Enhanced fermentation
10676728 ยท 2020-06-09
Assignee
Inventors
- Max Fabian Felle (Ludwigshafen, DE)
- Stefan Jenewein (Ludwigshafen, DE)
- Stefan Handtke (Greifswald, DE)
- Birgit Voigt (Greifswald, DE)
- Thomas SCHWEDER (Greifswald, DE)
- Michael Hecker (Greifswald, DE)
Cpc classification
C12N9/0065
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
International classification
C12N15/113
CHEMISTRY; METALLURGY
Abstract
The present invention generally relates to the field of fermentation technology and microorganisms useful for such fermentations. The invention also relates to materials including nucleic acids and proteins useful for altering fermentation characteristics of microorganisms, and to microorganisms comprising such nucleic acids and/or proteins. In particular, the invention relates to materials for conferring, modifying or reducing microbial stress resistance.
Claims
1. A method for protecting a microbially produced substance against oxidation, comprising a) providing a microorganism capable of producing said substance, the microorganism comprising, as a heterologous gene, a catalase gene encoding i) a catalase having at least 90% amino acid sequence identity to SEQ ID NO: 1, or ii) a fragment of the catalase according to i), wherein the fragment has catalase activity, and b) cultivating the microorganism under conditions such that said catalase gene is expressed and said substance is produced, wherein the microbially produced substance is an enzyme selected from the group consisting of protease, amylase, carbohydrase, lipase, cellulase, pullulanase, cutinase, pectinase, mannanase, arabinase, galactanase, xylanase, oxidase, peroxidase, isomerase, kinase, and phosphatase.
2. A fermentation method for producing a fermentation product, comprising the steps of a) providing a microorganism capable of producing said fermentation product, the microorganism comprising, as a heterologous gene, a catalase gene encoding i) a catalase having at least 90% amino acid sequence identity to SEQ ID NO: 1, or ii) a fragment of the catalase according to i), wherein the fragment has catalase activity, and b) cultivating the microorganism under conditions such that said catalase gene is expressed and said fermentation product is produced, wherein the fermentation product is an enzyme selected from the group consisting of protease, amylase, carbohydrase, lipase, cellulase, pullulanase, cutinase, pectinase, mannanase, arabinase, galactanase, xylanase, oxidase, peroxidase, isomerase, kinase, and phosphatase.
3. The method according to claim 1, wherein the catalase gene is operably linked to a control sequence and the control sequence is or comprises an inducible promotor.
4. The method according to claim 3, wherein the inducible promoter is a hydrogen peroxide inducible promoter.
5. The method according to claim 1, wherein the enzyme is a subtilisin protease.
6. The method according to claim 2, wherein the enzyme is a subtilisin protease.
7. The method according to claim 2, wherein the catalase gene is operably linked to a control sequence and the control sequence is or comprises an inducible promotor.
8. The method according to claim 7, wherein the inducible promoter is a hydrogen peroxide inducible promoter.
9. The method according to claim 1, wherein the catalase gene encodes a catalase having at least 95% amino acid sequence identity to SEQ ID NO: 1 or a fragment thereof having catalase activity.
10. The method according to claim 2, wherein the catalase gene encodes a catalase having at least 95% amino acid sequence identity to SEQ ID NO: 1 or a fragment thereof having catalase activity.
Description
BRIEF DESCRIPTION OF FIGURES
(1)
(2)
(3)
(4)
(5)
DETAILED DESCRIPTION OF THE INVENTION
(6) The present invention is particularly concerned with catalases. In this regard, the invention puts particular emphasis on a catalase having the amino acid sequence of SEQ ID NO. 1, variants of such catalase and fragments thereof. Thus, the term catalase of the present invention refers to a polypeptide comprising or consisting of the amino acid sequence SEQ ID NO. 1, to variants of such polypeptide comprising or consisting of an amino acid sequence having at least 60% amino acid sequence identity to the sequence according to SEQ ID NO. 1, and also to fragments of such polypeptides, unless a different meaning is expressly attributed to the term. It is understood that the variants and fragments have catalase activity.
(7) A catalase of the present invention is particularly known from Bacillus pumilus under the common name KatX2. The amino acid sequence of the catalase KatX2 of Bacillus pumilus has been determined repeatedly and is recorded in the Uniprot database under accession numbers B4AFT4_BACPU, A8FBF9_BACP2, A0A063Z4T4_BACPU, A0A0B0QA43_9 BACI, M5RKX5_9 BACI, K2MHE7_9 BACI, W8QL66_BACPU, W6ANB4_BACPU, A0A0B4S5R6_9 BACI, A0A059NBL2_9 BACI, A0A0C2PYN3_BACPU and A0A081LAW9_9 BACI, as indicated therein on 8 Oct. 2015. According to the present invention, the catalase KatX2 preferably consists of or comprises the amino acid sequence according to SEQ ID NO. 1. However, any other catalase recorded under the aforementioned Uniprot identifiers (sequences SEQ ID NO. 2-13) is likewise considered a catalase of the present invention.
(8) Thus, catalase sequences according to the present invention are in particular selected from:
(9) TABLE-US-00001 SEQID Uniprot NO. idenfifier sequence 1 KatX2-Bpu MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKWKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIENGNYPAWD LYVQLMPLSDYDDLDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEQVLHGDRMVRQKIEKPNDFKQAGEKYRSY SEEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADS LGVDIRSYLQGNMK 2 B4AFT4_BACPU MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIENGNYPAWD LYVQLMPLSDYDDLDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQVAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEQVLHGDRMVRQKIEKPNDFKQAGEKYRSY SEEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADS LGVDIRSYLQGSMK 3 A8FBF9_BACP2 MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEDG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIENGNYPAWD LYVQLMPLSDYDDLDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEQVLHDDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADSL GVDIRSYLQGNMK 4 A0A063Z4T4_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL BACPU AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPASYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIENGHYPAWD LYVQLMPLSDYDDLDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEQVLHGDRMVRQKIEKPNDFKQAGEKYRSY SEEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADS LGVDIRSYLQGSMK 5 A0A0B0QA43_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKL 9BACI AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEKG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNYPAWD LYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGERYRSYS EEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADSL GVDIRAYLQGNMK 6 M5RKX5_9BACI MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNYPAWD LYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRIVRQKIEKPNDFKQAGERYRSYS EEEKQALIKNLTADLKDVNEKTKLLAICNFYRADEDYGQRLADSL GVDIRSYLQGSMK 7 K2MHE7_9BACI MTNSNHKHLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPVFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPES THMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNYPAWD LYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYLRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKDVNEKTKLLAICNFYRADEDYGQRLADSL GVDIRSYLQGNMK 8 W8QL66_BACPU MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNYPAWD LYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQAAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKGVNEKTKLLAICNFYRADEDYGQRLADSL GVDIRSYLQGSMK 9 W6ANB4_BACPU MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGSSFLDDYHLIEKL AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVANIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRWVNKYGETKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNYPAWD LYVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR PGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKDVNEKTKLLAICNFYRADEDYGQRSADSL GVDIRSYLQGNMK 10 A0A0B4S5R6_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL 9BACI AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPASYAEMRGSGVHTFRVVVNKYGEAKYVKYH WRPSEGIHNLSMEEAAEIQANDFQHATRDLYDRIEKGNFPAWDL YVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSAFVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGERYRSYS EEEKQALIKNLTADLKDVNDKTKLLAICNFYRADEDYGQRLADSL GVDIRAYLQGSMK 11 A0A059NBL2_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL 9BACI AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANYAEMRGSGVHTFRVVVNKYGEAKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNFPAWDL YVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PDNFFAETEQSAFTPSAFVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYA DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKDVNDQTKLLAICNFYRADEDYGQRLADSL GVDIRAYLQGSMK 12 A0A0C2PYN3_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPTFLDDYHLIEKL BACPU AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTKAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPASYAEMRGSGVHTFRVVVNKYGEAKYVKYH WRPSEGIRNLSMEEAAEIQANDFQHATRDLYDRIEKGNFPAWDL YVQLMPLSDYDELDYDPCDPTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSAFVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYA DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS EEEKQALIKNLTADLKDVNDQTKLLAICNFYRADEDYGQRLADSL GVDIRAYLQGSMK 13 A0A081LAW9_ MTNSNHKNLTTNQGVPVGDNQNSRTAGHRGPSFLDDYHLIEKL 9BACI AHFDRERIPERVVHARGAGAYGVFEVENSMEKHTRAAFLSEEG KQTDVFVRFSTVIHPKGSPETLRDPRGFAVKFYTEEGNYDLVGN NLPIFFIRDALKFPDMVHSLKPDPVTNIQDPDRYWDFMTLTPEST HMLTWLFSDEGIPANFAEMRGSGVHTFRVVVNKYGETKYVKYH WKPSEGIRNLSMEEAAEIQANDFQHATRDLFDRIEKGNYPAWDL YVQLMPLSDYDELDYDPCDSTKTWSEEDYPLQKVGRMTLNRN PENFFAETEQSAFTPSALVPGIEASEDKLLQGRLFSYPDTQRHR LGANYMRIPVNCPYAPVHNNQQDGFMTTTRPSGHINYEPNRYD DQPKENPHYKESEPVLHGDRMVRQKIEKPNDFKQAGEKYRSYS DEEKQALIKNLTADLKGVNEKTKLLAICNFYRADEDYGQRLADSL GVDIRSYLQGNMK
(10) Bacillus pumilus had been described as having a high resistance to hydrogen peroxide provoked oxidative stress (Handtke et al., Bacillus pumilus Reveals a Remarkably High Resistance to Hydrogen Peroxide Provoked Oxidative Stress, PLOS ONE, January 2014, volume 9, pages 1 to 14). The authors of said publication describe that Bacillus pumilus is devoid of an otherwise common catalase KatA, which is involved in hydrogen peroxide defence of Bacillus pumilus and Bacillus licheniformis. In these bacilli, catalase KatA expression is induced by more than 100 fold upon exposition to hydrogen peroxide. In Bacillus pumilus, expression of KatX2 upon exposure to hydrogen peroxide is induced only up to 20 fold. The authors further note that upon exposure to hydrogen peroxide Bacillus pumilus induces a number of regulons, leading inter alia to an increased concentration of thiol compounds. Such compounds like bacillithiol have been known to protect intracellular substances against oxidation, for example by preventing reversible or irreversible cysteine oxidation. The authors also notice that a considerable set of hydrogen peroxide induced unique proteins with so far unknown function had been identified. Notably said publication has been subject of an expression of concern by the journal's editors (PLOS ONE, July 2014, Vol 9 Issue 7) on the grounds that the experiments described therein could not be repeated.
(11) In another publication (Handtke et al., Cell physiology of the biotechnological relevant bacterium Bacillus pumilusan omics-based approach, Journal of Biotechnology 192 (2014), 204-214) the authors analysed changes in protein concentration of Bacillus pumilus during a model fermentation. The authors did not report any significant amount of KatX2 catalase in the total set of cytosolic proteins. It came thus as a surprise that KatX2 not only is a catalase having a particularly high catalytic activity, but also that KatX2 would improve fermentations production of other substances.
(12) The present invention thus provides a nucleic acid comprising a catalase gene coding for a polypeptide operably linked to one or more control sequences that direct the production of the polypeptide in an expression host, wherein the polypeptide is
(13) i) a catalase having at least 60% amino acid sequence identity to SEQ ID NO. 1, or
(14) ii) a fragment of the catalase according to i), wherein the fragment has catalase activity.
(15) Such recombinant nucleic acid particularly facilitates the expression of the catalase polypeptide as a heterologous gene in a microorganism, as described herein in more detail. Thus, the recombinant nucleic acid of the present invention allows to confer the benefits of expression of the catalase of the present invention not only in Bacillus pumilus, but also in other microorganisms.
(16) According to the present invention, the term catalase and polypeptide having catalase activity are used interchangeably. Catalase activity can be determined as described in the examples section hereinafter by exposing a protein extract of a microorganism producing a polypeptide of putative catalase activity to hydrogen peroxide, incubating the extract and measuring remaining hydrogen peroxide concentration at defined time points.
(17) The gene codes for a catalase having at least 60% amino acid sequence identity to SEQ ID NO. 1. Thus, the invention also encompasses variants of the mature polypeptide of SEQ ID NO. 1 comprising a substitution, deletion and/or insertion at one or more positions of the amino acid sequence SEQ ID NO. 1, and correspondingly also encompasses corresponding genes et cetera. As indicated above, all such catalase variants must have catalase activity.
(18) The structure of KatX2 catalase is has been elucidated and is recorded in the PDB database under accession number 4QOL (DOI 10.2210/PDB4QOL/PDB). Variants of the catalase according to SEQ ID NO. 1 had been published under the aforementioned Uniprot identifiers and are repeated herein as sequences SEQ ID NO. 2-13. Thus, the skilled person is able to rationally construct new variants of the catalase according to SEQ ID NO. 1, keeping in mind that any substitution, deletion and/or insertion of one or more amino acids relative to the amino acid sequence of SEQ ID NO. 1 should not interfere with the three-dimensional folding of the amino acid chain, and should also not interfere with its agglomeration into a tetramer.
(19) For providing new variants of the catalase according to amino acid sequence SEQ ID NO. 1, the skilled person can perform a pairwise alignment of the amino acid sequence SEQ ID NO. 1 with the amino acid sequence of another functional catalase. This way the skilled person can determine for each position of the amino acid sequence SEQ ID NO. 1 another amino acid found at the corresponding position of another catalase amino acid sequence known to have catalase activity. The skilled person can then replace, at each desired position, the amino acid encountered in the sequence according to SEQ ID NO. 1 by the corresponding amino acid found at the corresponding position of the other catalase. The same applies to insertions and deletions relative to the amino acid sequence according to SEQ ID NO. 1.
(20) For substituting amino acids without regard to the occurrence of amino acid in other catalases, the following applies, wherein bracketed numbers indicate preference of replacement (higher numbers indicate higher preference): A may be replaced by any amino acid selected from S (1), C (0), G (0), T (0) or V (0). C may be replaced by A (0). D may be replaced by any amino acid selected from E (2), N (1), Q (0) or S (0). E may be replaced by any amino acid selected from D (2), Q (2), K (1), H (0), N (0), R (0) or S (0). F may be replaced by any amino acid selected from Y (3), W (1), I (0), L (0) or M (0). G may be replaced by any amino acid selected from A (0), N (0) or S (0). H may be replaced by any amino acid selected from Y (2), N (1), E (0), Q (0) or R (0). I may be replaced by any amino acid selected from V (3), L (2), M (1) or F (0). K may be replaced by any amino acid selected from R (2), E (1), Q (1), N (0) or S (0). L may be replaced by any amino acid selected from I (2), M (2), V (1) or F (0). M may be replaced by any amino acid selected from L (2), I (1), V (1), F (0) or Q (0). N may be replaced by any amino acid selected from D (1), H (1), S (1), E (0), G (0), K (0), Q (0), R (0) or T (0). Q may be replaced by any amino acid selected from E (2), K (1), R (1), D (0), H (0), M (0), N (0) or S (0). R may be replaced by any amino acid selected from K (2), Q (1), E (0), H (0) or N (0). S may be replaced by any amino acid selected from A (1), N (1), T (1), D (0), E (0), G (0), K (0) or Q (0). T may be replaced by any amino acid selected from S (1), A (0), N (0) or V (0). V may be replaced by any amino acid selected from I (3), L (1), M (1), A (0) or T (0). W may be replaced by any amino acid selected from Y (2) or F (1). Y may be replaced by any amino acid selected from F (3), H (2) or W (2).
(21) Preferably, the variant of the polypeptide of SEQ ID NO. 1 has a higher sequence identity to SEQ ID NO. 1 than to the amino acid sequence of a KatA and/or KatX catalase of Bacillus licheniformis and/or Bacillus subtilis.
(22) This way, when providing variants of the catalase according to SEQ ID NO. 1 the skilled person can avoid modifying the amino acid sequence according to SEQ ID NO. 1 in such way as to decrease catalytic activity of the variant catalase compared to the catalase according to SEQ ID NO. 1.
(23) The catalase of the present invention preferably has at least 60% amino acid sequence identity to SEQ ID NO. 1. Even more preferably, the catalase has at least 70% amino acid sequence identity to SEQ ID NO. 1, even more preferably at least 80% amino acid sequence identity to SEQ ID NO. 1, even more preferably at least 90% amino acid sequence identity to SEQ ID NO. 1, and even more preferably at least 95% amino acid sequence identity to SEQ ID NO. 1. With increasing sequence identity to SEQ ID NO. 1, the likelihood of a variant polypeptide having greatly reduced catalase activity is decreased. Correspondingly, the catalase preferably consists of an amino acid sequence differing from SEQ ID NO. 1 by not more than 15 substitutions, deletions and/or insertions of individual amino acids, even more preferably at most 14, more preferably by at most 13, more preferably by at most 12, more preferably by at most 11, more preferably by at most 10, more preferably by at most 9, more preferably by at most 8, more preferably by at most 7, more preferably by at most 6, more preferably by at most 5, more preferably by at most 4, more preferably by at most 3, more preferably by at most 2, most preferably by at most 1 substitutions, deletions and/or insertions of individual amino acids.
(24) In a variant according to the present invention it is preferred not to delete or substitute cysteine moieties at positions 279 and/or 359 according to SEQ ID NO. 1. As described herein, upon exposure of the catalase according to SEQ ID NO. 1 to hydrogen peroxide only the thiol group of cysteine 461 is found to be modified by the formation of sulfonic acid at that position. The cysteine moieties at positions 279 and 359, however, seem to remain unaffected and thus might not require substitution or deletion.
(25) According to the present invention, the catalase polypeptide can consist of an amino acid sequence as described above or a variant thereof having the required amino acid sequence identity. However, the present invention also provides for fragments of such catalase polypeptides, wherein the fragment has catalase activity. Such fragments may differ from the aforementioned amino acid sequences and variants thereof by the deletion of one or more amino acids at either end of the amino acid chain. Due to the requirement of maintaining the three-dimensional structure of the catalase to preserve its catalase activity, fragments according to the present invention differ from the aforementioned amino acid sequences or variants thereof preferably by not more than five amino acid deletions at either end of the amino acid chain, more preferably by at most for deletions, even more preferably by at most three deletions, even more preferably by at most two deletions, even more preferably at most one deletion at either end of the amino acid chain. Fragments according to the invention allow for the production of polypeptides having catalase activity while reducing the amount of resources to produce such catalases. This is particularly advantageous under oxidative stress conditions like exposure to a hydrogen peroxide or internal production of hydrogen peroxide by a microorganism, as the microorganism under these conditions requires all of its resources for defence against said oxidative stress.
(26) The recombinant nucleic acid according to the present invention comprises one or more control sequences that direct the production of the polypeptide in an expression host. The control sequence preferably comprises or is an inducible promoter, most preferably a hydrogen peroxide inducible promoter. Hydrogen peroxide induction can be determined by comparing, via Northern analysis or quantitative PCR, mRNA presence or concentration of a gene operably linked to said promoter in the presence or absence of H2O2. Preferably, a hydrogen peroxide inducible promoter results in an increase of said mRNA concentration by a factor of at least 4, even more preferably by a factor of at least 8, even more preferably by a factor of at least 10, even more preferably by a factor of at least 30, even more preferably by a factor of at least 90. Such promoters provide for the transcription of the gene under conditions where catalase activity actually is required, thereby making efficient use of the microorganism's resources. This way, the recombinant nucleic acid according to the present invention further facilitates fermentations by not unnecessarily redirecting resources that could be used for the firm entities production of a substance of interest as described herein. Preferred promotors are recorded under EMBL accession numbers. Preferred promoters are, for example, Bacillus subtilis KatA promoter and Bacillus pumilus KatX2 promoter, details of which can be found for example at bsubcyc.org/gene?orgid=BSUB&id=BSU08820 and under the Genbank identifiers NC_000964.3 and NC_009848.1, respectively.
(27) Preferably, the one or more control sequences allow for the low basal expression of the gene. This way, the recombinant nucleic acid of the present invention allows an expression host to react immediately to the slow change in hydrogen peroxide concentrations, as occurs in fermentations.
(28) The recombinant nucleic acid according to the present invention preferably is a nucleic acid construct or expression vector. This way, the recombinant nucleic acid allows to efficiently transform a microorganism into an expression host for expressing, preferably on demand as described above, the catalase of the present invention (which may be a variant or fragment as described above).
(29) The invention also provides a microorganism comprising, as a heterologous gene, a catalase gene coding for
(30) i) a catalase having at least 60% amino acid sequence identity to SEQ ID NO. 1, or
(31) ii) a fragment of the catalase according to i), wherein the fragment has catalase activity.
(32) The microorganism of the present invention is thus a recombinant microorganism. The microorganism may be obtained, as described herein, by transforming a wild type microorganism with the recombinant nucleic acid of the present invention. Thus, a microorganism according to the present invention can also be called a microorganism transformed with a catalase gene coding for said polypeptide. This definition excludes cells which were unsuccessfully transformed or which have lost the gene after the transformation event.
(33) The microorganism may comprise the catalase gene in its genome or on a plasmid. Genomic integration of the gene can be achieved by any suitable means known to the skilled person and potentially chosen in view of the respective microorganism. Instructions for performing genomic integration can be found, for example, in Wach, A. (1996) PCR-synthesis of marker cassettes with long flanking homology regions for gene disruptions in S. cerevisiae. Yeast 12, 259-265, the contents of which are incorporated herein in their entirety. Genomic integration has the advantage that the gene coding for the catalase according to the present invention can be maintained during cultivation and fermentation even in the absence of selection pressure, e.g. antibiotic pressure. Also, genomic integration allows to have a native catalase gene of the microorganism replaced by the catalase gene of the present invention.
(34) The microorganism can also comprise the gene on one or more plasmids. Such plasmids should be expression vectors according to the present invention, thereby leading to the expression of the gene coding for the catalase of the present invention under appropriate conditions according to the one or more control sequences. Generally, transformation of a microorganism with a plasmid is easier to achieve than genomic integration of the catalase gene. Microorganisms comprising such one or more plasmids are thus particularly preferred for producing variant catalases of the present invention to test their catalase activity.
(35) It is understood that the microorganism according to the present invention comprises said gene operably linked to one or more control sequences that direct the production of the gene product, that is the catalase of fragment thereof. This allows to materialise the benefits indicated above in view of control sequences.
(36) The microorganism can comprise the heterologous gene under the control of one or more heterologous control sequences. For example, the catalase promoter may be used as control sequence taken from a microorganism (source microorganism) closely related to the microorganism of the present invention (target microorganism). The source microorganism preferably is of the same class as the target microorganism, even more preferably of the same family as the target microorganism, even more preferably of the same genus as the target microorganism, and most preferably of the same species as the target microorganism. The closer the source and target microorganisms are phylogenetically related to each other, the more likely is it that the control sequence taken from a source microorganism directs the production of the corresponding catalase polypeptide in the target microorganism (expression host) under the same conditions as in the source microorganism.
(37) The microorganism can be a prokaryote or a eukaryote. Preferably, the microorganism is a bacteria, an archaea, a fungal cell, a yeast cell or a eukaryotic cell.
(38) Preferably, the microorganism of the present invention preferably belongs to the phylum Firmicutes or Proteobacteria. Preferably, the microorganism belongs to class Bacilli, to order Bacillales or Lactobacillales, to class Clostridia, to order Clostridiales, Halanaerobiales, Natranaerobiales, Thermoanaerobacterales, to class Erysipelotrichia, to order Erysipelotrichales, to class Limnochordia, to order Limnochordales, to class Negativicutes, to order Selenomonadales, to class Thermolithobacteria, to order Thermolithobacterales, to class Alphaproteobacteria, to order Caulobacterales, Kiloniellales, Kopriimonadales, Kordiimonadales, Magnetococcales, Parvularculales, Pelagibacterales, Rhizobiales (rhizobacteria), Rhodobacterales, Rhodospirillales, Rhodothalassiales, Rickettsiales (rickettsias), Sneathiellales, Sphingomonadales, to class Betaproteobacteria, order Burkholderiales, Ferritrophicales, Ferrovales, Gallionellales, Hydrogenophilales, Methylophilales, Neisseriales, Nitrosomonadales, Procabacteriales, Rhodocyclales, Sulfuricellales, to class Deltaproteobacteria, to class Epsilonproteobacteria, to class Gammaproteobacteria, order Acidiferrobacterales, Acidithiobacillales, Aeromonadales, Alteromonadales, Arenicellales, Cardiobacteriales, Cellvibrionales, Chromatiales, Enterobacteriales, Legionellales, Methylococcales, Oceanospirillales, Orbales, Pasteurellales, Pseudomonadales, Salinisphaerales, Thiotrichales, Vibrionales, Xanthomonadales, to class Oligoflexia, to order Oligoflexales, to class Zetaproteobacteria or to order Mariprofundales.
(39) Among the order Bacillales, the microorganism preferably is of family Alicyclobacillaceae, Bacillaceae, Listeriaceae, Paenibacillaceae, Planococcaceae, Sporolactobacillaceae or Thermoactinomycetaceae. Among the family Alicyclobacillaceae, the microorganism preferably is of any of the genera Alicyclobacillus, Effusibacillus, Kyrpidia or Tumebacillus. Among the family Bacillaceae, the microorganism preferably is of any of the genera Aeribacillus, Alkalibacillus, Allobacillus, Alteribacillus, Amphibacillus, Amylobacillus, Anaerobacillus, Anoxybacillus, Aquibacillus, Aquisalibacillus, Bacillus, Caldalkalibacillus, Caldibacillus, Calditerricola, Cerasibacillus, Domibacillus, Falsibacillus, Fictibacillus, Filobacillus, Geobacillus, Gracilibacillus, Halalkalibacillus, Halobacillus, Halolactibacillus, Hydrogenibacillus, Lentibacillus, Lysinibacillus, Marinococcus, Microaerobacter, Natribacillus, Natronobacillus, Oceanobacillus, Ornithinibacillus, Paraliobacillus, Paucisalibacillus, Piscibacillus, Pontibacillus, Pseudogracilibacillus, Psychrobacillus, Saccharococcus, Salimicrobium, Salinibacillus, Salirhabdus, Salisediminibacterium, Saliterribacillus, Salsuginibacillus, Sediminibacillus, Sinibacillus, Streptohalobacillus, Tenuibacillus, Tepidibacillus, Terribacillus, Texcoconibacillus, Thalassobacillus, Thermolongibacillus, Virgibacillus or Vulcanibacillus. Among the family Listeriaceae, the microorganism preferably is of any of the genera Brochothrix or Listeria. Among the family Paenibacillaceae, the microorganism preferably is of any of the genera Ammoniibacillus, Aneurinibacillus, (group), Brevibacillus, Cohnella, Fontibacillus, Gorillibacterium, Paenibacillus, Saccharibacillus or Thermobacillus. Among the family Pasteuriaceae, the microorganism preferably is of genus Pasteuria Among the family Planococcaceae, the microorganism preferably is of any of the genera Bhargavaea, Caryophanon, Chryseomicrobium, Crocinobacterium, Filibacter, Jeotgalibacillus, Kurthia, Paenisporosarcina, Planococcus, Planomicrobium, Rummeliibacillus, Savagea, Solibacillus, Sporosarcina, Ureibacillus or Viridibacillus. Among the family Sporolactobacillaceae, the microorganism preferably is of any of the genera Pullulanibacillus, Scopulibacillus, Sinobaca, Sporolactobacillus or Tuberibacillus. Among the family Staphylococcaceae, the microorganism preferably is of any of the genera Aliicoccus, Jeotgalicoccus, Macrococcus, Nosocomiicoccus, Salinicoccus or Staphylococcus. Among the family Thermoactinomycetaceae, the microorganism preferably is of any of the genera Desmospora, Geothermomicrobium, Hazenella, Kroppenstedtia, Laceyella, Lihuaxuella, Marininema, Marinithermofilum, Mechercharimyces, Melghirimyces, Novibacillus, Planifilum, Polycladomyces, Salinithrix, Seinonella, Shimazuella, Thermoactinomyces or Thermoflavimicrobium. Among the order Enterobacteriaceae, the microorganism preferably is of family Enterobacteriaceae, and even more preferably of any of the genera Aranicola, Arsenophonus, Averyella, Biostraticola, Brenneria, Buchnera, Budvicia, Buttiauxella, Cedecea, Citrobacter, Cosenzaea, Cronobacter, Dickeya, Edwardsiella, Enterobacter, Erwinia, Escherichia, Ewingella, Franconibacter, Gibbsiella, Grimontella, Guhaiyinggella, Hafnia, Klebsiella, Kluyvera, Kosakonia, Leclercia, Lelliottia, Leminorella, Lonsdalea, Mangrovibacter, Margalefia, Moellerella, Morganella, Obesumbacterium, Pantoea, Pectobacterium, Phaseolibacter, Photorhabdus, Phytobacter, Plesiomonas, Pluralibacter, Pragia, Proteus, Providencia, Pseudocitrobacter, Rahnella, Raoultella, Rosenbergiella, Rouxiella, Salmonella, Samsonia, Serratia, Shigella, Shimwellia, Siccibacter, Sodalis, Tatumella, Thorsellia, Tiedjeia, Trabulsiella, Wigglesworthia, Xenorhabdus, Yersinia and Yokenella. Among the order Pseudomonadales, the microorganism is preferably of family Moraxellaceae, and among these is preferably of any of the genera, Acinetobacter, Alkanindiges, Enhydrobacter, Faucicola, Moraxella, Paraperlucidibaca, Perlucidibaca and Psychrobacter, or, equally preferred, the microorganism is of family Pseudomonadaceae, and among these preferably is of any of the genera Azotobacter (group), Mesophilobacter, Permianibacter, Pseudomonas, Rugamonas, Serpens and Thiopseudomonas.
(40) Among the order Lactobacillales, the microorganism preferably belongs to any of the families Aerococcaceae, Carnobacteriaceae, Enterococcaceae, Lactobacillaceae, Leuconostocaceae and Streptococcaceae. Among the family Aerococcaceae, the microorganism preferably belongs to any of the genera Abiotrophia, Aerococcus, Dolosicoccus, Eremococcus, Facklamia, Globicatella or Ignavigranum. Among the family Carnobacteriaceae, the microorganism preferably belongs to any of the genera Agitococcus, Alkalibacterium, Allofustis, Alloiococcus, Atopobacter, Atopococcus, Atopostipes, Carnobacterium, Desemzia, Dolosigranulum, Granulicatella, Isobaculum, Jeotgalibaca, Lacticigenium, Marinilactibacillus, Pisciglobus or Trichococcus. Among the family Enterococcaceae, the microorganism preferably belongs to any of the genera Bavariicoccus, Catellicoccus, Enterococcus, Melissococcus, Pilibacter, Tetragenococcus or Vagococcus. Among the family Lactobacillaceae, the microorganism preferably belongs to any of the genera Lactobacillus, Pediococcus or Sharpea. Among the family Leuconostocaceae, the microorganism preferably belongs to any of the genera Convivina, Fructobacillus, Leuconostoc, Oenococcus or Weissella. Among the family Streptococcaceae, the microorganism preferably belongs to any of the genera Lactococcus (lactic streptococci), Lactovum, Okadaella or Streptococcus.
(41) Preferably, the microorganism is a Bacillus cell, e.g., Bacillus alkalophius, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus clausii, Bacillus coagulans, Bacillus firmus, Bacillus Jautus, Bacillus lentus, Bacillus licheniformis, Bacillus megaterium, Bacillus pumilus, Bacillus stearothermophilus, Bacillus subtilis, and Bacillus thuringiensis. Most preferred, the prokaryote is a Bacillus cell, preferably, a Bacillus cell of Bacillus subtilis, Bacillus pumilus, Bacillus licheniformis, or Bacillus lentus, most preferably, Bacillus licheniformis.
(42) The invention also provides a method for producing a catalase, comprising the steps of
(43) a) providing a microorganism according to the invention, and
(44) b) cultivating the microorganism under conditions allowing for the expression of said gene.
(45) As indicated above, the microorganism of the present invention comprises a catalase gene coding for a catalase polypeptide of the invention. To allow for the expression of said catalase gene, the gene preferably is operably linked to one or more control sequences that direct the production of the gene product, that is the catalase or fragment thereof. Preferred catalases including variants and fragments thereof and corresponding genes have been described above.
(46) Also described above are preferred control sequences. Thus, by using a microorganism of the present invention it is possible to produce a catalase of the present invention having high catalase activity. It is furthermore possible to produce such catalase under conditions specifically selected by the skilled person in accordance with the corresponding control sequence or control sequences.
(47) The catalase can be produced as an intracellular protein or can be secreted from the microorganism. In the first case catalase activity is mostly manifest in the producing microorganism itself. Such microorganism therefore has the advantage of increased tolerance against hydrogen peroxide compared to a microorganism not producing a catalase of the present invention.
(48) The invention correspondingly provides a method for increasing hydrogen peroxide tolerance of a microorganism, comprising a) providing a microorganism according to the invention in said medium, and b) cultivating the microorganism under conditions allowing for the expression of said catalase gene.
(49) As indicated above, it is possible to further increase hydrogen peroxide tolerance of said microorganism by exposing the microorganism to a low dose of hydrogen peroxide, wherein the dose is chosen such induce expression of the catalase gene of the present invention under the control of a hydrogen peroxide inducible control sequence. The skilled person will furthermore choose the dose of hydrogen peroxide such that oxidative stress of the microorganism is kept sufficiently low to allow the microorganism to continue producing the catalase. Preferred doses of hydrogen peroxide are 5-10 M.
(50) The invention also provides a method for removing hydrogen peroxide from a medium, comprising the steps of a) transforming a microorganism with a recombinant nucleic acid of the invention, or providing a microorganism of the invention, and b) cultivating the microorganism under conditions allowing for the expression of said gene.
(51) Cultivation under suitable conditions to produce a culture comprising the catalase of the present invention allows to materialise the advantages inherent in the activity of the catalase of the present invention and thus to remove hydrogen peroxide from said medium in which the microorganism is producing said catalase. The microorganism will take up hydrogen peroxide from the medium and have it reduced by the catalase of the present invention produced by said microorganism. The method thus effectively reduces hydrogen peroxide concentration of a medium, preferably of a fermentation medium.
(52) Instead of cultivating the microorganism in the medium, the invention also envisages a method for removing hydrogen peroxide from a medium, comprising the steps of a) cultivating a microorganism of the present invention in a first medium under conditions allowing for the expression of said catalase, and b) mix the medium from which hydrogen peroxide is to be removed (second medium) with an cell-free extract of said microorganism grown in step a).
(53) The cell-free extract suitably comprises the catalase of the present invention. This way it is possible to remove hydrogen peroxide from the second medium without having the microorganism of the present invention consume constituents of said second medium. Where the second medium is a fermentation medium, it is particularly preferred that said second medium comprises a production microorganism for producing a substance of interest. This way, the production microorganism can benefit from the action of the catalase of the present invention without having to be co-cultivated with the microorganism of the present invention, and also without having to produce the catalase of the present invention by itself.
(54) The invention also provides a method for protecting a microbially produced substance against oxidation, comprising a) transforming a microorganism capable of producing said substance with a recombinant nucleic acid according to the invention, or providing a microorganism of the present invention, and b) cultivating the microorganism under conditions allowing for the expression of said catalase gene.
(55) As indicated above, expression of said catalase gene of the present invention effectively reduces the concentration of hydrogen peroxide within the microorganism and/or in a surrounding medium. Thus, the substance produced by said microorganism essentially benefits from the action of the catalase and is thereby at least partly protected against oxidation. Protein oxidation can be measured by a thiol modification assay indicating oxidation of the thiol groups of the cysteines and subsequent disulfide bond formation by using mass spectrometry (Schroeter R, Voigt B, Jrgen B, Methling K, Pther D C, Schfer H, Albrecht D, Mostertz J, Mder U, Evers S, Maurer K H, Lalk M, Mascher T, Hecker M, Schweder T. The peroxide stress response of Bacillus licheniformis. Proteomics. 2011 July; 11(14):2851-66. doi: 10.1002/pmic.201000461). Furthermore, oxidation of cysteines can be specifically determined using the iodoTMT reagents (Thermo Scientific). To have the catalase gene induced once sufficient amounts of the substance have been produced. Such induction allows to protect the substance from oxidation without unnecessarily sacrificing nutrients that could be used for producing said substance.
(56) The invention thus also provides a fermentation method for producing a fermentation product, comprising the steps of a) providing a microorganism according to the invention, and b) cultivating the microorganism under conditions allowing for the expression of said catalase gene and also allowing the production of said fermentation product.
(57) As indicated above, expression of said catalase gene of the present invention allows to protect a microbially produced substance against oxidation, thus effectively protecting fermentation products. Protection is conferred as long as the fermentation product is in contact or mixed with an active catalase according to the present invention. Thus, the fermentation method of the present invention provides protection for a fermentation product during fermentation and also during downstream processing. Downstream processing includes cell disruption steps like cell lysis and homogenisation.
(58) As indicated above, the fermentation may be performed by co-cultivating a microorganism producing the fermentation product (production strain) and a microorganism producing the catalase of the present invention. This way it is possible to reduce hydrogen peroxide concentration of a fermentation medium without having to modify the production strain producing said fermentation product.
(59) Thus, in a preferred embodiment, the invention is directed to a fermentation method for producing a fermentation product, comprising the steps of a) providing a first microorganism comprising the catalase gene according to the invention, b) providing a second microorganism capable of producing the fermentation product, preferably by comprising a gene encoding for the fermentation product, and c) cultivating the first and the second microorganism together under conditions allowing for the expression of said catalase gene and also allowing the production of said fermentation product.
(60) In this embodiment, the first microorganism comprising the catalase gene and the second microorganism producing the fermentation product can be of the same or of a different species. Preferably, the first and the second microorganism are of the same species.
(61) More preferably, however, the production strain for producing the fermentation product also expresses the catalase of the present invention. In such cases the production strain is a microorganism of the present invention. This way the catalase is produced in close proximity, that is within the same microorganism also producing the desired fermentation product. Thus, the fermentation product can be thoroughly mixed with the catalase of the present invention in one compartment (that is within the same microorganism or compartment thereof) and thus benefit from the catalase activity without the catalase having to be transported to the fermentation product.
(62) Thus, in a preferred embodiment, the invention is directed to a fermentation method for producing a fermentation product, comprising the steps of a) providing a microorganism comprising the catalase gene according to the invention and being capable of producing the fermentation product, preferably by comprising a gene encoding the fermentation product, and b) cultivating the microorganism under conditions allowing for the expression of said catalase gene and also allowing the production of said fermentation product.
(63) The microorganism being capable of producing the fermentation product may comprise the gene encoding the fermentation product or one or more genes encoding the one or more proteins being involved in the production of the fermentation product in its genome or on a plasmid. The microorganism can also comprise said genes on one or more plasmids. The gene encoding the fermentation product or one or more genes encoding the one or more proteins being involved in the production of the fermentation product can be heterologous or homologous genes, preferably heterologous genes.
(64) Preferably, the microorganism being capable of producing the fermentation product comprises said gene encoding the fermentation product or one or more genes encoding the one or more proteins being involved in the production of the fermentation product operably linked to one or more control sequences that direct the production of the gene product. The microorganism can comprise the gene under the control of one or more heterologous or homologous control sequences, preferably heterologous control sequences.
(65) The microorganism producing the fermentation product can be a prokaryote or a eukaryote, preferably a bacteria, an archaea, a fungal cell, a yeast cell or a eukaryotic cell as described above for the catalase expressing microorganism. Useful prokaryotes are bacterial cells such as gram positive or gram negative bacteria. Preferred useful gram positive bacteria include, but are not limited to, a Bacillus cell, e.g., Bacillus alkalophius, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus clausii, Bacillus coagulans, Bacillus firmus, Bacillus Jautus, Bacillus lentus, Bacillus licheniformis, Bacillus megaterium, Bacillus pumilus, Bacillus stearothermophilus, Bacillus subtilis, and Bacillus thuringiensis. Most preferred, the prokaryote is a Bacillus cell, preferably, a Bacillus cell of Bacillus subtilis, Bacillus pumilus, Bacillus licheniformis, or Bacillus lentus, most preferably, Bacillus licheniformis.
(66) Where the catalase gene coding for the catalase of the present invention is under the control of one or more control sequences that allow inducible expression of said gene, treating the microorganism with a small dose of the inductor (possibly hydrogen peroxide) allows to selectively increase catalase production at a desired time during fermentation, thereby providing additional protection of the desired fermentation product against oxidation by hydrogen peroxide.
(67) The microbially produced substance (also called fermentation product) preferably is a protein. The protein can be a homologous or heterologous in view of the producing microorganism. Preferably the substance is an enzyme. The enzyme preferably is selected from the group consisting of protease, amylase, carbohydrase, lipase, cellulase, pullulanase, cutinase, pectinase, mannanase, arabinase, galactanase, xylanase, oxidase, e.g. laccase, peroxidase, isomerase, transferase, kinase, and phosphatase, preferably protease. Preferred proteases are subtilisin proteases. Preferred subtilisin proteases are selected from the group consisting of: subtilisin 168, subtilisin BPN, subtilisin Carlsberg, subtilisin DY, subtilisin 147, subtilisin 309, and variants thereof.
(68) The fermentation broth resulting from the method of the present invention may be further processed by methods known in the art. For example, the fermentation product can be purified or partially purified by one or more downstream methods known in the art, e.g., crystallization, precipitation, microfiltration, centrifugation, ultra-filtration, extraction, decolorization, chromatography, de-odorization, spray-drying, or evaporation.
EXAMPLES
(69) The following Examples are provided in order to demonstrate and further illustrate certain embodiments and aspects of the present invention and are not to be construed as limiting the scope thereof.
(70) Materials and Methods
(71) Bacillus pumilus SAFR-032 (Gioia J, Yerrapragada S, Qin X, Jiang H, Igboeli O C, et al. (2007) Paradoxical DNA repair and peroxide resistance gene conservation in Bacillus pumilus SAFR-032. PLoS One 2: e928), Bacillus licheniformis DSM13 (Waschkau B, Waldeck J, Wieland S, Eichstadt R, Meinhardt F (2008) Generation of readily transformable Bacillus licheniformis mutants. Appl Microbiol Biotechnol 78: 181-188) and Bacillus subtilis 168 (Burkholder P R, Giles N H, Jr. (1947) Induced biochemical mutations in Bacillus subtilis. Am J Bot 34: 345-348) were used in this study. Cells were grown aerobically at 37 C. and 180 rpm in a chemically defined medium containing 15 mM (NH4)2SO4, 8 mM MgSO47H2O, 27 mM KCl, 7 mM Na-citrate2H2O, 50 mM Tris-HCl (pH 7.5) supplemented with 1.8 mM KH2PO4, 2 mM CaCl2), 1 M FeSO47H2O, 10 M MnSO44H2O, 4.5 mM glutamate, 62.4 M tryptophane 0.2% w/v glucose and 0.04 M biotin.
(72) Construction of Mutant Strains
(73) The linear DNA fragment carrying the B. pumilus katX2 gene, the spectinomycin resistance marker and the homologous flanking sequences of B. subtilis was constructed using primers extended by several nucleotides homologous to the connecting upstream/downstream-fragment. A 600 kb upstream-fragment containing the regulatory structures of B. subtilis katA was combined with the B. pumilus katX2-gene, beginning with the ATG-start-codon and ending with the stop-codon. The spectinomycin resistance gene was fused to a 600 kb downstream fragment beginning right behind the B. subtilis katA stop codon. In a second step both fusion products were combined.
(74) Purification, fusing and transformation of the PCR products was carried out according to Reder et al. Mutants were selected on LB agar plates containing 200 g/mL spectinomycin. For the verification of the knock-out and knock-in mutants, chromosomal DNA amplified and finally sequenced by Eurofins (http://www.eurofinsgenomics.eu/de/home.aspx).
(75) Sample Preparation
(76) Cells were harvested or stressed at an OD500 of 0.6 with various concentrations of H2O2. Samples used for 2D-PAGE analyses, fluorescence thiol modification assays and the quantification of catalase protein accumulation were stressed with 50 M (B. subtilis, B. subtilis katA::katX2, B. licheniformis) and 2 mM (B. pumilus) H2O2, respectively. Samples used for the catalase activity assay were stressed using one-tenth of these concentrations.
(77) Cells were harvested by centrifugation (20 000g, 4 C., 10 min) followed by two washing steps with 100 mM Tris-HCl buffer, pH 7.5. Cell disruption was done by sonication after resuspension in TE buffer (10 mM Tris, pH 7.5, 10 mM EDTA) containing 1.4 mM PMSF. For absolute protein quantification an in-solution digestion of proteins with TE buffer without PMSF was used. Protein concentration was determined with RotiNanoquant (Roth).
(78) 2D-PAGE, gel imaging, relative quantification and protein identification 200 g protein were adjusted to 306 L with 2 M thiourea/8 M Urea, mixed with 34 L CHAPS solution (20 mM DTT, 1% w/v CHAPS, 0.5% v/v Pharmalyte, pH 4-7 or 3-10) and loaded onto commercially available IPG strips (SERVA Electrophoresis) in the pH-range of 4-7. IEF was performed according to Buttner et al. (Buttner K, Bernhardt J, Scharf C, Schmid R, Mader U, et al. (2001) A comprehensive two-dimensional map of cytosolic proteins of Bacillus subtilis. Electrophoresis 22: 2908-2935). Equilibration of the strips containing the focused proteins was performed in solutions containing DTT and iodacetamide, respectively, as described by Gorg et al. (Gorg A, Boguth G, Obermaier C, Posch A, Weiss W (1995) Two-dimensional polyacrylamide gel electrophoresis with immobilized pH gradients in the first dimension (IPG-Dalt): the state of the art and the controversy of vertical versus horizontal systems. Electrophoresis 16: 1079-1086). Gels of 12.5% acrylamide and 2.6% bisacrylamide were used for separation in the second dimension. Gels were stained with Flamingo Fluorescent Gel Stain (Bio-Rad Laboratories) according to the manufacturer instructions.
(79) Analysis of the gel images and spot quantification was performed as described by Wolf et al. using the Delta2D software version 4.4 (Decodon) Wolf C, Hochgrfe F, Kusch H, Albrecht D, Hecker M, et al. (2008) Proteomic analysis of antioxidant strategies of Staphylococcus aureus: diverse responses to different oxidants. Proteomics 8: 3139-3153). Protein spots were excised from the gels (Ettan Spot Picker, GE Healthcare), digested and spotted onto MALDI targets (Ettan Spot Handling Workstation, GE Healthcare). MS-Analysis of the targets was performed by MALDI-TOF-MS/MS using the Proteome Analyzer 4800 (Applied Biosystems) and peak lists were searched with MASCOT search engine version 2.1.0.4 (Matrix Science) and search parameters as described by Wolf et al. (Wolf C, Hochgrfe F, Kusch H, Albrecht D, Hecker M, et al. (2008) Proteomic analysis of antioxidant strategies of Staphylococcus aureus: diverse responses to different oxidants. Proteomics 8: 3139-3153).
(80) Label-Free Quantification (LC-IMSE)
(81) In-solution digestion of protein extracts with trypsin was done according to the method described previously (Muntel J, Fromion V, Goelzer A, Maabeta S, Mader U, et al. (2014) Comprehensive absolute quantification of the cytosolic proteome of Bacillus subtilis by data independent, parallel fragmentation in liquid chromatography/mass spectrometry (LC/MS(E)). Mol Cell Proteomics 13: 1008-1019). Desalting of peptides prior to mass spectrometry analysis using stage tips was achieved using a standard protocol (Rappsilber J, Mann M, Ishihama Y (2007) Protocol for micro-purification, enrichment, pre-fractionation and storage of peptides for proteomics using StageTips. Nat Protoc 2: 1896-1906). For absolute quantification the peptide mix was spiked with a tryptic digest of yeast alcohol dehydrogenase (Waters) at a final concentration of 50 fmol/L.
(82) The nanoACQUITY UPLC system (Waters) was used to separate the peptide mixture and to introduce the samples into the mass spectrometer. The peptide mixture was directly loaded on an analytical column (nanoACQUITY UPLC column, BEH300 C18, 1.7 mm, 75 mm_200 mm, Waters). Separation of peptides for IMSE (MSE with ion mobility separation) was done with a 90 min gradient from 5% buffer B to 40% buffer B. All MSE analyses were performed as previously described (Muntel J, Fromion V, Goelzer A, Maabeta S, Mader U, et al. (2014) Comprehensive absolute quantification of the cytosolic proteome of Bacillus subtilis by data independent, parallel fragmentation in liquid chromatography/mass spectrometry (LC/MS(E)). Mol Cell Proteomics 13: 1008-1019). The only modification was, that the collision energy was alternated between 4 eV in the precursor ion trace and a ramp 25-45 eV for fragment ion trace. Wave velocity was ramped from 1,000-400 m/s, wave height was set to 40 V.
(83) LC-IMSE data were processed using PLGS v3.0.1. Processing parameter were set as follows: Chromatographic peak width and MS TOF resolution were set to automatic, lock mass charge 2 set to 785.8426 Da/e with a lock mass window of 0.25 Da, low energy threshold 200.0 counts, elevated energy threshold 20.0 counts, intensity threshold 750 counts. The data were searched against a randomized Bacillus subtilis 168 database (NCBI, version August 2014) with added amino acid sequence of B. pumilus SAFR032 KatX protein, laboratory contaminants and yeast ADH1 sequence (8,438 entries). For positive protein identification the following criteria had to be met: 1 fragment ion matched per peptide, 5 fragment ions matched per protein, 1 peptide matched per protein; 2 missed cleavages allowed, primary digest reagent: trypsin, fixed modification: carbamidomethylation C (+57.0215), variable modifications: deamidation N, Q (+0.9840), oxidation M (+15.9949), pyrrolidonecarboxylacid N-TERM (27.9949). The protein false discovery rate (FDR) was set to 5%. For the final analysis only 2 peptide identifications were considered. A protein had to be identified in at least two out of 3 technical replicates per time point; this took the FDR on protein level to less than 3%. 3 biological replicates for each time point were analyzed.
(84) Data generated by the IMSE mode were corrected for detector saturation effects by implementing a correction factor based on the ion accounting output files that were created for each sample by the PLGS software. The correction factor (cf) was calculated using following equation.
Ipeptide/Iproduct*1/m=cf
(85) Where Ipeptide and Iproduct are the matched peptide/product intensity sums, m is the median of the ratios Ipeptide/Iproduct calculated for every protein quantified in a sample.
(86) Catalase Activity Assay
(87) Cells were grown to an OD500 nm of 0.6. Right before starting the assay, a working solution of 25 g/mL lactoperoxidase and 0.5 M dicarboxidine dihydrochloride (both Sigma-Aldrich) was prepared. A final concentration of 2 mM hydrogen peroxide was added to the cell cultures. To measure the H2O2 concentration remaining in the culture at certain time points, 25 L of the culture was mixed with 500 L working solution and absorbance at 450 nm was measured as described (Ma Q, Wood T K (2011) Protein acetylation in prokaryotes increases stress resistance. Biochem Biophys Res Commun 410: 846-851).
(88) The same protocol was used to determine the degradation of H2O2 by cytosolic protein extracts. 5 g of protein extract were filled up with catalase assay buffer (Catalase Assay Kit, BioVision) to 200 L. H2O2 was added to a final concentration of 2 mM and the extracts were incubated at 30 C. The remaining H2O2 concentration was measured as described above at defined time points.
(89) Fluorescence Thiol Modification Assay and Analysis of Protein Modifications
(90) Proteins with reversibly oxidized cysteines were visualized using a protocol described by Hochgrfe et al. (Hochgrfe F, Mostertz J, Albrecht D, Hecker M (2005) Fluorescence thiol modification assay: oxidatively modified proteins in Bacillus subtilis. Mol Microbiol 58: 409-425). Protein extracts were purified and pre-stained as described and loaded onto IPG-strips in the pH-range 4-7 (SERVA Electrophoresis). 2D-PAGE was performed as described above in the dark. Following fluorescence scanning of reversibly oxidized proteins the gels were stained with Flamingo Fluorescent Gel Stain (Bio-Rad Laboratories). Spot quantification and MS-analyses were performed as described above.
(91) For the analysis of possible modifications protein spots were excised from the gels as described above, destained (0.2 M NH4HCO3, 30% acetonitrile) and double digested with trypsin and chymotrypsin (both Promega). Peptide extraction was performed by covering the gel pieces with ultra-pure water (prepared with a Sartorius Stedim unit) and 15 min incubation in an ultrasonic water bath. Peptides were detected by LC-MS/MS using an Orbitrap Elite (Thermo Fisher Scientific). Database searches were conducted with the SEQUEST software v28 (rev.12, Thermo Fisher Scientific) against B. subtilis 168 and B. pumilus SAFR-032 database. Data were analyzed using Scaffold proteome viewer version 4.0.5.
Example 1
(92) There was no difference in the growth behavior of the B. subtilis katA::katX2 mutant compared to the wild type strain under control conditions. After the treatment of the wild type strain and the B. subtilis katA::katX2 mutant with 50 M H2O2 also only a small impact on the growth of both strains could be detected (
(93) The survival of the B. subtilis 168 strain and the katA::katX2 mutant was analyzed using 500 M H2O2. 23% of the wild type cells survived three minutes after peroxide treatment. At the same time point about 50% of the katA::katX2 mutant cells were still alive. 15 min after addition of H2O2 32% of the katX2-expressing cells were alive whereas only 18% of the wild type cells survived at this time point. These data indicate a 1.5-2-fold higher survivability of the katX2-expressing cells under this oxidative stress conditions.
Example 2
(94) Under control conditions, in all extracts tested the relative spot volume of the vegetative catalase KatA respectively KatX2 was about 0.4-0.5%. The KatX2 spot volume only increased about 1.4-fold in B. pumilus cells 20 min after H2O2 treatment. In B. subtilis cells we detected a 3-fold increase from 0.39% to 1.23% in the amount of KatA after H2O2 treatment indicating that a higher amount of enzyme was present compared to B. pumilus cells. A similar about three-fold increase after addition of H2O2 was also observed for the KatX2 spot in the B. subtilis katA::katX2 mutant.
(95) To gain information on the absolute concentrations of the catalases in the cytoplasm, the gel- and label-free quantification approach LC-IMSE was conducted. The results of this experiment revealed a concentration of KatA of 0.0165 fmol/ng protein extract in exponentially growing B. subtilis cells. KatA accumulation increased up to 0.11 fmol per ng protein extract in hydrogen peroxide stressed cells. In B. pumilus we measured an amount of 0.0385 fmol KatX2 per ng protein extract. 20 min after addition of H2O2, catalase accumulation increased up to about 0.1 fmol per ng cell extract in B. pumilus cells. Based on the lower basal accumulation the induction rate following H2O2 treatment was significantly higher in B. subtilis cells.
(96) Exponentially growing B. subtilis katA::katX2 mutant cells contained 0.026 fmol KatX2 catalase per ng protein extract. Following hydrogen peroxide treatment the KatX2 accumulation increased up to about 0.14 fmol per ng cell extract and therefore it was higher than the KatX2 accumulation in H2O2 stressed B. pumilus cells.
Example 3
(97) To analyze how the cells deal with hydrogen peroxide, 2 mM H2O2 were added to growing cells at an OD500 of 0.6. In B. pumilus cultures a significantly faster decrease of hydrogen peroxide concentration was observed than in B. subtilis or B. licheniformis cultures (
(98) In a second approach cell extracts were used containing equal amounts of protein to analyze the degradation of H2O2 by the catalases. For this extracts were prepared from exponentially growing cells as well as from cells previously stressed by low amounts of H2O2 (5 M for B. subtilis and B. licheniformis, 200 M for B. pumilus) (
(99) The degradation rate of extracts from exponentially growing unstressed B. subtilis katA::katX2 mutant cells was comparable to those shown by the wild type. Pre-stressed extracts of the mutant cells degraded the added H2O2 much faster than the corresponding extracts from the other strains and organisms, even faster than the pre-stressed B. pumilus cell extracts (
Example 4
(100) Reversible thiol-modifications in the B. pumilus KatX2 protein was analysed as described above. This procedure uses two different staining methods, one for protein accumulation and one for reversible thiol oxidations. Quantification of proteins is done using relative spot volumes (volume of a spot compared to the volumes of all spots visible on the 2D-gel). The ratio between the spot volumes of a protein spot in the thiol modification staining and the protein accumulation staining is an indicator for the amount of reversible oxidations of the cysteine residues in a protein. In exponentially growing cells, KatX2 cysteine residues were nearly completely reduced. A hydrogen peroxide treatment caused a significant increase of reversible cysteine oxidation. The ratio of thiol modification to protein accumulation increased from about 0.5 to 1.36.
(101) Furthermore, LC-MS/MS analysis was performed to show irreversible oxidation of cysteine residues in the different catalase spots excised from the 2D-gels. This irreversible oxidation cannot be accessed by the fluorescence thiol modification assay. Mass shifts of +32 and +48 were detected in KatX2 expressed by the B. subtilis katA::katX2 mutant representing sulfinic (+32) and sulfonic (+48) acid formation. In B. pumilus only formation of a sulfonic acid in the KatX2 cysteine 461 was detected.