[0245] The PCR product was subjected to 1% agarose gel electrophoresis and the band corresponding to BHA was excised from the gel for purification.
[0246] For the construction of BAH, the ABD was first amplified by the following pair of primers for which the forward primer was designed for the overlap PCR directly with the BCA while BamHI restriction site, six-Histidine tag and stop codon were introduced via the reverse primer:
TABLE-US-00008 ForwardprimerforcloningABD: (SEQIDNO:85) 5-CGTTGTTTGGTGAAAAACTCATGGCGCAGCATGATGAAG-3 ReverseprimerforcloningABD: (SEQIDNO:86) 5-cgGGATCCTTAGTGATGGTGATGGTGATGAGGTAATGCAGCTAAAAT TTCATCTAT-3
TCTAT-3 (SEQ ID NO: 86)
[0247] The PCR product from the amplification of ABD was subjected to 1.5% agarose gel electrophoresis and the PCR products were purified. The engineered BCA with an extra mutation (V20P) was cloned using the following pair of primers for which the stop codon and six-Histidine tag were deleted:
TABLE-US-00009 ForwardprimerforcloningBCA: (SEQIDNO:81) 5-ggaattccCATATGAAGCCAATTTCAATTATCG-3 ReverseprimerforcloningBCA: (SEQIDNO:82) 5-GTGATGGTGATGGTGATGCA-3
[0248] The BCA amplified by the above primer was subjected to 1% agarose gel electrophoresis and the PCR products were purified. The above PCR product of BCA and ABD was tethered by overlap PCR. Similarly, 200 ng of BCA and ABD was used as template and amplified by 1 unit of iProof High-Fidelity DNA Polymerase. The BCA and ABD were incubated at 98 C. for 30 s while 15 cycles of amplification including heat denaturation at 98 C. for 10s, annealing at 60 C. for 30 s and extension at 72 C. for 30 s. The product from overlap PCR was used as template for further amplification using the following pair of primers:
TABLE-US-00010 ForwardprimerforcloningBAH: (SEQIDNO:87) 5-ggaattccCATATGAAGCCAATTTCAATTATCG-3 ReverseprimerforcloningBAH: (SEQIDNO:88) 5-cgGGATCCTTAGTGATGGTGATGGTGATGAGGTAATGCAGCTAAAAT TTCATCTAT-3
[0249] The PCR product was subjected to 1% agarose gel electrophoresis and the band corresponding to BHA was excised from the gel for purification. The PCR product encoding. BHA and BAH and the pET-3a vector were double digested with NdeI and BamHI. The BHA and BAH were ligated to the pET-3a vector and transformed to TOP10 competent E. coli cells. The nucleotide sequences of BHA and BAH were confirmed by DNA sequencing. The pET-3a vector containing the BHA or BAH insert was transformed to the BL21(DE3) vector for protein expression.
Example 6: Protein Constructs of BHA and BAH
[0250] The protein sequence of BCA used in this study is the same as that used by Bewley et al. (Structure 7, 435-448, 1999) (PDB ID: 2CEV, incorporated herein by reference) except that it contains a 6His tag at the C terminus and a S161C mutation. The constructs of both BCA-6His-ABD (BHA) and BCA-ABD-6His (BAH) were designed and E. coli cell stocks can express BHA and BAH. In both BHA and BAH, the BCA portion is a mutated version of BCA with its valine residue at position 20 mutated to proline (V20P), while the ABD portion is the wild-type version of ABD with a linker sequence (AQHDEAVDANS) (Jonsson et al., 2008, Protein Eng. Des. Sel. 21, 515-527). The ABD portion is either located at the very C terminus of the fusion protein (in the case of BHA) or fused in between BCA and 6 histidine tag (in the case of BAIT). The alignment of the protein sequences of BCA, BHA, and BAH used in this study is shown in
TABLE-US-00011 BCA(wild-type)aminoacidsequence (PDBID:2CEV): (SEQIDNO:70) MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIP IGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHS IAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFG HPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDR LGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRE SHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM BCA(S161C)-Hisaminoacidsequence: (SEQIDNO:71) MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIP IGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHS IAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFG HPALTQIGGYCPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDR LGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRE SHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLMH HHHHH BHAaminoacidsequence: (SEQIDNO:75) MKPISIIGVPMDLGQTRRGPDMGPSAMRYAGVIERLERLHYDIEDLGDIP IGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHS IAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFG HPALTQIGGYCPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDR LGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRE SHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLMH HHHHHAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGV KALIDEILAALP BAHaminoacidsequence: (SEQIDNO:76) MKPISIIGVPMDLGQTRRGPDMGPSAMRYAGVIERLERLHYDIEDLGDIP IGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHS IAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFG HPALTQIGGYCPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDR LGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRE SHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLMA QHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDE ILAALPHHHHHH
Example 7: Production of BHA and BAH
[0251] E. coli cell stocks that expressed BHA and BAH were used. To prepare the seed culture, a small amount of E. coli BL21 (DE3) glycerol stock was inoculated into 10 mL LB medium supplemented with 100 g/mL ampicillin. The seed culture was grown at 37 C. with shaking at 700 rpm for overnight (16 h). The overnight seed culture at a volume of 2.5 mL was then used to inoculate 250 mL of LB medium with 100 g/mL ampicillin. Inoculated cells were grown at 37 C. with shaking at 280 rpm for 2-4 h to an optical density at 600 nm wavelength (OD.sub.600) of 0.6-0.8. IPTG (0.2 mM) was then added to the culture medium to induce the overexpression of the target protein. Cells were grown for a further 4 h and harvested by centrifugation at 4,500 rpm.
[0252] Protein Purification by Nickel Affinity Chromatography
[0253] E. coli cell pellets were resuspended in buffer containing 50 mM Tris-HCl, 100 mM NaCl (pH 7.4) and were disrupted by sonication. Cell debris was then removed by centrifugation at 10,000 rpm for 40 min. Supernatant was applied to a 5 mL HiTrap chelating column (GE Healthcare) that had been charged with Ni.sup.2+ and equilibrated with buffer A (20 mM sodium phosphate, 0.5 M NaCl, pH 7.4) using an KTA purifier. Proteins were eluted using a gradient of 0-0.5 M imidazole which was achieved by the combination of buffer A with buffer B (0.5 M imidazole in buffer A) at various ratios. Fractions were analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) using 12% polyacrylamide gels, and those containing the target, protein were pooled. Pooled fractions were concentrated and the buffer of the concentrated pooled fractions were exchanged with 20 mM sodium phosphate (pH 7.4) using centrifugal filter device (Amicon) or tangential flow filtration (TFF) device (Millipore). The membrane cut-off was 30,000 MW for BHA and BAH. The retentate was then diluted to desired concentration and underwent sterile filtration through a 0.2 m syringe filter and stored at 4 C.
[0254] According to the chromatogram of BHA purification, three peaks are observed during the elution process using increasing concentrations of imidazole (
[0255] According to the chromatogram of BAH purification, three peaks are observed during the elution process using increasing concentrations of imidazole (
[0256] One unit of enzyme activity is defined as the amount of enzyme (BCA, BHA or BAH) that catalyzes the production of 1 mol urea per min under standard assay conditions. Specific activity of the enzyme is expressed as activity units per mg of protein. Under standard DAMO assay conditions (37 C., pH 7.4), freshly purified BHA (SEQ ID NO: 75) has a specific activity value of 220.615.8 U/mg, which is close to the value of BCA (S161C)-His (SEQ ID NO: 89) (243.30 U/mg).
[0257] For fusion proteins comprising a BCA polypeptide and an ABD polypeptide, extremely high protein yield of about 290 mg protein per L of shake flask culture has been obtained in the case of BHA (SEQ ID NO: 75). The yields of ABD fusion proteins are highly dependent on the expression systems used. It has been reported that the yield of ABD fused with sCR1 ranges from 0.4 to 1.1 g per 24 h per mL of Chinese hamster ovary cell culture (Makrides et al., 1996, J. Pharmnacol. Exp. Ther. 277, 534-542). Around 2-15 mg single-chain diabody-ABD fusion proteins can be obtained from every L of HEK293 cell culture (Hopp et al., 2010, Protein Eng. Des. Sel. 23, 827-834; Stork et al., 2007, Protein Eng. Des. Sel. 20, 569-576). The yield of ABD-TolA fusion protein expressed in E. coli BL21 host is 20 mg/L LB broth medium (Ahmad et al., 2012, Proteins 80, 774-789). In comparison, the yield of BHA is much higher. Our results have demonstrated that the production of BHA (SEQ ID NO: 75) is simple and cost-effective.
Example 8: Expression and Purification of BCA (S161C)-His (SEQ ID NO: 89)
[0258] An overnight seed culture of the E. coli strain BL21 (DE3)pLysS transformed with plasmid pET-3a-BCA(S161C)-His was prepared in 5 mL LB medium containing 100 g/mL ampicilin and it was allowed to grow in the shake flask at 37 C. for 16 h with 280 rpm shaking. For 250 mL LB medium containing 100 g/mL ampicilin, 2.5 mL overnight culture was added and cultured at 37 C. with shaking at 280 rpm until the optical density (OD.sub.600) reached 0.8-0.9 at 600 nm. Isopropyl -D-thio-galactopyranoside (IPTG) was added to a final concentration of 0.2 mM. After 4 h induction, the cells were harvested by centrifugation at 12,000g for 20 min at 4 C. The cell pellet could either be disrupted by sonication and proceed to purification, or kept at 20 C. until required. The cell pellet was suspended in 20 mL solubilization buffer (50 mM Tris-HCl, 100 mM NaCl, pH 7.4) containing 10 mM MnCl.sub.2. The cells were first disrupted by sonication on ice for 10 min with pulse for every 30 s at 40% amplitude. The cell debris was removed by centrifugation at 12,000g for 20 min at 4 C. The supernatant was incubated at 70 C. for 15 min and precipitates formed during the heat treatment step were removed by centrifugation. Soluble fraction was filtered through 0.22 m filter before loading to the 5 mL HisTrap Chelating HP column. The flow through fraction was collected during sample loading and the unbound proteins were washed out by 5 column volume (CV) of starting buffer or until the baseline level off. The target proteins bound on the column was eluted out by competitive gradient elution using imidazole (0.5 M imidazole in start buffer). The target fractions were identified and pooled together which would be buffer-exchanged in 20 mM sodium phosphate at pH 7.4 using Amicon Ultra-15 Centrifugal Filter Unit with 10 kDa MW cutoff following manufacture's instruction. The sample was filtered under sterile conditions through a by 0.22 m filter and stored at 4 C. until required.
Example 9: Purification of BCA (S161C)-his (SEQ ID NO: 89) from Fed-batch Fermentation
[0259] The fermentation of BCA (S161C)-His-expressing E. coli cells in a 5 L bioreactor produced 248.86 g wet cell weight. The cell pellet was re-suspended in solubilization buffer containing DNase and RNase which broke down the huge amount of DNA and RNA released by homogenization, thus reducing the viscosity of the cell lysate. The cell lysate, after passing through the homogenizer for three times, was incubated at 37 C. for 15 minutes to further reduce the viscosity, followed by centrifugation to obtain the soluble fraction. The first step of purification removes the non-target impurities by heat treatment at 70 C. for 15 min which precipitated the heat-labile proteins, and the heat-stable BCA (S161C)-His (SEQ ID NO: 89) was recovered by centrifugation.
[0260] The soluble fraction containing the target protein was further purified by Ni-affinity column with 196 mL bed volume packed in XK50 column. Briefly, a 4-segment elution program was used to elute the BCA (S161C)-His (SEQ ID NO: 89) from the Ni-affinity column. The first elution gradient from 0 to 30% elution buffer was intended to remove the protein that bound non-specifically on the column. The second segment was maintained at 30% which allowed complete elution of non-specific bound proteins. The target protein was eluted out in the third segment by increasing concentration of elution buffer from 30 to 70%. The fourth segment of 70 to 100% elution buffer eluted any remaining protein that was still bound on the column. The fractions that gave absorbance at UV wavelength 280 nm was analyzed by SDS-PAGE while the 24 fractions from E1 to A5 (50 mL each), containing the target protein, were pooled together (
Example 10: Determination of Arginase Enzyme Activity
[0261] The activity of BCA (S161C)-His (SEQ ID NO: 89) was assayed by direct colorimetric method using diacetyl monoxime (DAMO) which determines the amount of product, urea, in the enzymatic reaction. Briefly, a serial dilution of 0.3 mL BCA solutions together with 0.15 mL water and 720 mM arginine substrate at pH 7.4 was pre-incubated separately at 37 C. for 10 min. The enzymatic reaction was carried out by adding 0.3 mL arginine substrate to the pre-incubated enzyme solutions. The reaction mixture was incubated at 37 C. for exactly 5 minutes and quenching reagent [50% trichloroacetic acid (TCA)] was added to stop the reaction. The sample blanks were prepared in a similar way but the same volume of enzyme solutions was added after TCA solution.
[0262] The urea formed from the above reaction was quantified using the DAMO direct colorimetric method described by World Health Organization (WHO). This protocol has been adopted by WHO as the Standard Operating Procedures (SOP) for measuring the blood urea concentration. Several reagents were prepared regarding the SOP, mixed acid reagent was prepared by slowly adding 100 mL concentrated sulfuric acid to 400 mL distilled water followed by 0.3 mL stock acid reagent (0.5 g ferric chloride hexahydrate in 15 mL of distilled water and make up to 25 mL by concentrated phosphoric acid). Mixed color reagent was prepared by mixing 35 mL stock color reagent A (1 g DAMO in 50 mL distilled water) and 35 mL stock color reagent B (0.25 g thiosemicarbazide in 50 mL distilled water) and make up to 500 mL with distilled water. Working urea standard was prepared by adding 5 mL of stock urea standard (0.5 g urea in 50 mL benzoic acid) to 45 mL benzoic acid (1 g/dL). The DAMO assay was carried out by adding 100 L of 20-fold diluted reaction mixture to a glass boiling tube and followed by 3 mL of color development reagent which is freshly prepared by mixing distilled water, mixed color reagent and mixed acid reagent in 1:1:1 ratio. The tubes were incubated at 100 C. for 15 min and allowed to cool to room temperature for 5 min. The absorbance at 540 nm was measured. One unit of arginase is defined as the amount of enzyme that converts a micromole of arginine to ornithine and urea per minute at 37 C., pH 7.4. The enzyme activity was calculated using the following equations, the absorbance value of the sample was subtracted from its blank:
A.sub.540 nmSample=A.sub.540 nmSampleA.sub.540 nm Sample Blank
[0263] The amount of urea produced is calculated from the standard curve:
Example 11: Determination of Protein Concentration
[0264] The protein concentration was determined by Bradford's assay. The Protein Assay Dye Reagent Concentrate (Bio-rad) was diluted 5 times before use. 20 L of sample was mixed with 1 mL diluted dye reagent and incubated at room temperature for 10 min. To determine the protein concentration, the mixture was measure at 595 nm with Quick Start Bovine Serum Albumin Standard Set (Bio-rad) as standard in the range of 0-1 mg/mL.
Example 12: Enzymatic Activity of the BHA (SEQ ID NO: 75) Fusion Protein
[0265] The arginine catabolic activity of BHA (SEQ ID NO: 75) was assayed in order to find out whether the enzymatic activity would be affected in the presence of HSA. The results showed that the activity of BHA (SEQ ID NO: 75) was not affected by the various amounts of HSA added to the activity assay. The mole ratio of BHA:HSA tested in the binding studies were 1:10, 1:5, 1:1, 5:1 and 10:1. Under all these conditions, the measured specific activities of BHA (SEQ ID NO: 75) alone and the BHA-HSA complexes were very similar, and were approximately 200 U/mg.
Example 13: Binding of N-ABD-rhArg (SEQ ID NO: 49) or BHA (SEQ ID NO: 75) to HSA Revealed by Non-Denaturing PAGE Analysis
[0266] When ABD is fused to rhArg or BCA, it is important for the fusion protein to retain both the albumin binding capacity and the enzymatic activity. To demonstrate the binding capacity of ABD in the fusion proteins, a fixed amount of human serum albumin (HSA) was incubated with N-ABD-rhArg (SEQ ID NO: 49) or BHA (SEQ ID NO: 75) in different molar ratios. The reaction mixtures were analyzed in their native condition on non-denaturing PAGE where the proteins were separated by size and conformation.
[0267] In
Example 14: In Vivo Study of BHA (SEQ ID NO: 75)
[0268] Six BALB/c mice of 8 weeks old were used for the in vivo study of BHA (SEQ ID NO: 75). Prior to the injection of BHA (SEQ ID NO: 75), blood sample was taken from each mouse and used as control (0 h). The mice were randomly divided into two groups for intraperitoneal (i.p.) and intravenous (i.v.) injection, respectively. BHA (SEQ ID NO: 75) (250 U) was injected to each mouse, and blood samples were taken at 6, 24, 72, and 120 h after injection. The plasma of each blood sample at 16 L was analyzed by an amino acid analyzer (Biochrom) for arginine and ornithine content.
[0269] The in vivo arginine-depleting effect of BHA (BHA SEQ ID NO: 75) was studied in BALB/c mice and is compared with that of BCA (S161C)-His (SEQ ID NO: 89), as shown in
Example 15: In Vivo Pharmacodynamics Study of N-ABD-rhArg (SEQ ID NO: 49)
[0270] The anti-cancer effects of arginase had been investigated long time ago (Greenberg and Sassenrath, 1953, Cancer Res. 13, 709-715). Arginase was found to have very good anti-cancer effect in vitro. However, nearly no effect was observed in vivo, due to the short plasma half-life. Plasma arginine dropped to the lowest level 3 hours after injection of native arginase to C3H mice. Arginine increased to normal basal level 5 hours after injection in the same model (Greenberg and Sassenrath, 1953, Cancer Res. 13, 709-715). Therefore, arginase was considered as an ineffective anti-cancer agent, because of the short plasma half-life. This suggested that plasma half-life can affect the potency of the enzyme drug in vivo. N-ABD-rhArg (SEQ ID NO: 49) and N-ABD094-rhArg (SEQ ID NO: 50) showed similar specific activity. We found that extension of plasma half-life of rhArg (SEQ ID NO: 103) via fusion with ABD is an effective method. To reduce the production cost of rhArg (SEQ ID NO: 103) with extended plasma half-life, N-ABD-rhArg (SEQ. ID NO: 49) and N-ABD094-rhArg (SEQ ID NO: 50) were developed.
[0271] Fifteen female BALB/c mice (10 weeks of age) were used in this study. They were kept in groups of five per cage. A single dose of N-ABD-rhArg (SEQ ID NO: 49) (500 U, 250 U, and 125 U, respectively) was administered to the mice via i.p. injection. Blood samples were collected from the saphenous vein using heparinized capillary tubes, and were centrifuged at 800g to obtain plasma. Sixteen microliters of plasma sample was subjected to measurement of L-arginine concentration using the Biochrom 30 Amino Acid Analyzer. The results are shown in
Example 16: In Vivo Pharmacodynamics and Pharmacokinetics Study of N-ABD094-rhArg (SEQ ID NO: 50)
[0272] Fifty C57BL/6J male mice (10-12 weeks of age) were used in this study. A single dose of 500U N-ABD094-rhArg (SEQ ID NO: 50) was administered to the mouse via i.p. injection. Blood samples were collected from the saphenous vein using heparinized capillary tubes, and were centrifuged at 800g to obtain plasma. Five microliters of plasma sample was subjected to measurement of L-arginine concentration by liquid chromatography-tandem mass spectrometry using the Agilent 6460 Liquid Chromatography/Electrospray Ionization Triple Quadrupole Mass Spectrometer, with a detection limit of 0.3 M L-arginine Five microliters of plasma sample was subjected to measurement of N-ABD094-rhArg (SEQ ID NO: 50) concentrations using Human Arginase I ELISA (Enzyme-Linked Immunosorbent Assay) Kit (Abeam) that specifically detects human arginase, and does not react with mouse arginase.
[0273] Following injection, serum was collected at Hour 2, Hour 4, Hour 8, Hour 16, Hour 24 (Day 1) and from Day 2 to Day 12 at 24-hour intervals, and from Day 12 to Day 30 at 72-hour intervals. To strike a balance between the number of animals used and to minimize the effect on results of pharmacokinetics and pharmacodynamics study caused by removal of N-ABD094-rhArg (SEQ ID NO: 50) from the mouse as a consequence of blood collection, mice were divided into 10 groups, with n=5 in each group, and subjected to blood collection at the indicated time-point(s) shown in brackets: Group 1 (Hour 2), Group 2 (Hour 4), Group 3 (Hour 8), Group 4 (Hour 16), Group 5 (Hour 24), Group 6 (Day 2, Day 7, Day 12), Group 7 (Day 3, Day 8, Day 18), Group 8 (Day 4, Day 9, Day 21), Group 9 (Day 5, Day 10, Day 15, Day 24), Group 10 (Day 0, Day 6, Day 11, Day 27, Day 30). The pharmacodynamics and pharmacokinetics results are respectively shown in
[0274] Results of measurement of plasma arginine concentrations showed that 500U of N-ABD094-rhArg (SEQ ID NO: 50) administered via i.p. injection could deplete plasma arginine concentrations to 1 M within 2 hour after injection (
TABLE-US-00012 TABLE 4 Plasma arginine concentrations prior to and at different time points after i.p. injection of 500U N-ABD094-rhArg (SEQ ID NO: 50) Time point after Plasma arginine concentrations (M) injection (Mean of 5 mice SEM) 0 134.543 3.791 Hour 2 1.007 0.013 Hour 4 0.934 0.021 Hour 8 0.912 0.006 Hour 16 0.943 0.010 Hour 24 0.934 0.007 Day 2 0.944 0.007 Day 3 0.965 0.008 Day 4 0.535 0.121 Day 5 0.681 0.043 Day 6 0.896 0.089 Day 7 0.792 0.135 Day 8 0.916 0.079 Day 9 1.224 0.178 Day 10 0.721 0.054 Day 11 3.828 1.511 Day 12 7.607 2.325 Day 15 31.283 4.569 Day 18 48.648 3.989 Day 21 73.55 3.76 Day 24 76.07 4.92 Day 27 111.09 6.21 Day 30 110.91 3.81
[0275] The pharmacokinetic parameters are calculated with two compartment model.
[0276] The elimination rate constant k.sub.e is calculated by the following equation:
[0277] The plasma half-life t.sub.1/2, is calculated by the following equation:
[0278] Area under the curve (AUC) is calculated by the trapezoidal rule with the following equation:
For comparison, we use the reported half-life of the native rhArg in literature. The fusion protein N-ABD094-rhArg (SEQ ID No: 50) had elimination half-life of 3.90.3 days (
Example 17: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Reduces Fat Mass, Suppresses Lipogenesis and Improves Insulin Sensitivity in Normal Lean Mice
[0279] Our data on a mouse model show that a single i.p. injection of 500U N-ABD094-rhArg (SEQ ID NO: 50) to 8-week old normal lean C57BL/6J male mice could maintain plasma arginine concentrations at 1 M for at least 10 days, demonstrating the long circulatory half-life of N-ABD094-rhArg (SEQ ID NO: 50) (
[0280] Obesity is highly associated with insulin resistance. We therefore conducted both in vivo and in vitro study to determine whether N-ABD094-rhArg (SEQ ID NO: 50) treatment will have effects on insulin sensitivity. Results of insulin tolerance test (ITT) showed that mice treated with N-ABD094-rhArg (SEQ ID NO: 50) exhibited a significant increase in insulin sensitivity after 2 weeks of drug treatment (
[0281] The findings on normal lean mice have demonstrated that N-ABD094-rhArg (SEQ ID NO: 50) has a long circulatory half-life, and can reduce fat mass, suppress lipogenesis, and improve insulin sensitivity both in vivo and in vitro. These results give support that ABD-rhArg fusion protein can be used for the prevention and treatment of obesity and associated metabolic disorders, such as insulin resistance and hepatic steatosis (fatty liver).
Example 18: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Effectively Prevents HFD-Induced Obesity
[0282] Treatment with recombinant human arginase [N-ABD094-rhArg (SEQ ID NO: 50)] can significantly reduce fat mass, suppress lipogenesis and improve insulin sensitivity in normal lean mice.
[0283] The effect of N-ABD094-rhArg (SEQ ID NO: 50) on adiposity and various metabolic parameters in obese animals was tested. A high-fat diet-induced obesity (DIO) mouse model [Wang and Liao, 2012, Methods Mol. Biol. 821:421-433], which shares many characteristics with human obesity and is widely used for testing prospective anti-obesity agents [Vickers et al., 2011, Br. J. Pharmacol. 164(4):1248-1262], was employed. Specifically, C57BL/6J, which is the most commonly used mouse strain for polygenic obesity model, was employed in the study. It is well-reported that C57BL/6J mice feeding on a high-fat diet will have prominent weight gain, become obese and develop hyperinsulinemia, hyperglycemia, impaired glucose tolerance and insulin resistance [Gallou-Kabani et al., 2007, Obesity 15(8):1996-2005].
[0284] To determine the efficacy of N-ABD094-rhArg (SEQ ID NO: 50) in preventing mice from diet-induced obesity and associated metabolic disorders, C57BL/6J male mice were fed a high-fat diet containing 60 kcal % fat (HFD; Research Diets, D12492) from 8 week old for 12 weeks, and concurrently received i.p. injection of 200-300U N-ABD094-rhArg (SEQ ID NO: 50) or saline as vehicle control at 7-day intervals. C57BL/6J mice fed a matched low fat diet containing 10 kcal % fat (LFD; Research Diets, D12450J) and injected with saline served as the lean control of various measurements.
[0285] Two cohorts, with n=5 in each group, had been separately conducted. Mice were housed in group of 5. Similar results were obtained in the two independent cohorts. Data of one cohort of mice were summarized in Examples 18-22.
[0286] In comparing with the lean control fed a LFD and treated with vehicle [referred to as LFD(vehicle) group], vehicle-treated male mice fed a HFD [referred to as HFD(vehicle) group] showed a marked gain in bodyweight (
[0287] After confirming the anti-obesity effect of N-ABD094-rhArg (SEQ ID NO: 50) on male mice, the effect of N-ABD094-rhArg (SEQ ID NO: 50) on female mice (n=5 in each group) was studied to determine if there was any sex difference. Results showed that concurrent treatment with N-ABD094-rhArg (SEQ ID NO: 50) was similarly effective in protecting female mice fed a HFD starting from 8 week old for 12 weeks from weight gain (
[0288] To test the effect of N-ABD094-rhArg (SEQ ID NO: 50) on fat cells, mouse 3T3-L1 preadipocytes were used, which are commonly employed as cell-based model for studying adipogenesis [Green and Meuth, 1974, Cell 3:127-133]. It was found that N-ABD094-rhArg (SEQ ID NO: 50) could effectively inhibit adipogenesis and lipogenesis in 3T3-L1 cells (
[0289] Moreover, supplementing arginine-free medium with varying concentrations of L-arginine demonstrated the dose-dependent effect of arginine on adipogenesis and lipogenesis (
[0290] Together, these findings demonstrate that the anti-adipogenesis and lipogenesis effect of N-ABD094-rhArg (SEQ ID NO:50) is mediated via arginine deprivation.
[0291] Collectively, these findings support that arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzymes (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used as a preventive anti-obesity therapy.
Example 19: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Prevents HFD-Induced Insulin Resistance, Impaired Glucose Tolerance, and Metabolic Derangements
[0292] Obesity is commonly associated with insulin resistance, impaired glucose tolerance and metabolic derangements. Indeed, in comparison with the vehicle-treated lean control mice fed a LFD, vehicle-treated mice fed a HFD showed a significant reduction in sensitivity to blood glucose-lowering effect of the injected insulin in the insulin tolerance test (ITT) conducted at 6 week after feeding on a HFD (
[0293] Together, these results demonstrate that N-ABD094-rhArg (SEQ ID NO: 50) can effectively prevent insulin resistance and glucose intolerance, a precursor to developing type 2 diabetes. It may also prevent leptin resistance and other metabolic derangements including dyslipidemia associated with obesity.
[0294] Collectively, these results support that arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzymes (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used as a preventive anti-diabetes, anti-dyslipidemia, anti-atherosclerosis and anti-metabolic derangement therapy.
Example 20: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Prevents HFD-Induced Steatosis
[0295] Steatosis refers to abnormal retention of lipids within the cell. Non-alcoholic hepatic steatosis (non-alcoholic fatty liver) is a common comorbidity associated with obesity. While it may be asymptomatic during early stage, it will become steatohepatitis when the liver is inflamed, which can progress to fibrosis and further develop into cirrhosis at more advanced stages, which greatly increases the risk to become hepatocellular carcinoma. Indeed, it was found that in the vehicle-treated mice fed a HFD, the liver was prominently enlarged and pale in colour (
[0296] Other than the liver, obesity is also associated with excessive accumulation of lipids in the kidney (renal steatosis), pancreas (pancreatic steatosis) and heart (cardiac steatosis), causing lipotoxicity and dysfunction of these organs. Indeed, it was found that in the vehicle-treated mice fed a HFD, there was a significant increase in the weight of the kidney (
[0297] Collectively, these results support that ABD-rhArg fusion protein can effectively prevent steatosis and arginine depletion by N-ABD094-rhArg (SEQ ID NO: 50) or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzymes (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used as a preventive anti-steatosis therapy.
Example 21: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Prevents HFD-Induced Chronic Inflammation
[0298] Excessive expansion of WAT will increase the production of a number of adipokines, which trigger chronic low-grade inflammation that contributes to the development of insulin resistance. Monocyte chemoattractant protein-1 (Mcp1) is one of the key proinflammatory adipokines secreted by WAT that regulates macrophages infiltration into the WAT, insulin resistance and hepatic steatosis in obesity. Indeed, we found that the mRNA level of Mcp1 was significantly upregulated in perigonadal WAT of vehicle-treated mice fed a HFD (
[0299] These results demonstrate that N-ABD094-rhArg (SEQ ID NO: 50) can prevent chronic low-grade inflammation associated with obesity and support the potential of arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) as a preventive anti-inflammation therapy.
Example 22: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Prevents HFD-Induced Whitening and Deregulation of Fatty Acid Oxidation in Brown Adipose Tissue and Enhances Non-Shivering Thermogenesis
[0300] Brown adipose tissue (BAT) serves to dissipate oxidative fuels into heat (non-shivering thermogenesis). Recent studies show that it has great capacity in energy expenditure to counteract obesity. On the contrary, whitening of BAT is associated with obesity and impairs BAT function. Indeed, we found that in vehicle-treated mice fed a HFD, the interscapular BAT was prominently enlarged (
[0301] Together, these results demonstrate that N-ABD094-rhArg (SEQ ID NO: 50) treatment can effectively prevent brown fat whitening and deregulation of fatty acid oxidation in BAT associated with obesity, and enhances non-shivering thermogenesis to combat against the adiposity effect of HFD.
[0302] These findings support the potential of arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., ABD094-rhArg, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) as a preventive anti-obesity therapy.
Example 23: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Effectively Reduces HFD-Induced Obesity
[0303] After confirming that concurrent treatment with N-ABD094-rhArg (SEQ ID NO: 50) can effectively prevent HFD-induced obesity and associated complications and comorbidities including insulin resistance, glucose intolerance, hyperglycemia, dyslipidemia, hepatic steatosis, chronic inflammation, and whitening of BAT, next, we studied the efficacy of N-ABD094-rhArg (SEQ ID NO: 50) in reducing obesity and reversing these disorders in mice with pre-existing diet-induced obesity (DIO). C57BL/6J male mice were fed a HFD from 5 week old for 12 weeks to induce obesity and associated complications and comorbidities. They were then stratified according to the bodyweight into 2 groups and treated with either 600-700U N-ABD094-rhArg (SEQ ID NO: 50) or saline as vehicle control at 7-day intervals for 12 weeks while continued to be fed the HFD. One group of mice were fed a matched low fat diet (LFD) and injected with saline throughout the study to serve as the lean control of various measurements. Two cohorts, with n=5 in each group, have been separately conducted. Mice were housed in groups of 5. Similar results were obtained in the two independent cohorts. Data of one cohort of mice were presented in Examples 23-28.
[0304] Twelve weeks of HFD feeding could increase the bodyweight of male mice to over 50 g, which was markedly heavier than lean control male mice fed a LFD (
[0305] Together with results in Example 18, these findings support that ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used for therapeutic treatment of obesity.
Example 24: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Reverses HFD-Induced Insulin Resistance and Impaired Glucose Tolerance, and Corrects Metabolic Derangement
[0306] Prior to treatment, mice feeding on a HFD for 12 weeks had developed peripheral insulin resistance (
[0307] Collectively, our findings demonstrate the great efficacy of N-ABD094-rhArg (SEQ ID NO: 50) in reversing insulin resistance, impaired glucose tolerance, hyperglycemia, hyperinsulinemia, hyperleptinemia and hypercholesterolemia within 4 weeks of treatment.
[0308] Together, these findings support that arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used as an insulin-sensitizing agent, and for therapeutic treatment of prediabetes and type 2 diabetes characterized by insulin resistance, glucose intolerance and hyperglycemia, and other disorders associated with insulin resistance. It can also be used for therapeutic treatment of hyperleptinemia and hypercholesterolemia.
Example 25: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Reverses HFD-Induced Steatosis
[0309] Twelve weeks of HFD feeding induced hepatic steatosis in male mice (
[0310] Other than the liver, obesity is also associated with excessive accumulation of lipids in the kidney (renal steatosis), pancreas (pancreatic steatosis) and heart (cardiac steatosis), causing lipotoxicity and dysfunction of these vital organs. Indeed, there was a significant increase in the weight of kidney (
[0311] Collectively, these findings support that ABD-rhArg fusion proetin or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used for therapeutic treatment of steatosis.
Example 26: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Reduces HFD-Induced Chronic Inflammation and Fibrosis
[0312] As illustrated in Example 21, HFD feeding induces chronic inflammation. In vehicle-treated DIO mice, concomitant with upregulated expressions of proinflammatory adipokine Mcp1 in perigonadal WAT (
[0313] In the liver of vehicle-treated DIO mice, there was significant upregulation of several proinflammatory genes including Interleukin 1 alpha and 1 beta (Il1a and Il1b) (
[0314] Collectively, these findings demonstrate that N-ABD094-rhArg treatment can effectively alleviate chronic inflammation, and fibrosis in the liver, kidney, pancreas and probably other organs as well.
[0315] Fatty liver (hepatic steatosis) may be asymptomatic during early stage. It will become steatohepatitis when the liver is inflamed, which can progress to fibrosis and further develop into cirrhosis at more advanced stages, which greatly increases the risk to become hepatocellular carcinoma. Our findings suggest that N-ABD094-rhArg treatment can stop the progression of liver disease and reverse liver damage.
[0316] Together, these results support that arginine depletion by ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG, BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ABD-ADI, ADC-PEG or ADC-ABD) can be used for therapeutic treatment of chronic inflammation and fibrosis.
Example 27: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Reverses Whitening of Brown Fat
[0317] After prolonged feeding on a HFD, there was a further increase in the size (
[0318] Collectively, these results support that ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used for therapeutic treatment of obesity via reversing whitening of brown fat.
Example 28: Treatment with N-ABD094-rhArg (SEQ ID NO: 50) Lowers Blood Pressure
[0319] Obesity is associated with cardiovascular disease and hypertension. DIO mice treated with 600U N-ABD094-rhArg (SEQ ID NO: 50) at 7-day intervals for 5 weeks were subjected to measurement of blood pressure by tail cuff method using the CODA Non-invasive Blood Pressure System (Kents Scientific Corporation). It was found that the systolic and diastolic blood pressure (
[0320] Collectively, these findings support that ABD-rhArg fusion protein or other forms of arginase (e.g., rhArg-PEG, BCA-PEG or BCA-ABD) or arginine-depleting enzyme (e.g., ADI-PEG, ADI-ABD, ADC-PEG or ADC-ABD) can be used for therapeutic treatment of hypertension.
Example 29: N-ABD0094-rhArg (SEQ ID NO: 50) does not Induce Neutralizing Antibody and Remains Effective for Prolonged Use
[0321] Generation of neutralizing antibodies may affect the pharmacodynamics, pharmacokinetic, stability and efficacy of a drug. To determine the immunogenic response, 8 week old C57BL/6J male mice fed a LFD received i.p. injection of 500U of N-ABD094-rhArg (SEQ ID NO: 50), or saline as vehicle control, at 7-day intervals for 8 months. It was found that despite the presence of anti-drug antibodies against N-ABD094-rhArg (SEQ ID NO: 50) (
[0322] To assess the safety of long-term use, serum and urine samples from LFD-fed mice treated with N-ABD094-rhArg (SEQ ID NO: 50) for 8 months were collected for analysis of ALT and AST, which are commonly used biomarkers of liver damage, and serum creatinine and urine albumin/creatinine ratio for assessing kidney functions. It was found that LFD-fed mice treated with the drug did not show any significant differences from LFD-fed mice treated with vehicle (
[0323] In a separate study in which diet-induced obese C57BL/6J male mice were treated with 600U N-ABD094-rhArg (SEQ ID NO: 50) for 20 weeks while continued to be fed a HFD, the bodyweight was reduced to a level similar to the lean control mice by 5 weeks and continued to be maintained at this level without rebound. Regular monitoring of plasma arginine concentrations showed that arginine remained at levels below the detection limit of the Biochrom 30 Amino Acid Analyzer (3 M). These results support that N-ABD094-rhArg (SEQ ID NO: 50) remained effective throughout the treatment period. Together, these findings support that N-ABD094-rhArg (SEQ ID NO: 50) is safe and effective for long term use.
Example 30: PEGylation Protocol for Recombinant Human Arginase (rhArg)
[0324] Recombinant human arginase (His-rhArg SEQ ID NO: 101) was obtained by purification using affinity chromatography. Prior to PEGylation, the purified His-rhArg (SEQ ID NO: 101) was diafiltered against 20 mM sodium phosphate (pH 8.0), and the protein concentration was adjusted to 2 mg/mL. PEGylation reagents were made up in 20 mM sodium phosphate (pH 8.0). A molar ratio of PEG reagent to rhArg at 20:1 was used. The PEG reagent was added to the His-rhArg (SEQ ID NO: 101) and then incubated for 4 hours at room temperature with stirring. The reaction mixture was then diafiltered against 20 mM sodium phosphate (pH 7.4) using tangential flow filtration (TFF). Excess PEG was removed in the flow through using affinity chromatography and the PEGylated His-rhArg (SEQ ID NO: 101) was recovered by eluting the protein with 0.5 M imidazole. Any underivatized His-rhArg (SEQ ID NO: 101) was separated by another round of affinity chromatography. The reaction mixture was then analyzed by SDS-PAGE using 12% polyacrylamide gel. The gel was stained with Coomassie blue for molecular weight identification, or 0.1 M iodine solution for detection of free PEG.
[0325] For example, in a preparation, 150 mg of the PEGylated His-rhArg (SEQ ID NO: 101) was obtained, with specific activity of 245 U/mg and concentration of 7.5 mg/mL.
TABLE-US-00013 TABLE 5 Production of PEGylated His-rhArg (SEQ ID NO: 101) and its analysis. Volume Concentration Total Specific Act. (mL) (mg/mL) (mg) (U/mg) PEGylated His-rhArg 11 3.5 38.5 189 batch 3 PEGylated His-rhArg 35 5.3 185.5 213 batch 3
Example 31: Treatment with PEGylated his-rhArg [SEQ ID NO: 101] Reduces Obesity and Improves Insulin Sensitivity
[0326] Production of PEGylated His-rhArg (SEQ ID NO: 101) is described in Example 30. C57BL/6J male mice with pre-existing diet-induced obesity (DIO) received i.p. injection of 300U PEGylated His-rhArg [SEQ ID NO: 101], or saline as vehicle control, at 7-day intervals for 5 weeks, while continuously being fed a HFD. The bodyweight of the mice treated with PEGylated His-rhArg (SEQ ID NO: 101) gradually reduced to 30 g, which was similar to the vehicle-treated lean control mice fed a chow diet (
[0327] Two weeks after treatment of PEGylated His-rhArg [SEQ ID NO: 101], DIO mice already showed a lower fasting blood glucose levels (
[0328] Together, these findings support that PEGylated His-rhArg [SEQ ID NO: 101] has anti-adiposity and insulin-sensitizing effects similar to N-ABD094-rhArg [SEQ ID NO: 50]. Arginine deprivation by PEGylated His-rhArg (SEQ ID NO: 101) has therapeutic effects to treat obesity and diseases associated with insulin resistance.
Example 32: Metal Ion Substitution
[0329] Wild type arginase typically includes a Mn.sup.2+ metal ion (DAntonio & Christianson, 2011, Biochemistry, 50:8018-27). It is found that metal ion substitution is a method to prepare a much more potent form of ABD094-rhArg (low K.sub.m value and high k.sub.cat/K.sub.m value). Purified N-ABD094-rhArg (SEQ ID NO: 50) in 20 mM Tris-HCl buffer (pH 7.4) was mixed with 20 mM of different divalent metal ions (Mn.sup.2+, Ni.sup.2+ or Co.sup.2+), and was incubated at 52-55 C. for 15-60 min and then buffer exchanged with PBS buffer (pH 7.4).
[0330] Samples were subjected to enzyme activity and enzyme kinetic studies to determine the specific activity and catalytic efficiency (k.sub.cat/K.sub.m). Samples were applied to inductively coupled plasma atomic emission spectroscopy (ICP-OES, Agilent 700 Series ICP optical emission spectrometer) for quantitative analysis of metal content.
[0331] Each protein sample (100-200 L) was added to 10 ml of 1% w/v HNO.sub.3 and then different elements and wavelengths were selected for ICP-OES analysis. The metal to protein ratio was determined by dividing metal concentration by protein concentration. Pierce BCA protein assay was used to evaluate the protein concentration following the manufacturer's instruction (Thermo Fisher Scientific).
[0332] Adding Co.sup.2+ or Ni.sup.2+ metal ion to N-ABD094-rhArg (SEQ ID NO: 50) resulted in good Mn.sup.2+ removal and incorporation of Co.sup.2+ or Ni.sup.2+.
[0333] It was found that the cobalt-substituted enzyme (N-ABD094-rhArg-Co.sup.2+) showed much smaller K.sub.m (0.27-0.35 mM), higher k.sub.cat (250-316 s.sup.1) and higher catalytic efficiency k.sub.cat/K.sub.m (905-917 s.sup.1 mM.sup.1). For the original enzyme (N-ABD094-rhArg-Mn.sup.2+), it has K.sub.m of 1.37-1.89 mM, k.sub.cat of 82-98 s.sup.1 and k.sub.cat/K.sub.m of 44-72 s.sup.1 mM.sup.1. The metal substitution method successfully replaced Mn.sup.2+ by Co.sup.2+, leading to a saturated Co.sup.2+ to protein ratio of approximately 2-4 to 1. The data suggest that a more potent form of N-ABD094-rhArg (SEQ ID NO: 50) or other fusion proteins described herein can be manufactured by substitution with other divalent metal ions (e.g., Ni.sup.2+ or Co.sup.2+).
Example 33: Treatment with N-ABD094-rhArg-Co.SUP.2+.[SEQ ID NO: 50 (Cobalt Substituted)] Reduces Obesity
[0334] Production of N-ABD094-rhArg-Co.sup.2+ [SEQ ID NO: 50 (cobalt substituted)] is described in Example 32. C57BL/6J male mice with pre-existing diet-induced obesity (DIO) received i.p. injection of 25-100U N-ABD094-rhArg-Co.sup.2+[SEQ ID NO: 50 (cobalt substituted)] for 5 weeks, while continuously being fed a HFD. The bodyweight of the mice gradually reduced from 55 g to 30 g within 5 weeks of treatment (
Example 34: Mammalian Cell Culture and Proliferation Assay
[0335] Cancer cell lines (e.g. MKN45, AGS, BGC823, HCT-15 and HCT-116) were maintained in RPMI Medium with 10% FBS and 100 units/mL penicillin/streptomycin by standard protocol.
[0336] For cell proliferation assay, cancer cells (510.sup.3) in a volume of 100 L of growth medium were seeded to each well of a 96-well plate and incubated for 24 h. The culture medium was replenished by arginine free medium (AFM) supplemented with different concentrations of arginine, fresh medium containing various concentrations of different arginine depleting enzymes as well as using these enzymes in combination with citrulline. The plate was incubated for an additional 1-3 days at 37 C. in an incubator containing a humidified atmosphere of 95% air and 5% CO.sub.2.
[0337] Quantitative cell proliferation assays were performed using MTT (3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide) assays as widely described elsewhere. The amount of arginine depleting enzyme required to kill 50% of the cells in a culture was defined as IC.sub.50.
Example 35: Inhibition of the Proliferation of Various Human Cancer Cell Lines by Various Arginine-Depleting Enzymes (ADI, BCA and ADC)
[0338] The cytotoxicities of arginine deiminase (ADI), bacterial arginase (BCA) and arginine decarboxylase (ADC) were determined in a comparative study in five tumor cell lines: A375, HeLa, BxPC-3, PANC-1, and HCT116.
[0339] As both ADI- and BCA-catalyzed reactions are steps of the urea cycle, the anti-tumor effects of ADI and BCA are both related to cellular ASS level. In contrast, the anti-tumor effect of ADC may be relatively less affected by the presence of ASS, as neither catalytic products of ADC are intermediates of the urea cycle. Our results have demonstrated that ADI, BCA and ADC all exert inhibitory effects in the cell lines studied. ADI is effective against A375, HCT116, BxPC-3, PANC-1, but not HeLa cells, while both BCA and ADC are effective against all these five cancer cell lines tested (Table 6). ADC is the least potent arginine-depleting enzyme but is advantageous over ADI and BCA in terms of efficacy, especially on ASS-positive cancer cells (Table 6).
[0340] Sensitivity of tumor cells to ADI displays a clear relationship to the cellular ASS level (Table 6). Taken together, ADC and BCA can inhibit the proliferation of human cancer cell lines in an ASS-independent manner compared to ADI.
[0341] Table 6. IC.sub.50 and maximum cytotoxicity of ADI, BCA and ADC on five human cancer cell lines. Cells were treated for 72 h before MTT analysis. Data are the mean of three experiments performed in triplicate. IC.sub.50 value is defined as the amount of enzyme needed to achieve 50% inhibition of cell viability. Maximum cytotoxicity is expressed as the maximum percentage of nonviable cells achieved by each enzyme. ADI-resistant cells are defined as cells of which more than 50% survive under the maximum dose of ADI tested.
TABLE-US-00014 TABLE 6 ASS IC.sub.50 (g/mL) Maximum cytotoxicity (%) Cancer Type Cell Line protein level ADI BCA ADC ADI BCA ADC Melanoma A375 Undetectable, 0.03 0.12 5.61 93.92 86.92 84.76 uninducible Colorectal HCT116 Low 0.10 0.22 12.23 72.18 81.05 84.35 Pancreatic BxPC-3 Medium 0.09 0.44 16.85 57.53 84.82 93.16 PANC-1 Low/medium, 0.04 1.81 4.65 55.68 63.01 82.98 inducible Cervical HeLa Low/high, Resistant 1.25 3.82 <50 61.14 86.49 inducible
Example 36: Cytotoxicity of BHA (SEQ ID NO: 75) on Gastric Cancer Cells
[0342] The in vitro efficacy of the albumin-binding arginase BHA (SEQ ID NO: 75) was tested by incubating the MKN45 gastric cancer cell line with various concentrations of BHA (SEQ ID NO: 75) for 72 h and determining the viability of MKN45 by MTT assay. As shown in
Example 37: Evaluation of Apoptosis by Annexin V-FITC and N Double Staining
[0343] To evaluate the induction of apoptosis by the BCA arginase (SEQ ID NO: 71), 310.sup.5 cells were seeded in 6-well plate one day prior to different treatment conditions. The medium was withdrawn and replenished with complete medium supplemented with different concentrations of BCA (SEQ ID NO: 71). After exposed to BCA for 24 h, 48 h and 72 h, both floating cells and adherent cells were collected. Briefly, the floating cells in culture medium were collected by centrifugation at 100g for 3 min at room temperature while the adherent cells were washed with PBS and lifted by incubating with 0.25% trypsin solution for 3 min at 37 C. After addition of complete medium, the cells were collected by centrifugation. The cells were washed with PBS and resuspended in 0.1 mL binding buffer (0.01 M HEPES, pH 7.4; 0.14 M NaCl; 2.5 mM CaCl.sub.2) containing propidium iodide (PI) and annexin V-FITC. The cells were stained in dark at room temperature for 15 min and 0.4 mL of binding buffer was added to each tube prior to flow cytometry analysis using FACSAria (BD biosciences). The cytometer was set to acquire the data from 10,000 cells for each sample and the data were analyzed by the FACSAria software.
[0344] According to the flow cytometry results, apoptosis was induced in HCT116 human colon cancer cells in a time-dependent manner upon BCA (SEQ ID NO: 71) treatment (50 g/mL of BCA). At 24, 48, and 72 h post-BCA-treatment, 16%, 21%, and 25% of HCT116 cancer cells have undergone apoptosis, respectively.
Example 38: Cell Viability Assay and Combination Drug Effects
[0345] Breast cancer cell lines (e.g. human MCF-7 and MDA-MB-231 cells) were used in these studies. Cancer cells (510.sup.3 cells) were seeded in 96-well plates (TPP) with 100 jut complete medium. The plates were incubated in incubator overnight and the cells were allowed to adhere to the plates. The His-rhArg arginase (SEQ ID NO: 101) (from 2 U/mL to 0.0032 U/mL) and autophagy inhibitor chloroquine (CQ, from 100 M to 0.16 M) were then added to the 96-well plate. For the drug combination group, His-rhArg (SEQ ID NO: 101) (from 2 U/mL to 0.0032 U/mL) were added with 20 M CQ (non-constant ratio method) to the wells. Each dosage was triplicated in 3 wells to obtain the average change of cell viability. After 68 h incubation, 10 l of 5 mg/mL MTT [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] solution was added. The plates were put back into the incubator and further incubated for 4 h. To dissolve the insoluble compound, formazan, formed by MTT, 100 l of 10% SDS in 0.01 M HCl was added. The plates were incubated at 37 C. overnight. The color change was measured by spectrophotometer at 570 nm. Control set up (without any drug) was used as base to calculate percentage of cell viability which was used to plot the dose response curve by the software Prism 6.0 (GraphPad) to find the IC.sub.50 values. The interaction or combination effects between His-rhArg (SEQ ID NO: 101) and CQ can be calculated by combination index (CI). CalcuSyn software (Biosoft) was used for calculating the CI values.
[0346] The MCF-7 cancer cells were sensitive to arginine starvation by arginase for 72 h (Table 7). CQ also showed its cytotoxic effects on MCF-7 (Table 8). For the drug combination group, there were synergistic effects (CI<1) between His-rhArg (SEQ ID NO: 101) and CQ (Table 9). Table 10 shows the IC.sub.50 of His-rhArg (SEQ ID NO: 101), CQ, and rhArg plus CQ against the MCF-7 Cancer cells.
TABLE-US-00015 TABLE 7 Percentage of cell viability of the MCF-7 cancer cells after treating with His-rhArg (SEQ ID NO: 101) His-rhArg Mean of % Concentration Cell Viability (U/mL) (n = 6) SEM 2 45.29% 0.80% 0.4 48.75% 0.99% 0.08 70.68% 1.69% 0.016 88.99% 1.64% 0.0032 80.88% 2.40% 0 100.00% 1.44%
TABLE-US-00016 TABLE 8 Percentage of cell viability of the MCF-7 cancer cells after treating with CQ CQ Mean of % Concentration Cell Viability (M) (n = 6) SEM 100 40.73% 2.33% 20 72.41% 1.76% 4 83.34% 0.69% 0.8 85.88% 3.03% 0.16 96.33% 0.91% 0 100.00% 0.87%
TABLE-US-00017 TABLE 9 Combination index (CI) and the percentage of cell viability of combination of His-rhArg (SEQ ID NO: 101) and CQ against the MCF-7 cells His-rhArg CQ Mean of % Concentration Concentration Cell Viability (U/mL) (M) (n = 6) SEM CI 2 20 35.98% 0.37% 0.463 0.4 20 37.34% 0.51% 0.190 0.08 20 45.90% 0.70% 0.253 0.016 20 59.78% 1.32% 0.669 0.0032 20 69.27% 0.98% 1.440 0 0 100.00% 1.44%
TABLE-US-00018 TABLE 10 IC.sub.50 of His-rhArg (SEQ ID NO: 101), CQ and combining His-rhArg (SEQ ID NO: 101) and CQ against the MCF-7 cancer cells MCF-7 IC.sub.50 SEM His-rhArg 0.7869 U/mL 0.0760 U/mL CQ 67.16 M 10.72 M His-rhArg + 0.07617 U/mL 0.00576 U/mL CQ
[0347] The experimental data showed that the MDA-MB-231 breast cancer cells were sensitive to arginine starvation by His-rhArg (SEQ ID NO: 101) and CQ (Table 11 and Table 12). Combination of His-rhArg (SEQ ID NO: 101) and CQ also showed synergistic cytotoxicity on the MDA-MB-231 cells. The CI value was less than 1 (Table 13). Table 14 shows the IC.sub.50 of His-rhArg (SEQ ID NO: 101), CQ, and His-rhArg (SEQ ID NO: 101) plus CQ against the MDA-MB-231 breast cancer cells.
TABLE-US-00019 TABLE 11 Percentage of cell viability of His-rhArg (SEQ ID NO: 101) against the MDA-MB-231 cells His-rhArg Mean of % Concentration Cell Viability (U/mL) (n = 3) SEM 2 49.10% 1.67% 0.4 50.24% 0.33% 0.08 70.87% 1.39% 0.016 79.26% 7.62% 0.0032 93.70% 2.62% 0 100.00% 1.47%
TABLE-US-00020 TABLE 12 Percentage of cell viability of the MDA-MB- 231 cells after incubated with CQ for 72 h CQ Mean of % Concentration Cell Viability (M) (n = 3) SEM 100 43.17% 0.97% 20 75.18% 1.50% 4 82.16% 0.49% 0.8 98.14% 1.38% 0.16 99.03% 1.67% 0 100.00% 3.53%
TABLE-US-00021 TABLE 13 Combination index (CI) and the percentage of cell viability of combination of His-rhArg (SEQ ID NO: 101) and CQ against the MDA-MB-231 breast cancer cells His-rhArg CQ Mean of % Concentration Concentration Cell Viability (U/mL) (M) (n = 3) SEM CI 2 20 44.55% 1.88% 1.697 0.4 20 45.92% 0.65% 0.584 0.08 20 55.33% 1.42% 0.568 0.016 20 61.59% 2.68% 0.623 0.0032 20 46.62% 0.60% 0.263 0 0 100.00% 3.92%
TABLE-US-00022 TABLE 14 IC.sub.50 of His-rhArg (SEQ ID NO: 101), CQ and combining His- rhArg (SEQ ID NO: 101) and CQ against the MDA-MB-231 cells MDA-MB-231 IC.sub.50 SEM His-rhArg 0.9522 U/mL 0.1299 U/mL CQ 73.39 M 5.36 M His-rhArg + 0.1408 U/mL 0.0274 U/mL CQ
[0348] We also tested the drug combination of His-rhArg (SEQ ID NO: 101) (0.016, 0.08, or 0.4 U/mL) and CQ (20 M) on a human liver cancer cell line Red Flu HepG2. Synergistic effects (CI values less than 1) were also observed.
Example 39: Trans-Well Migration Assay and Invasion Assay
[0349] Breast cancer cell lines (human MDA-MB-231 cells and mouse 4T1 cells) were used in these studies. Both migration assay and invasion assay were performed in 24 wells Costar (Corning) Trans-well system (polycarbonate membrane inserts, pore size 8.0 m). Before the assay, the cells were cultivated in appropriate serum free medium for at least 24 h. One day before seeding cells to the upper chambers, 100 L diluted matrigel was added to the upper chambers of the inserts for invasion assay. Serum free medium (100 L) was added to the upper chamber used for migration assay. The 24 well plates were incubated in the incubator for overnight. The next day, cells were trypsinized and counted. In the studies, 310.sup.4 cells of 4T1 or 510.sup.4 cells of MDA-MB-231, with 200 L appropriate serum free medium, were seeded into the upper chambers. Appropriate complete medium (750 L) was added to the lower chambers. For the drug treatment group, 1 U/mL His-rhArg (SEQ ID NO: 101) was added to both chambers. The 24 well plates were incubated at 37 C. humidified atmosphere with 5% CO.sub.2 for 20 h (4T1 cells) or 24 h (MDA-MB-231 cells).
[0350] After incubation, the medium in the upper chambers was removed. The trans-well inserts were washed with 1PBS twice. Cold 100% methanol was added to both upper chambers and lower chambers for 10 min to fix the cells. The inserts were washed with 1PBS for two times. After that, 1% crystal violet in 1PBS was added to both chambers for 15 min to stain the cells. The inserts were washed with 1PBS twice. The cells on the surface of the upper chamber were removed by cotton swab. The inserts were air dried for overnight. Photos were taken by confocal microscope. The results showed that the number of cancer cells that can migrate and invade via the transwell inserts decreased when the cells were treated with 1 U/mL His-rhArg (SEQ ID NO: 101), indicating that arginine depletion by arginase can inhibit cancer cell migration and invasion.
Example 40: N-ABD-rhArg (SEQ ID NO: 49) Inhibits Growth and Metastasis of Aggressive Breast Cancer Cells In Vivo
[0351] For the aggressive 4T1 breast cancer cell xenograft model studies, 10 female nude mice (11-12 weeks of age) were used. They were kept in groups of five per cage and provided food and water ad libitum. The 4T1 cancer cells were harvested by trypsinization and washed twice with 1PBS and resuspended in 1PBS for inoculation. The cancer cells (110.sup.6 cells of 4T1) were injected subcutaneously into the left flank of the mice. Mice were separated into two groups by random when the tumor had a mean length of 6 mm after 3 days of inoculation. They were injected with either 500U (3.2 mg, 230 L) N-ABD-rhArg (SEQ ID NO: 49) or 1PBS once per week. Blood samples were collected from the saphenous vein. Tumor size and the body weight of mice were monitored regularly. The tumor volume was estimated by the following equation:
[0352] The mice were sacrificed after 16 days of cancer cell inoculation (i.e. 13 days after starting of the experiment) because of necrosis of tumor in the PBS-injected control group. After being sacrificed, tumors were collected from the mice and the weight of the tumor was measured. Lungs were also collected and washed with 1PBS. The lungs were fixed in Bouin's solution overnight and washed with 1PBS after fixation. Lung metastatic nodules were counted.
[0353] Importantly, 500U of the albumin-binding arginase N-ABD-rhArg (SEQ ID NO: 49) depleted arginine to a level below the detection limit of the Biochrom 30 Amino Acid Analyzer (3 M) for at least 10 days in BALB/c mice (
TABLE-US-00023 TABLE 15 Serum arginine levels of the N-ABD-rhArg (SEQ ID NO: 49) treated group of mice (mouse 1-4). The levels were measured by using the Biochrom 30 Amino Acid Analyzer. BDL: Below Detection Level; Day 0: before treatment Day 0 Day 6 Day 13 Arginine Arginine Arginine Concentration Concentration Concentration (M) (M) (M) 1 132.5 0 (BDL) 0 (BDL) 2 117.0 0 (BDL) 0 (BDL) 3 130.5 0 (BDL) 0 (BDL) 4 122.5 0 (BDL) 0 (BDL)
[0354]
[0355] These results suggested that arginine depletion by using 500U of N-ABD-rhArg (SEQ ID NO: 49) injected once per week can inhibit the growth of 4T1 aggressive breast cancer xenograft in nude mice significantly. The in vivo study showed that N-ABD-rhArg (SEQ ID NO: 49) can inhibit growth of cancer in nude mice in a safe and efficient way.
[0356] Furthermore, we found that arginine starvation can inhibit 4T1 breast cancer cell metastasis which was consistent with our in vitro results. Lungs of the mice from the treatment group were collected and carefully examined for signs of metastasis after the mice were sacrificed. Three lung metastatic nodules were found in 3 different lungs of the control group; whereas there were no metastatic nodules found in the N-ABD-rhArg (SEQ ID NO: 49) treated group (Table 16). The results showed convincingly that arginine starvation by N-ABD-rhArg (SEQ ID NO: 49) can inhibit tumor metastasis. This suggested that arginine might play an important role in cell migration and tumor metastasis. Depletion of arginine by N-ABD-rhArg (SEQ ID NO: 49) may inhibit some pathways that are important for the metastasis of cancer cells (Knott et al., 2018, Nature, 554:378-381).
TABLE-US-00024 TABLE 16 Number of metastatic nodules in animal studies. Number of metastatic nodules % of metastasis Group found in lungs free animals PBS Control 3 50% (n = 6) 500 U of N-ABD-rhArg 0 100% (n = 4)
Example 41: Cytotoxicity on Human Colon Cancer Cell Lines with the N-ABD094-rhArg (SEQ ID NO: 50) Fusion Enzyme
[0357] The in vitro efficacy of ABD and rhArg fusion protein was tested on human colon cancer cell lines. Human colon cancer cell lines (HCT116, LOVO and HT29) were seeded in 96-well plate at densities of 510.sup.3 cells/well. After 1 day of incubation, the culture medium was replaced with medium containing different concentrations (2, 0.4, 0.08, 0.016 and 0.0032 U/ml) of N-ABD094-rhArg (SEQ ID NO: 50). MTT assay was conducted at Day 3 [3 days after N-ABD094-rhArg (SEQ ID NO: 50) treatment] to determine the IC.sub.50 values. The culture medium was replaced with MTT solution (1 mg/ml) (Invitrogen) and incubated at 37 C. for 4 h. After incubation, MTT solution was replaced with dimethyl sulfoxide (DMSO), and the absorbance at 570 nm was measured with a reference of 650 nm. The cell viability was determined by dividing the absorbance of N-ABD094-rhArg-treated cells by the average absorbance of untreated cells. The IC.sub.50 values of N-ABD094-rhArg (SEQ ID NO: 50) on the cancer cell lines (at 95% confidence interval) were analyzed by software Prism 6.0. Three independent sets of experiments (n=3) were performed for each cell line. Results are shown in Table 17.
TABLE-US-00025 TABLE 17 Single drug experiment using N-ABD094-rhArg (SEQ ID NO: 50); Drug = N-ABD094-rhArg (SEQ ID NO: 50); Cell line = HCT116 Drug conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.938 0.950 0.608 0.452 0.419 SEM 0 0.042 0.116 0.086 0.051 0.046 Cell line = LOVO Drug conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.922 0.848 0.566 0.432 0.392 SEM 0 0.048 0.037 0.075 0.040 0.038 Cell line = HT29 Drug conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.962 0.853 0.521 0.423 0.383 SEM 0 0.070 0.084 0.016 0.009 0.029
[0358] All the colon cancer cell lines tested were very sensitive to the N-ABD094-rhArg (SEQ ID NO: 50) fusion enzyme in vitro with IC.sub.50 values between 0.22 and 0.58 U/ml. HCT116 was the most sensitive tumor with an IC.sub.50 of 0.22 U/ml. The IC.sub.50 values for LOVO and HT29 were 0.38 U/ml and 0.58 U/ml, respectively.
Example 42: Combination of N-ABD094-rhArg (SEQ ID NO: 50) and Chloroquine Exert Synergistic Cytotoxicity Effects on Human Colon Cancer Cell Lines
[0359] The IC.sub.50 values of the autophagy inhibitor chloroquine (CQ) were determined as follows: colon cancer cell lines HCT116, LOVO and HT29 were seeded separately and after 1 day of incubation, the culture medium was replaced with medium containing different concentrations of CQ (100, 20, 4, 0.8, 0.16 M). MTT assay was conducted at Day 3. Three independent sets of experiments (n=3) were performed for each cell line. Results are shown in Table 18.
TABLE-US-00026 TABLE 18 Single drug experiment using CQ; Drug = Chloroquine (CQ); Cell line = HCT116 Drug conc. (U/mL) 0 0.16 0.8 4 20 100 Mean cell viability (%) 1 0.981 0.967 0.921 0.897 0.874 SEM 0 0.032 0.037 0.059 0.033 0.027 Cell line = LOVO Drug conc. (U/mL) 0 0.16 0.8 4 20 100 Mean cell viability (%) 1 0.973 0.921 0.759 0.495 0.060 SEM 0 0.029 0.017 0.027 0.018 0.002 Cell line = HT29 Drug conc. (U/mL) 0 0.16 0.8 4 20 100 Mean cell viability (%) 1 1.057 1.009 0.983 1.018 0.037 SEM 0 0.079 0.071 0.083 0.073 0.006
[0360] The IC.sub.50 values of CQ for HCT116, LOVO and HT29 were >100 M, 15 M and 71 respectively. For drug-combination assay, a non-constant ratio analysis was performed (Hastak et al., 2010, Cancer Res. 70(20):7970-7980). Colon cancer cells were seeded and after 1 day of incubation, the culture medium was replaced with medium containing different concentrations of N-ABD094-rhArg (SEQ ID NO: 50) (2, 0.4, 0.08, 0.016, 0.0032 U/ml) combined with fixed amount of CQ according to its IC.sub.50. MTT assay was conducted at Day 3. The combination index (CI) of combined N-ABD094-rhArg (SEQ ID NO: 50) and CQ treatment was analyzed by software CalcuSyn version 2.1. Three independent sets of experiments (n=3) were performed for each cell line. Results are shown in Table 19.
TABLE-US-00027 TABLE 19 Combination drug experiment (Drug 1 plus Drug 2); Drug 1 = N-ABD094-rhArg (SEQ ID NO: 50); Drug 2 = Chloroquine (CQ) (fixed concentration at 20 M); Cell line = HCT116 Drug 1 conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.951 0.885 0.476 0.273 0.231 SEM 0 0.024 0.027 0.008 0.008 0.006 Cell line = LOVO Drug 1 conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.555 0.542 0.211 0.186 0.177 SEM 0 0.008 0.008 0.002 0.010 0.005 Cell line = HT29 Drug 1 conc. (U/mL) 0 0.0032 0.016 0.08 0.4 2 Mean cell viability (%) 1 0.979 0.983 0.480 0.369 0.367 SEM 0 0.035 0.054 0.036 0.027 0.023
[0361] Results indicate that the CI values were <1.0 when 0.08 or 0.4 U/ml of N-ABD094-rhArg (SEQ ID NO: 50) was combined with 20 M of CQ in all the 3 colon cancer cell lines. This suggests that N-ABD094-rhArg (SEQ ID NO: 50) is active alone and is synergistic in combination with CQ. Taken together, autophagy inhibitor chloroquine (CQ) enhances the cell death inducing effect of the N-ABD094-rhArg (SEQ ID NO: 50) fusion protein in human colon cancer cells.
Example 43: N-ABD-rhArg (SEQ ID NO: 49) and PEGylated his-rhArg (SEQ ID NO: 101) Both Inhibit Growth and Metastasis of Aggressive Breast Cancer Cells In Vivo
[0362] In another 4T1 breast cancer allograft study, female nude mice (5-6 weeks of age) were used. They were kept in groups of five per cage and provided food and water ad libitum. Cells of 4T1 breast cancer (1105) were injected subcultuaneously into the right flank of the mice. Mice were separated into four groups by random when the tumor had a mean length of 8 mm after 11 days of inoculation. There were one control group (n=8) and three experimental groups, including 500U PEGylated His-rhArg (SEQ ID NO: 101) (n=8), 500U N-ABD-rhArg (SEQ ID NO: 49) (n=6) and 250U N-ABD-rhArg (SEQ ID NO: 49) (n=8). Mice in the control group were injected with 1PBS weekly. For the 500U ABD-rhArg group and the 250U ABD-rhArg group, mice were injected with 500U and 250U ABD-rhArg once a week, respectively; one group was injected with 500U PEG-rhArg once per week. The mice were sacrificed after 24 days of inoculation (i.e. 14 days after starting of experiment) because of necrosis of tumor in PBS control group. After sacrificing, the mice were dissected. Tumors were collected from the mice and measured their weight. Lungs were also collected and washed with 1PBS. The lungs were fixed in Bouin's solution overnight and washed with 1PBS after fixation. Lung metastatic nodules were counted.
[0363] For the results,