Cysteine Labelling
20200172954 ยท 2020-06-04
Inventors
Cpc classification
International classification
Abstract
The present invention relates to the production of activated biological molecules for use in profiling biological molecule interactions. The activated biological molecule may be a ubiquitin (Ub) and ubiquitin-like conjugation enzyme as well as other proteins with internal reactive cysteine residues.
Claims
1. A method of detecting an interaction between biological molecules, the method comprising providing a first activated biological molecule according to formula (1) ##STR00009## wherein X is a first biological molecule and EWG is an electron withdrawing group; and bringing the activated biological molecule into proximity with one or more further biological molecules, in order to allow one or more of said further biological molecules to react with the activated biological molecule and form a conjugate; and detecting formation of one or more conjugates which may be formed.
2. The method according to claim 1 wherein a sulphur-containing moiety of the first biological molecule is derivatised in order to allow formation of the activated biological molecule.
3. The method according to claim 2 wherein the sulphur-containing moiety is a cysteine, especially an internal cysteine present within a protein or peptide.
4. The method according to claim 3 wherein the cysteine may be a naturally occurring cysteine in the first biological molecule, or may be introduced into the molecule.
5. The method according to claim 1 wherein the electron withdrawing group (EWG) is selected from NO.sub.2, NR.sub.3.sup.+, CF.sub.3, or other trihalide, CN, SOOR, SOON, COOH, COOR, CHO, COR, wherein R is typically H, NH, or C.sub.1-C.sub.4 alkyl (e.g. methyl) or alkenyl.
6. The molecule or method according to claim 5 wherein the EWG is CN, or CO.sub.2Me.
7. The method according to claim 1 wherein the EWG is further substituted in order to provide a functional group which is capable of reacting with a moiety of said one or more further biological molecules and forming a covalent bond.
8. The method according to claim 1 wherein the first biological molecule X is an enzyme and said one or more further biological molecules is a substrate or ligand for the enzyme.
9. The method according to claim 1 wherein the first biological molecule is a ubiquitin conjugating enzyme (E2).
10. The method according to claim 9 wherein the E2 enzyme is selected from UBE2D1, UBE2D1 C86, UBE2D1 C86 AzF3(X), UBE2D2, UBE2D3, UBE2L3*, UBE2L3**, UBE2L6*, UBE2L6**, UBE2N, UBE2H, UBE2I and UBE2M, as identified herein.
11. The method according to claim 9 wherein said one or more further biological molecules is ubiquitin.
12. The method according to claim 1 wherein the activated biological molecule is further modified by incorporation of a tag.
13. The method according to claim 12 wherein the tag is an affinity label, a fluorophore, biotin, or a radioactive label.
Description
DETAILED DESCRIPTION
[0039] The present invention will now be further described by way of non-limiting example and with reference to the figures which show
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050] Parkin WT was only observed with probe 9 in response to CCCP treatment. Probe labeling correlated with Parkin phosphorylation and labeling of the phosphorylated pool was more efficient than that of the total Parkin pool, as determined by anti-Parkin and anti-Parkin-pSer65 immunoblotting. Non-phosphorylatable Parkin S65A did not undergo labeling with probe 9 emphasizing a strict requirement of Parkin phosphorylation for activity. Parkin H302A with significantly impaired p-Ub binding ability exhibited compromised labeling efficiency with 9. Parkin phosphorylation was also significantly compromised. This suggests that in the context of PINK1-Parkin cellular signaling, initial generation of p-Ub binds Parkin and primes it for phosphorylation by PINK1 that leads to its optimal activation. Consistent results were obtained over 3 replicate experiments.
[0051]
[0052] Parkin (3 g), GST-PhPINK1 (1.5 g). Reactions were incubated at 30 C. for 1 h, resolved by SDS-PAGE, and visualized by coomassie staining.
[0053]
[0054] Materials & Methods
[0055] General Methods
[0056] LC-MS was carried out with an Agilent 1200 LC-MS system fitted with a Max-Light Cartridge flow cell coupled to a 6130 Quadrupole spectrometer. The solvent system consisted of 0.05% trifluoroacetic acid (TFA) in H2O as buffer A, and 0.04% TFA acid in acetonitrile (MeCN) as buffer B. Protein UV absorbance was monitored at 214 and 280 nm. An Agilent ZORBAX 300SB-C3 5 um, 2.1150 mm column was employed for proteins unless otherwise stated. Protein MS acquisition was carried out in positive ion mode and total protein masses were calculated by deconvolution within the MS Chemstation software (Agilent Technologies).
[0057] Small molecule LC-MS was carried out using the Agilent system with an Agilent ZORBAX Eclipse Plus C18, 4.6100 mm, 3.5 m column. Variable wavelengths were used and MS acquisitions were carried out in positive and negative ion modes.
[0058] Semi-preparative peptide HPLC was carried out on a Dionex Ultimate system with Thermo Biobasic C4 21.2250 mm column at a flow rate of 10 ml min-1.
[0059] 1H & 13C NMR was carried out with a (Bruker AVANCE II 500 spectrometer). Chemical shifts () are reported in ppm and referenced to residual solvent (MeOH-D4). J values are in hertz, and the splitting patterns are designated as follows: s, singlet; bs, broad singlet; d, doublet; t, triplet; app. t, apparent triplet; q, quartet; m, multiplet. All solvents and reagents were purchased from Sigma Aldrich or VWR unless otherwise stated.
[0060] E2 Constructs Used
TABLE-US-00001 >UBE2D1 (SEQIDNO:1) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSALKRIQKELSDLQRDPPAHCS AGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS NGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE WTQKYAM Features(aminoacidresiduenumbers): 6His:[5:10] Thrombinsite:[14:19] >UBE2D1C86 (SEQIDNO:2) MSYYHHHHHHDYDIPTTENLYFQGAGSGSMALKRIQKELSDLQRDPPAHSSAGPVG DDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICL DILRSQWSPALTVSKVLLSISSLLSDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKY AM Features(aminoacidresiduenumbers): 6His:[5:10] TEVsite:[18:24] >UBE2D1C86AzF3(X) (SEQIDNO:3) MSXYHHHHHHDYDIPTTENLYFQGAGSGSMALKRIQKELSDLQRDPPAHSSAGPVG DDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICL DILRSQWSPALTVSKVLLSISSLLSDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKY AM Features(aminoacidresiduenumbers): 6His:[5:10] TEVsite:[18:24] >UBE2D2 (SEQIDNO:4) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSALKRIHKELNDLARDPPAQCS AGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREW TQKYAM Features(aminoacidresiduenumbers): 6His:[5:10] Thrombinsite:[14:19] >UBE2D3 (SEQIDNO:5) MGSSHHHHHHSSGLEVLFQGPGSALKRINKELSDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQ WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2L3* (SEQIDNO:6) MGSSHHHHHHSSGLEVLFQGPGSMAASRRLMKELEEIRKSGMKNFRNIQVDEANLLT WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFSKNAEEFTKKYGEKRP VD Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2L3** (SEQIDNO:7) MGSSHHHHHHSSGLEVLFQGPGSMAASRRLMKELEEIRKSGMKNFRNIQVDEANLLT WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVIAAEN WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFSKNAEEFTKKYGEKRP VD Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2L6* (SEQIDNO:8) MGSSHHHHHHSSGLEVLFQGPGSMMASMRVVKELEDLQKKPPPYLRNLSSDDANVL VWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSE NWKPSTKTSQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDR PS Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2L6** (SEQIDNO:9) MGSSHHHHHHSSGLEVLFQGPGSMMASMRVVKELEDLQKKPPPYLRNLSSDDANVL VWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIIASE NWKPSTKTSQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDR PS Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2N (SEQIDNO:10) MGSSHHHHHHSSGLEVLFQGPGSAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFH VVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKW SPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2H (SEQIDNO:11) MGSSHHHHHHSSGLEVLFQGPGSMSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEF VVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVIN QTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATE EALKEQEEGTGDSSSESSMSDFSEDEAQDMEL Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2I (SEQIDNO:12) MGSSHHHHHHSSGLEVLFQGPGSMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPD GTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPS GTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR AQAKKFAPS Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21] >UBE2M (SEQIDNO:13) MGSSHHHHHHSSGLEVLFQGPGSPEFPGVDSKAAAMIKLFSLKQQKKEEESAGGTK GSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFK VGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPN PEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Features(aminoacidresiduenumbers): 6His:[5:10] PreScissionsite:[14:21]
[0061] Experimental Procedures
[0062] Preparation of Ub.sub.1-74 Mercaptoethyl Carboxamide (Ub.sub.1-74-SH)
[0063] Codons for ubiquitin residues 75-76 were deleted by Quikchange mutagenesis using the plasmid pTXB1-Ub1-76 [4] as template yielding plasmid pTXB1-Ub1-74. The 5-GTCTTAAGACTGCGTTGCATCACGGGAGATG-3 (SEQ ID NO:14) forward primer and 5-CATCTCCCGTGATGCAACGCAGTCTTAAGAC-3 (SEQ ID NO:15) reverse primer were used. ER2566 E. coli. cells (50 L) (NEB) were transformed with pTXB1-Ub1-74 and recovered with S.O.B. medium (250 L). The cells were incubated for 1 h at 37 C and then LB medium (100 mL) containing ampicillin (100 g mL1) was inoculated with the recovered cells (200 L) and the culture was incubated overnight whilst shaking (230 rpm) at 37 C. LB medium (2 L) containing ampicillin (100 g mL1) was inoculated with the overnight culture (60 mL) and incubated whilst shaking (230 rpm) at 37 C. At O.D.6000.4, the cells were transferred to a 25 C incubator and after 30 min the cells were induced with IPTG (0.5 mM). After 5 h the cells were harvested and suspended in 60 ml lysis buffer (20 mM Na.sub.2HPO.sub.4 pH 7.2, 200 mM NaCl, 1 mM EDTA) and frozen. The thawed cells were lysed by sonication on ice and were clarified by centrifugation (39000 g, 30 min). An empty XK 26/20 column was filled with chitin beads (20 mL) (NEB) and equilibrated with lysis buffer. At 4 C the clarified lysate was loaded (flow rate: 0.5 mL min-1) onto the column using an AKTA FPLC system. The column was then washed with lysis buffer (- 400 mL) and equilibrated with 60 mL of cleavage buffer (20 mM Na.sub.2HPO.sub.4 pH 7.2, 200 mM NaCl, 50 mM cysteamine, 10 mM TCEP, 1 mM EDTA). The flow was then stopped and the column incubated for 66 h at 23 Preparation of UbS-=CN, UbS-VME and UbS-VME*
[0064] Ub.sub.1-74 -SH (3.6 mg, 0.42 mol) was reconstituted .sup.[5] by the addition of DMSO (54 L). On complete dissolution of Ub.sub.1-74-SH in DMSO, PBS (1X, 1746 L) was added to give a final DMSO concentration of 3% (v/v) and a final Ub.sub.1-74-SH concentration of 233 M. 4 eq. of 1 were then added from a DMSO stock solution of 1 (17.6 L, 96 mM) and the mixture was then briefly vortexed. The resulting solution was placed in an Eppendorf thermomixer (30 C., 2 hours) and the reaction was monitored by LC-MS. To remove small molecule by-products, the reaction solution was buffer exchanged into MQ water using a pre-packed PD-10 column (GE Healthcare). UbS-=CN was eluted on the addition at an approximate concentration of 116 M (based on quantitative conversion of Ub.sub.1-74-SH.
[0065] Determination of UbS-=CN concentration was achieved by extrapolation using a standard concentration curve of WT Ub based upon the absorbance of the UV absorbance at 214 nm. Preparation of UbS-VME and UbS-VME* was carried under identical conditions but 1 was substituted for 2 and methyl propiolate respectively.
[0066] Standard Concentration Curve of WT Ub
[0067] From a 1.66 mM stock solution of Ubiquitin (determined by using A280 0.16=1 mg/mL) Serial dilution of a 1 mM WT Ub solution (100 mM Na.sub.2HPO.sub.4, pH 8) was then carried out to generate stock WT Ub solutions at concentrations of 5 M, 10 M, 30 M and 50 M (100 mM Na.sub.2HPO.sub.4, pH 8). 100 L of each solution was added to 4 L 25% TFA (in acetonitrile). Samples were then analysed by LC-MS (5 L injection, see General methods; protein LC-MS) with a gradient of 10% to 75% acetonitrile (flow rate; 0.3 mL/min) over 20 minutes. The peak area of Ub at 214 nm was determined using the Agilent Chemstation software v.4.0. Runs were repeated in duplicate.
[0068] C, to allow thiolysis and concomittant rearrangement. Liberated Ub.sub.1-74-SH was eluted with elution buffer (20 mM Na.sub.2HPO.sub.4 pH 6, 200 mM NaCl, 1 mM EDTA). The fractions containing Ub.sub.1-74-SH were pooled and concentrated to 5 mL using an Amicon Ultra-15 centrifugal filter device (Millipore). The protein was then further purified by semi-preparative RP-HPLC using the Dionex system. A gradient of 10% buffer A to 80% buffer B was applied at a flow rate of 10 mL min.sup.1 over 30 min (buffer A=0.1%TFA in H.sub.2O, buffer B=0.1% TFA in acetonitrile). Fractions containing Ub.sub.1-74-SH were pooled and lyophilized.
[0069] Preparation of UbS-=CN, UbS-VME and UbS-VME*
[0070] Ub.sub.1-74-SH (3.6 mg, 0.42 mol) was reconstituted.sup.[5] by the addition of DMSO (54 L). On complete dissolution of Ub.sub.1-74-SH in DMSO, PBS (1, 1746 L) was added to give a final DMSO concentration of 3% (v/v) and a final Ub.sub.1-74-SH concentration of 233 M. 4 eq. of 1 were then added from a DMSO stock solution of 1 (17.6 L, 96 mM) and the mixture was then briefly vortexed. The resulting solution was placed in an Eppendorf thermomixer (30 C., 2 hours) and the reaction was monitored by LC-MS. To remove small molecule by-products, the reaction solution was buffer exchanged into MQ water using a pre-packed PD-10 column (GE Healthcare). UbS-=CN was eluted on the addition at an approximate concentration of 116 M (based on quantitative conversion of Ub.sub.1-74-SH. Determination of UbS-=CN concentration was achieved by extrapolation using a standard concentration curve of WT Ub based upon the absorbance of the UV absorbance at 214 nm. Preparation of UbS-VME and UbS-VME* was carried under identical conditions but 1 was substituted for 2 and methyl propiolate respectively.
[0071] Standard Concentration Curve of WT Ub
[0072] From a 1.66 mM stock solution of Ubiquitin (determined by using A280 0.16=1 mg/mL) Serial dilution of a 1 mM WT Ub solution (100 mM Na.sub.2HPO.sub.4, pH 8) was then carried out to generate stock WT Ub solutions at concentrations of 5 M, 10 M, 30 M and 50 M (100 mM Na.sub.2HPO.sub.4, pH 8). 100 L of each solution was added to 4 L 25% TFA (in acetonitrile). Samples were then analysed by LC-MS (5 L injection, see General methods; protein LC-MS) with a gradient of 10% to 75% acetonitrile (flow rate; 0.3 mL/min) over 20 minutes. The peak area of Ub at 214 nm was determined using the Agilent Chemstation software v.4.0. Runs were repeated in duplicate.
[0073] Reaction of Glutathione with UbS-=CN and Rate Constant Determination
[0074] The rate constant for the reaction of UbS-=CN with reduced glutathione was obtained by manual mixing under pseudo-first order conditions by monitoring the exponential depletion of UbS-=CN based on the decrease in integrated peak area from a HPLC data (at UV absorbance of 280 nm). Observed rates, kobs, for the reaction were obtained with a 2000-, 8000- and 16000-fold excess of reduced glutathione in 100 mM Na.sub.2HPO.sub.4, pH 8. Reduced glutathione stock solution (1 M) was prepared with MQ water. The pH was adjusted to pH 7 without exceeding pH 7.5 and was degassed thoroughly with argon for 10 minutes. Glutathione solutions of 125 mM, 500 mM and 1000 mM were then subsequently prepared (by dilution of the 1 M glutathione stock), with a final Na.sub.2HPO.sub.4 concentration of 100 mM (using a buffer solution of 1 M Na.sub.2HPO.sub.4, pH 8). The solutions were also thoroughly argon degassed.
[0075] UbS-=CN solution (60 M, 100 mM Na.sub.2HPO.sub.4, pH 8) was made up from a stock of UbS-=CN in MQ water and 1 M Na.sub.2HPO.sub.4, pH 8. UbS-=CN and reduced glutathione stock solutions were incubated at room temperature for 10 minutes prior to use in kinetic reactions. UbS-=CN concentration was determined using the standard curve described above.
[0076] The reaction was initiated by the addition of UbS-=CN (500 L, 60 M) to pre-incubated (5 minutes) reduced glutathione stock solution (500 ) in a Eppendorf thermomixer (37 C., 600 rpm). A total of 9 time points were taken per reaction (0, 1, 5, 15, 30, 60, 120, 180 and 360 minutes) and the reaction was repeated in duplicate.
[0077] At an appropriate time point, 100 L of reaction solution was quenched with 4 L quenching solution (25% TFA in acetonitrile), and was subjected to LC-ESI-MS analysis (instrument parameters below).
[0078] Initial time points (0 minutes) were obtained for each reaction by pre-mixing the appropriate reduced glutathione stock solution (50 L) with quenching solution (4 L), followed by the addition of UbS-=CN (50 L, 60 M). Quenched reaction solution (5 L injection) was analysed by HPLC (see General Methods, protein LC-MS) with a gradient of 10% to 75% acetonitrile (flow rate; 0.3 mL/min) over 20 minutes. Absorbance data at 280 nm was collected for UbS-=CN (retention time; 13.8 minutes) and the peak was integrated automatically by the Agilent Chemstation v.4 software. Data were fit to an exponential decay function to allow determination of the half-life. The observed rate, k.sub.obs, for each run were calculated from the half-life equation:
[0079] and k.sub.obs for each run was plotted against the concentration of reduced glutathione to obtain the rate constant, k, from the slope of the plot. All data processing was performed using Prism v.6.0d (GraphPad).
[0080] Covalent Modification of Deubiquitinases with UbS-=CN 100 mM Na.sub.2HPO.sub.4 phosphate buffer, pH8 and deubiquitinase enzymes (DUBs; UCH-L3 residues 1-103 (93 M), OTUB2 residues 1-234 (275 M), His-USPS residues 1-858 (21 M), His-USP21 residues 196-565 (25 M) GST-USP2 residues 1-353 (7 M), His-TRABID residues 245-697 (18 M)) were individually aliquoted into 1.5 mL microcentrifuge tubes and placed on-ice to give a final DUB concentration of 5 M (based on a 50 L reaction volume). The DUB solutions were incubated in an Eppendorf thermomixer (30 C., 400 rpm) for 5 minutes before the addition of UbS-=CN (8.6 L, 116 M in MQ water) was added to each tube to give a final UbS-=CN concentration 20 M (in a reaction volume of 50 L).
[0081] A control sample of UbS-=CN (20 M in 50 L reaction volume), which contained no DUB, was also prepared and incubated alongside DUB samples. SDS sample buffer contained 2-mercaptoethanol at a final concentration of 179 mM which illustrates redox stability of the modifications.
[0082] The reaction solution was incubated at 30 C. for 1 hour at which time 16 L of reducing SDS-gel loading buffer (NuPAGE LDS loading buffer (4), 715 mM 2-mercaptoethanol) was added to each microcentrifuge tube. The quenched reaction solutions were boiled for 1 minute at 100 C. and then 15 L of solution was analysed by SDS-PAGE (NuPAGE Bis-Tris, 4-12%).
[0083] Synthesis of (E)-Methyl 3-Tosylacrylate (2)
[0084] Phl(OAc)2 (966 mg, 2 mmol) was added to a suspension of methyl methacrylate (2 mmol), sodium arenesulfinate (8.0 mmol), and KI (328 mg, 2.0 mmol) in CH.sub.3CN (8 mL). The reaction mixture was stirred vigorously at room temperature for 1 h under an inert atmosphere. The reaction mixture was quenched by the addition of saturated Na.sub.2S.sub.2O.sub.3 aq. (20 mL) followed by a saturated aqueous solution of NaHCO.sub.3 aq. (20 mL). Further stirring was followed by extraction with EtOAc (350 mL). The combined organic phases were washed with saturated NaCl aq. (75 mL) and dried over Na.sub.2SO.sub.4. The organic solvent was removed in vacuo and the crude product was directly purified by flash chromatography using a Reveleris 2 flash chromatography system (Grace) (Reveleris 12 g silica column; EA:Hexane; 12% to 100% EA gradient elution).
[0085] Expression and Purification of E1 Activating Enzymes
[0086] His-tagged human UBA1 and UBA7 cDNA were cloned into the pFastBacHTB vector (Life Technologies) with N-terminal 6His tags. A C632A mutant of UBA1 was made by Quikchange mutagenesis. Dac-tagged.sup.[6] NAE1 and UBA3 CDNA were cloned into the pFastBacDual vector (Life Technologies). The recombinant E1s were expressed using the Bac-to-Bac system (Life Technologies). Briefly, the bacmid DNAs were generated in DH10Bac cells, and the resulting baculovirus was generated and amplified in Spodoptera frugiperda Sf21 insect cells (Life Technologies). E1s were overexpressed in Sf21 insect cells grown in Insect-Xpress medium (Lonza). Cells were harvested 72 h after infection. For UBA1, UBA1 C632A and UBA7 cells were lysed by sonication in lysis buffer (25 mM HEPES, 150 mM NaCl, 0.3% Triton X-100, 0.5 mM EGTA, 0.1 mM EGTA, 1 mM DTT, Leupeptin & Pefabloc. The lysate was clarified by ultracentrifugation (40,000 rpm for 1 h). The supernatant was subjected to Ni-NTA affinity chromatography (Qiagen) and washed with wash buffer (25 mM HEPES, 250 NaCl, 20 mM imidazole 0.3% Triton X-100, 0.5 mM EGTA, 0.1 mM EGTA, 1 mM DTT). Protein was eluted with imidazole and dialyzed into storage buffer (25 mM HEPES pH 7.5, 10% glycerol, 150 mM NaCl, 0.03% Brij35, 1 mM DTT). In the case of wt UBA1, the N-terminal His-tag was removed with TEV protease and protease was subsequently depleted by incubation with Ni-NTA resin. For Dac-NAE1-UBA3, cells were lysed by sonication in buffer (40 mM Tris pH 7.5, 0.2% Triton X-100, 0.5 mM ETDA, 0.5 mM EGTA, 1 mM DTT, protease inhibitor). Clarified lysate was incubated with ampicillin sepharose and washed with wash buffer (40 mM HEPES pH 7.5 150 mM NaCl, 0.03% Brij35) and eluted with wash buffer supplemented with 5% glycerol and 10 mM ampicilin buffer. Eluted protein was further purified by gel filtration (Superdex 200 16/60, GE Healthcare) using wash buffer as running solvent.
[0087] GST-tagged SAE1 and His-tagged UBA2 were cloned into the pET DUET-1 vector and co-expressed protein was expressed in E. coli BL21(DE3) cells. Cells were lysed in lysis buffer (50 mM Tris pH 7.5, 150 mM NaCl, 1 mM EGTA 1 mM EDTA, 1 mM Leupeptin, 1 mM DTT, 0.03% Brij-35, 1% Triton-X100). Nickel affinity purification using Ni-NTA resin (Qiagen) was carried out on the clarified lysate and resin was washed with buffer (50 HEPES pH 7.5, 150 mM NaCl, 5 mM imidazole, 0.03% Brij35, 10% glycerol) protein was eluted with elution buffer (50 mM HEPES pH 7.5, 150 mM NaCl, 400 mM imidazole, 0.03% Brij35, 10% glycerol). Protein was subsequently purified using glutathione resin and washed with wash buffer. Protein was then eluted with GST elution buffer (50 mM HEPES pH 7.5, 150 mM NaCl, 10 mM GSH, 0.03% Brij35, 10% glycerol).
[0088] Activity-Based Labelling of E1 Activating Enzymes with E2 Probes
[0089] E2 probes (14 M) were mixed with E1 enzyme (3.5 M) and diluted 10reaction buffer (500 mM Na.sub.2HPO.sub.4 pH 8) or 10X Ub-ATP buffer (500 mM Na.sub.2HPO.sub.4 pH 8, 20 M ubiquitin, 20 mM ATP) to a final volume of 15-50 L. Reactions were incubated at 30 C. and 15 L aliquots were taken at 1 and 5 h time points which were quenched with 5 L of reducing SDS-gel loading buffer (NuPAGE LDS loading buffer (4), 715 mM 2-mercaptoethanol). The quenched reaction solutions were boiled for 5 minute at 100 C. and then 4 L was analysed by SDS-PAGE (NuPAGE Bis-Tris, 4-12%).
[0090] Compatibility of Probe Labelling with Reducing Agents, Acids and Bases
[0091] Activity-based crosslinking against Uba1 was carried out pro rata as described above with Ubc13-=CN and Ubc13-VME probes but in a reaction volume of 20 L and in the presence of 1 mM TCEP, DTT and 2-mercaptoethanol (10 mM stock solutions) and 10 mM TCEP, DTT and 2-mercaptoethanol (100 mM stock solutions).
[0092] To test the stability of the formed crosslinks, crosslinking reactions with Ubc13-=CN and Ubc13-VME were carried out on a larger scale in a final volume of 140 L. No additional reducing agent was added and reactions were again incubated for 3 h at 30 C. 20 L aliquots of each reaction were then treated with 10 L of the following: 750 mM TCEP, 750 mM 2-mercaptoethanol, 1.5 M HCl, 15% TFA (aq.), 15% formic acid (aq.), 15% acetic acid (aq.) and 1.5 M NaOH. The treated samples were then incubated for 2 h at 23 C. Samples were then diluted with 4 LDS loading buffer+BME and 6 L was analyzed by SDS-PAGE.
[0093] Competitive ABPP of UBA1 with PYR-41
[0094] Human UBA1 (500 nM) was incubated with Pyr41 (50 M) or DMSO control respectively in 50 mM Na.sub.2HPO.sub.4, pH 8 buffer for 15 minutes at room temperature. Ubiquitylation components (Ub-Fluorescein (Boston Biochem U-580), ATP and MgCl.sub.2) were then added as a stock solution (final concentrations of 2 M, 2 mM and 10 mM respectively) to the pre-incubated samples and were then incubated for a further 15 minutes at 30 C. in an Eppendorf thermomixer. The samples were then divided into two portions and were treated with UBE2N-=CN (14 M) or with MQ water (to account for the minor volume change (4%) on E2-probe addition). Samples were then left to incubate for 1 hour at 30 C. in an Eppendorf thermomixer. 4 LDS loading buffer (non-reducing) was added to a final concentration of 1(For western blotting, BME was added to the LDS treated samples, which were then heated). Samples were then subjected to 4-12% SDS-PAGE (MOPS buffer, 45 minutes, 200V) and were analysed by fluorescence imaging (excitation wavelength 273 nM) on a Fujifilm FLA-1500 imager and by western blotting (anti-His detection; experimental conditions as above).
[0095] Cell Culture and Lysis Protocol
[0096] HEK 293 cells were cultured in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% foetal bovine serum, 2 mM L-glutamine and antibiotics (100 Units ml.sup.1 penicillin, 100 gml.sup.1 streptomycin). All cells were cultured at 37 C. in a 10% CO.sub.2 humidified atmosphere.
[0097] Cells from one culture flask (75 cm.sup.2, Nunclon) at 90% confluence were washed with Dulbecco's Phosphate Buffered Saline (DPBS) and trypsinised (0.05% Trypsin-EDTA (1), Gibco) at room temperature. Trypsinised cells from three culture flasks were combined, centrifuged (1200 rpm, 4 C., 3 minutes) and washed with DPBS (repeated once). Cells were snap frozen with liquid nitrogen and stored at 80 C.
[0098] The combined cells from three culture flasks were lysed with 50 mM Tris pH 7.5, 150 mM NaCl, 1% Nonidet P40 substitute, 0.25% sodium deoxycholate, 1 mM AEBSF, 1 mM sodium orthovanadate, 2 mM benzamidine, 1 mM sodium fluoride, Roche complete EDTA free inhibitor cocktail, and benzonase (Sigma-Aldrich) using 200 L 1.1lysis buffer per culture flask. The cell pellet was incubated on-ice for 20 minutes. Lysates were cleared using centrifugation (13200 rpm, 30 minutes) and filtration through 0.45 m spin filters (Millipore) to remove cell debris. Lysates were then diluted approximately 3 fold with 50 mM Tris pH 7.5, 150 mM NaCl, 1 mM PMSF, Roche complete EDTA free inhibitor cocktail, 1.33 mM TCEP to bring the detergent concentration down to 0.3% and a final protein concentration of 2.8 mg/mL as determined by Bradford assay (595 nm).
[0099] Activity-Based Profiling of Protein Extracts
[0100] E2 probes were added to 125 g of protein extract (50 L) and incubated at 30 C. for 3 hours. All probes based on UDE2D1, UBE2D2, UBE2D3 and UBE2M were used at a concentration of 5 M. Probes based on UBE2L3, UBE2L6, UBE2N, UBE2H and UBE2I were used at 25 M. Post-incubation, the DUB USP2 (1 M) was added to parallel incubations with UBE2D1-based probes and incubated at 25 C. for 30 min to check if polyubiquitination was exacerbating labelling profile. Labelling was quenched by the addition of 1 part 4 LDS loading buffer (Life Technologies) supplemented with 715 mM 2-mercaptoethanol (BME) to 3 parts probe-treated protein extract. Proteins were resolved by SDS-PAGE (10%) and transferred to nitrocellulose membrane (20 V for 40-60 min) by semi-dry transfer using a Novex Semi-dry device (Life Technologies). Membranes were blocked by incubation with 5% milk powder in phosphate buffered saline+0.1% Tween 20 (PBST) for 1 h. His-tagged species were probed with 1:10000 anti-His primary antibody (Clontech) in PBST+5% milk powder for 30 min at room temperature. Detection was carried out by incubation with 1:2500 anti-mouse-HRP conjugated antibody (Cell Signalling Technologies) in PBST+5% milk powder for 1 h at room temperature. ECL Prime substrate (GE Life Sciences) was used for visualization in accordance with the manufacturer's protocol. Probing for UBA1 was carried out with anti-UBA1 primary antibody (Sigma E3152) and incubated for 1 h at room temperature. Detection was carried out by incubation with 1:15000 anti-mouse-HRP conjugated antibody (Cell Signalling Technologies) in PBST+5% milk powder for 1 h at room temperature.
[0101] Activity-Based Profiling of Alkylated Cell Extract
[0102] The same procedure was followed as described for unmodified protein extracts but prior to addition of probe, extracts were treated with 20 mM N-ethylmaleimide (NEM; 1M stock solution in EtOH) for 20 minutes at 23 C.
[0103] Expression of AzF Containing UBE2D1 C86 Conjugating Enzyme (UBE2D1 C86 AzF3)
[0104] Quikchange site-directed mutagenesis was used to introduce amber stop codons into a plasmid harbouring UBE2D1 C21S C107S C111S (pHISTEV30a-UBE2D1C86) at residue position 3 (upstream of the N-terminal His tag). The 5-GGAGATATACATATGTCGTAGTACCATCACCATCACC-3 (SEQ ID NO:16) forward and 5- GGTGATGGTGATGGTACTACGACATATGTATATCTCC-3 (SEQ ID NO:17) reverse primer was used yielding the plasmid pHISTEV30a-UBE2D1C86-TAG3. Successful mutation was confirmed by DNA sequencing. Mutations (Y32T, E107N, D158P, I159L, L162Q) which are reported to permit the incorporation of azido-phenylalaine (AzF), .sup.[7] were introduced into a Methaacoldococcus Janaschi tyrosyl-tRNA synthetase gene (MjYRS) flanked by Ndel and Pstl restriction sites to yield plasmid pBK-AzFRS. The gene was amplified by PCR and BgIII and SaII restriction sites were introduced at the 5- and 3-ends with the 5-AGATTGAGATCTATGGACGAGTTCGAAATG-3 (SEQ ID NO:18) forward and 5-AGTTGGGTCGACTTATAATCTCTTTCTAATTGGC-3 (SEQ ID NO:19) reverse primer. PCR product was digested with BgIII and SaII restriction enzymes (Fermentas). In paralell, the pEVOL-pBoF plasmid,.sup.[8,9] (kindly provided by Prof. Peter Schultz) was similarly treated. This plasmid contains constituitive and inducible copies of a mutant MjYRS which directs the incorporation of p-boronophylalanine. Digested vector and insert were ligated with T4 DNA Ligase. Replacement of the indicuble copy of the mutant MjYRS gene with the AzF mutant was confirmed by DNA sequencing which yielded plasmid pEVOL-BoFRS/AzFRS. To replace the constituitive copy of the mutant M.sub.jYRS pBK-AzFRS and pEVOL-BoFRS/AzFRS were treated with Ndel and Pstl restriction enzymes and the insert from pBK-AzFRS was cloned into the the pEVOL backbone yielding pEVOL-AzFRS. Chemically competent BL21-DE3 cells were cotransformed by heat shock with pEVOL-AzFRS and pHISTEV30a-UBE2D1C86. Luria-Bertani medium (LB; 50 mL) was supplemented with chloramphenicaol (34 ug/ml) and ampicilin (100 ug/ml) and was incolulated with the cotransformed pET156P-UBE2H-TAG3 recovered cells. LB supplemented with chloramphenicaol (34 ug/ml) and kanamycin (50 ug/ml) was inoculated with the cotransformed 200 l pHISTEV30a-UBE2D1C86 recovered cells. Cultures were incubated overnight at 37 C. were diluted 1:20 into fresh LB medium (500 ml) with appropriate antibiotics reduced to 50% of the concentrations used in the overnight cultures. Cells were cultured (37 C., 220 rpm) until OD.sub.6000.6-0.8 and then AzF (1 mM; Bachem) and arabinose (0.02%) was added followed by chilling for 15 min in an ice bath. IPTG (0.1 mM) was then added and cells were cultured overnight hours at 20 C. Harvested cells were lysed in lysis buffer (50 mM Tris pH 8.0, 250 mM NaCl, 10 mM Imidazole and Roche Complete EDTA free protease inhibitor tablet). Protein was loaded onto Ni-NTA agarose (Qiagen) and washed with lysis buffer. UDE2D1-C86-AzF3 was eluted with elution buffer (50 mM Tris pH 8.0, 150 mM NaCl, 100 mM Imidazole).
[0105] TAMRA and Biotin Labelling of UDE2D1-C86-AzF3
[0106] UBE2D1-086-AzF3 (1 mL @ 0.8 mg/mL; determined by Bradford assay) was incubated (in the absence of light) with DBCO-PEG.sub.4-Biotin (Jena Bioscience) or DBCO-PEG4-TAMRA (Jena Bioscience) (20 mM and 5 mM DMSO stocks respectively) at a final concentration of 250 M in an eppendorf thermomixer (300 rpm) at 25 C. for 5 hours and subsequently overnight at 20 C. The reaction was monitored by LC-MS. The conjugated material was incubated with 5 mM TCEP at room temperature for 45 minutes and was then buffer exchanged into 100 mM Na.sub.2HPO.sub.4, 150 mM NaCl, pH 8, 0.1 mM TCEP using a PD10 desalting column (GE Healthcare). The TAMRA conjugate was further purified by size exclusion chromatography using a HiLoad 16/600 Superdex 75 pg column. Running buffer was 100 mM Na.sub.2HPO.sub.4, 100 mM NaCl, pH 8. The protein conjugates (UBE2D1-086-Biotin and UBE2D1-C86-TAMRA) were then concentrated using an Amicon centrifugal filter (3 KDa MWCO) to a concentration of 2-3 mg/mL (determined by Bradford assay).
[0107] VME Labelling of UBE2D1-C86-Biotin and UBE2D1-C86-TAMRA
[0108] UBE2D1-C86-Biotin or UBE2D1-C86-TAMRA (1 mL 1mg/mL) was incubated with 4 mol equivalents of 2 (20 mM DMSO stock) at room temperature for 1 hour. The reaction was monitored by LC-MS. Once complete, the VME-labelled protein was buffer exchanged into 100 mM Na.sub.2HPO.sub.4, 150 mM NaCl, pH8, using a PD10 desalting column (GE Healthcare) and using an Amicon centrifugal filter (3KDa MWCO) to a concentration of 2-3 mg/mL (determined by Bradford assay).
REFERENCES FOR MATERIALS AND METHODS SECTION
[0109] [1] C. Chatterjee, R. K. McGinty, B. Fierz, T. W. Muir, Nat Chem Biol 2010, 6, 267-269.
[0110] [2] J. Chen, Y. Ai, J. Wang, L. Haracska, Z. Zhuang, Nat Chem Biol 2010, 6, 270-272.
[0111] [3] D. Komander, M. J. Clague, S. Urb, Nat Rev Mol Cell Biol 2009, 10, 550-563.
[0112] [4] S. Virdee, Y. Ye, D. P. Nguyen, D. Komander, J. W. Chin, Nature Chemical Biology 2010, 6, 750-757.
[0113] [5] F. El Oualid, R. Merkx, R. Ekkebus, D. S. Hameed, J. J. Smit, A. de Jong, H. Hilkmann, T. K. Sixma, H. Ovaa, Angew Chem Int Ed Engl 2010, 49, 10149-10153.
[0114] [6] D. W. Lee, M. Peggie, M. Deak, R. Toth, Z. O. Gage, N. Wood, C. Schilde, T. Kurz, A. Knebel, Anal Biochem 2012, 428, 64-72.
[0115] [7] J. W. Chin, S. W. Santoro, A. B. Martin, D. S. King, L. Wang, P. G. Schultz, J Am Chem Soc 2002, 124, 9026-9027.
[0116] [8] T. S. Young, I. Ahmad, J. A. Yin, P. G. Schultz, J Mol Biol 2010, 395, 361-374.
[0117] [9] E. Brustad, M. L. Bushey, J. W. Lee, D. Groff, W. Liu, P. G. Schultz, Angewandte Chemie International Edition 2008, 47, 8220-8223.
[0118] Results & Discussion
[0119] We reasoned that a strategy for making ABPs directed towards such activity would be to use an E2 as a binding element and exploit the juxtaposition of catalytic cysteine residues between functional E1-E2 and E2-E3 pairs (Scheme 1C & D). The conserved E2 catalytic cysteine could serve as a labelling site for installation of a warhead such as an activated vinylsulfide (AVS). Aqueous nucleophilic thiol-yne addition to electron deficient alkynes generates an AVS,.sup.[6] which has been shown to undergo nucleophilic thiol-ene addition affording a geminal bisthioether, which would mirror the geometry of the transthioesterification intermediate (Scheme 1A-C).sup.[6c, 7]. AVS installation can also be carried out by an addition-elimination reaction with arylsulfonyl substituted doubly activated vinyl compounds which yields the trans regioisomer (
[0120] His-tagged UBE2N. Labelling with 4 eq. of 1 was achieved within 30 minutes at 25 C.
[0121] We tested the ability of UBE2N labelled with 1 (UBE2N-=CN) to undergo activity-based labelling of human Ub E1 activating enzyme UBA1 ,.sup.[13] which has 19 cysteine residues in addition to the catalytic C632. In pH 8 phosphate buffer UBA1 (3.5 M) was incubated with 4 eq. of UBE2N-=CN at 30 C. After 1 h, labelling of UBA1 was observed which was strictly dependent on the presence of C632 (
[0122] We next tested whether E2 probes could label endogenous proteins in a complex proteome. We prepared additional thioacrylonitrile and thiomethyl acrylate probes built on UBE2D1, UBE2D2, UBE2D3 and UBE2H. UBE2D1-3 have been shown to be promiscuous E2s that support activity of many E3s..sup.[20] UBE2D1-3 contain 4 cysteines and as before all cysteines were labelled as modification of all cysteine residues in an E2 with bulky fluorophores has been shown to have no effect on affinity to the HECT E3, E6AP,.sup.[21] but we also prepared a mutant of UBE2D1 where the non-catalytic cysteines were mutated to serine (UBE2D1C86). UBE2H was chosen as it only has a single catalytic cysteine. Human embryonic kidney cell (HEK293) extracts (125 g) were incubated with empirically determined probe concentrations (5-25 M). After incubation at 30 C. for 3 h, all probes with a Ub E2 binding element produced a labelled band consistent with the molecular weight of modified UBA1 as determined by anti-His and anti-UBA1 western blot and labelling was dependent on the presence of the AVS warhead (
[0123] In conclusion, we have demonstrated that use of TDMAs to chemoselectively install thioacrylonitrile and thiomethyl acrylate groups onto recombinant proteins. Proximity effects arising from juxtaposition of the AVSs with a cysteine residue upon protein-protein binding leads to efficient formation of stable covalent labelling as exemplified by the production of ABPs directed against 4 E1s. These ABPs should prove to be valuable tools for targeted profiling of E1 pharmacological space with the ability to assess cross selectivity. Potential for E3 profiling is currently underway which will be facilitated by our biotin- and TAMRA conjugated probes. We envisage this technology will also find utility in protein engineering and material sciences in general.
[0124] [1] D. Komander, M. Rape, Annu. Rev. Biochem 2012, 81, 203-229.
[0125] [2] aM. D. Petroski, BMC Biochem 2008, 9 Suppl 1, S7; bD. Hoeller, C.-M. Hecker, I. Dikic, Nat. Rev. Cancer2006, 6, 776-788; cP. Cohen, Nat. lmmunol. 2014, 15, 521-529.
[0126] [3] aA. Hershko, A. Ciechanover, Annu. Rev. Biochem 1998, 67, 425-479; bJ. J. Smit, T. K. Sixma, EMBO Rep 2014, 15, 142-154.
[0127] [4] aM. J. Niphakis, B. F. Cravatt, Annu. Rev. Biochem 2014, 83, 341-377; bL. E. Sanman, M. Bogyo, Annu. Rev. Biochem 2014, 83, 249-273.
[0128] [5] aH. An, A. V. Statsyuk, J. Am. Chem. Soc. 2013; bX. Lu, S. K. Olsen, A. D. Capili, J. S. Cisar, C. D. Lima, D. S. Tan, J. Am. Chem. Soc. 2010, 132, 1748-1749.
[0129] [6] aH.-Y. Shiu, H.-C. Chong, Y.-C. Leung, M.-K. Wong, C.-M. Che, Chem-Eur J2010, 16, 3308-3313; bH.-Y. Shiu, T.-C. Chan, C.-M. Ho, Y. Liu, M.-K. Wong, C.-M. Che, Chem-Eur J 2009, 15, 3839-3850; cV. X. Truong, A. P. Dove, Angew. Chem. Int. Ed. Engl. 2013, 52, 4132-4136.
[0130] [7] aH. Kuroda, I. Tomita, T. Endo, Polymer 1997, 38, 6049-6054; bA. L. Krasovsky, V. G. Nenajdenko, E. S. Balenkova, Russ. Chem. Bull. 2002, 51, 2080-2085; cD. H. Grayson, S. H. ODonnell, ARKIVOC 2003.
[0131] [8] S. Strickson, D. G. Campbell, C. H. Emmerich, A. Knebel, L. Plater, M. S. Ritorto, N. Shpiro, P. Cohen, Biochemical J 2013, 451, 427-437.
[0132] [9] aA. Borodovsky, H. Ovaa, N. Kolli, T. Gan-Erdene, K. D. Wilkinson, H. L. Ploegh, B. M. Kessler, Chem Biol 2002, 9, 1149-1159; bM. Altun, H. B. Kramer, L. I. Willems, J. L. McDermott, C. A. Leach, S. J. Goldenberg, K. G. S. Kumar, R. Konietzny, R. Fischer, E. Kogan, M. M. Mackeen, J. McGouran, S. V. Khoronenkova, J. L. Parsons, G. L. Dianov, B. Nicholson, B. M. Kessler, Chem BioI 2011, 18, 1401-1412; cJ. F. McGouran, S. R. Gaertner, M. Altun, H. B. Kramer, B. M. Kessler, Chem Biol 2013.
[0133] [10] L. Yi, H. Li, L. Sun, L. Liu, C. Zhang, Z. Xi, Angew. Chem. Int. Ed. Engl. 2009, 48, 4034-4037.
[0134] [11] P. Katrun, S. Chiampanichayakul, Eur J Org Chem 2010, 5633-5641.
[0135] [12] G. Joshi, E. V. Anslyn, Org. Lett. 2012, 14, 4714-4717.
[0136] [13] B. A. Schulman, J. W. Harper, Nat. Rev. Mol. Cell. Biol. 2009, 10, 319-331.
[0137] [14] aA. Hershko, H. Heller, S. Elias, A. Ciechanover, J. Biol. Chem. 1983, 258, 8206-8214; bC. M. Pickart, E. M. Kasperek, R. Beal, A. Kim, J Biol Chem 1994, 269, 7115-7123.
[0138] [15] aD. T. Huang, H. W. Hunt, M. Zhuang, M. D. Ohi, J. M. Holton, B. A. Schulman, Nature 2007, 445, 394-398; bS. K. Olsen, C. D. Lima, Mol Cell 2013, 49, 884-896.
[0139] [16] L. Huang, E. Kinnucan, G. Wang, S. Beaudenon, P. M. Howley, J. M. Huibregtse, N. P. Pavletich, Science 1999, 286, 1321-1326.
[0140] [17] aH. Tong, G. Hateboer, A. Perrakis, R. Bernards, T. K. Sixma, J Biol Chem 1997, 272, 21381-21387; bD. T. Huang, A. Paydar, M. Zhuang, M. B. Waddell, J. M. Holton, B. A. Schulman, Mol Cell 2005, 17, 341-350.
[0141] [18] Y. Yang, J. Kitagaki, R.-M. Dai, Y. C. Tsai, K. L. Lorick, R. L. Ludwig, S. A. Pierre, J. P. Jensen, I. V. Davydov, P. Oberoi, C.-C. H. Li, J. H. Kenten, J. A. Beutler, K. H. Vousden, A. M. Weissman, Cancer Res 2007, 67, 9472-9481.
[0142] [19] aD. A. Bachovchin, L. W. Koblan, W. Wu, Y. Liu, Y. Li, P. Zhao, I. Woznica, Y. Shu, J. H. Lai, S. E. Poplawski, C. P. Kiritsy, S. E. Healey, M. DiMare, D. G. Sanford, R. S. Munford, W. W. Bachovchin, T. R. Golub, Nat. Chem. Biol. 2014, 10, 656-663; bD. A. Bachovchin, S. J. Brown, H. Rosen, B. F. Cravatt, Nat. Biotechnol. 2009, 27, 387-394.
[0143] [20] Y. Ye, M. Rape, Nat Rev Mol Cell Biol 2009, 10, 755-764.
[0144] [21] Z. M. Eletr, B. Kuhlman, J. Mol. Biol. 2007, 369, 419-428.
[0145] [22] C. H. Emmerich, A. Ordureau, S. Strickson, J. S. C. Arthur, P. G. A. Pedrioli, D. Komander, P. Cohen, Proc Natl Acad Sci U S A 2013, 110, 15247-15252.
[0146] [23] aJ. W. Chin, S. W. Santoro, A. B. Martin, D. S. King, L. Wang, P. G. Schultz, J. Am. Chem. Soc. 2002, 124, 9026-9027; bT. S. Young, I. Ahmad, J. A. Yin, P. G. Schultz, J. Mol. Biol. 2010, 395, 361-374.
[0147] [24] N. J. Agard, J. A. Prescher, C. R. Bertozzi, J. Am. Chem. Soc. 2004, 126, 15046-15047.
[0148] General Materials
[0149] All DNA constructs were verified by DNA sequencing, which was performed by The Sequencing Service, School of Life Sciences, University of Dundee, using DYEnamic ET terminator chemistry (Amersham Biosciences) on Applied Biosystems automated DNA sequencers. DNA for bacterial protein expression was transformed into E. coli BL21-DE3 (Merck) or BL21 DE3 RIL (codon plus) cells (Stratagene). With the exception of pCDF-PyIST, all cDNA plasmids and antibodies generated for this study are available to request through our reagents website (mrcppureagents.dundee.ac.uk/).
[0150] LC-MS was carried out with an Agilent 1200 LC-MS system fitted with a Max-Light Cartridge flow cell coupled to a 6130 Quadrupole spectrometer. The solvent system consisted of 0.05% trifluoroacetic acid (TFA) in H.sub.2O as buffer A, and 0.04% TFA acid in acetonitrile (MeCN) as buffer B. Protein UV absorbance was monitored at 214 and 280 nm. An Agilent ZORBAX 300SB-C3 5 um, 2.1150 mm column was employed for proteins unless otherwise stated. Protein MS acquisition was carried out in positive ion mode and total protein masses were calculated by deconvolution within the MS Chemstation software (Agilent Technologies). Semi-preparative peptide HPLC was carried out on a Dionex Ultimate system with Thermo Biobasic C4 21.2 x 250 mm column at a flow rate of 10 ml min.sup.1. All solvents and reagents were purchased from Sigma Aldrich or VWR unless otherwise stated.
[0151] Synthesis of Alkyne-Functionalized TDAE 3
[0152] PhI(OAc).sub.2 (966 mg, 2 mmol) was added to a suspension of propargyl acrylate 1 (2 mmol), sodium arenesulfinate (8.0 mmol), and KI (328 mg, 2.0 mmol) in acetonitrile (MeCN) (8 mL). The reaction mixture was stirred vigorously at room temperature for 1 h under an inert atmosphere. The reaction mixture was then quenched by the addition of saturated Na.sub.2S.sub.2O.sub.3 aq. (20 mL) followed by a saturated aqueous solution of NaHCO.sub.3 aq. (20 mL). Further stirring was followed by extraction with ethyl acetate (EtOAc) (350 mL). The combined organic phases were washed with saturated NaCl aq. (75 mL) and dried over Na.sub.2SO.sub.4. The organic solvent was removed in vacuo and the crude product was directly purified by flash chromatography using a Reveleris X2 flash chromatography system (Grace) (Reveleris 12 g silica column; EA:Hexane; 15% to 25% to 100% EA gradient elution) to yield 3.
[0153] .sup.1H NMR (500 Mhz, CDCl.sub.3) 7.79 (2H, d, 8.4 Hz), 7.35-7.40 (3H, m), 6.81 (1H, d, 15.2 Hz), 4.78 (2H, d, 2.5 Hz), 2.51 (1H, t, 2.5 Hz), 2.46 (3H, s); .sup.130 NMR (126 MHz, CDCl.sub.3) 162.75, 145.83, 144.60, 135.21, 130.32, 129.19, 128.48, 76.50, 75.87, 53.23, 21.74.
[0154] HR-MS: observed [M-H].sup. 263.0361 (calculated 263.0373).
[0155] Synthesis of Alkyne-Functionalized TDAE 4
[0156] To synthesize 4, starting material N-propargylacrylamide, 2 was first prepared as previously described (ref. 3). Purification was carried out by flash chromatography using a Reveleris X2 flash chromatography system (Grace) (Reveleris 12g silica column; EA:Hexane; 20% to 35% EA gradient elution). Analytical data corresponded to literature values. Phl(OAc).sub.2 (966 mg, 2 mmol) was added to a suspension of N-propargylacrylamide, 2 (2 mmol), sodium arenesulfinate (8.0 mmol), and KI (328 mg, 2.0 mmol) in CH.sub.3CN (8 mL). The reaction mixture was stirred vigorously at room temperature for 1 h under an inert atmosphere. The reaction mixture was quenched by the addition of saturated Na.sub.2S.sub.2O.sub.3 aq. (20 mL) followed by a saturated aqueous solution of NaHCO.sub.3 aq. (20 mL). Further stirring was followed by extraction with EtOAc (350 mL). The combined organic phases were washed with saturated NaCl aq. (75 mL) and dried over Na.sub.2SO.sub.4. The organic solvent was removed in vacuo and the crude product was directly purified by flash chromatography using a Reveleris X2 flash chromatography system (Grace) (Reveleris 12 g silica column; Toluene:EA; 0% to 1% to 10% EA gradient elution).
[0157] .sup.1H NMR (500 Mhz, CDCl.sub.3) 7.78 (2H, d, 8.3 Hz), 7.37 (2H, d, 8.5 Hz), 7.34 (1H, d, 14.9 Hz), 6.98 (1 H, d, 14.8 Hz), 6.60 (1 H, t, 5.1 Hz), 4.10-4.12 (2H, dd, 5.3, 2.6 Hz), 2.45 (3H, s), 2.23 (1H, t, 2.6 Hz); .sup.13C NMR (126 MHz, CDCl3) 161.70, 145.60, 141.00, 135.58, 132.38, 130.25, 128.23, 78.28, 72.39, 29.77, 21.72.
[0158] HR-MS: observed [M-H].sup. 262.0537 (calculated 262.0543).
[0159] Preparation of UBE2L3* (C17S, C137S), UBE2D3* (C21S, 107S, C111S) and UBE2N
[0160] Full-length E2s were cloned into the pET expression vectors downstream of an N-terminal Hisx6 tag and Precision protease site. E. coli strain BL21(DE3) transformed with E2 clones were cultured at 37 C. in LB medium supplemented with 100 g mL.sup.1 of ampicillin. When the OD.sub.600 reached 0.6, the culture was induced by addition of 0.4 mM isopropyl thio--D-galactoside (IPTG) and incubated at 37 C. for 5.0 hours. The cells were harvested by centrifugation and stored at 80 C. Cells were resuspended in ice cold lysis buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 25 mM imidazole, 0.5 mg/mL lysozyme, 50 g/mL Dnasel, Complete, Mini, EDTA-free protease inhibitor cocktail, (one tablet per 50 mL of buffer, Roche)) and incubated on ice for 30 minutes followed by sonication. The lysate was then clarified by centrifugation and the supernatant was subjected to Ni-NTA affinity chromatography (Qiagen) and washed with wash buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 25 mM imidazole). Protein was eluted with elution buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 300 mM imidazole) and dialyzed into storage buffer (20 mM Tris, 150 mM NaCl, 1 mM DTT). The protein was then further purified by size exclusion chromatography using a HiLoad 16/600 Superdex 75 pg column (GE Life Sciences) coupled to an KTA Purifier FPLC system (1.0 ml min.sup.1, running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT). Fractions were collected, concentrated and flash frozen for storage at 80 C.
[0161] General Method for UB-SR Preparation
[0162] A plasmid composed of full-length Ub cloned into the pTXB1 vector (ref. 4) was taken and the bases coding for the C-terminal Ub residues 74-76 were deleted by Quikchange mutagenesis. To suppress cellular intein activity, a T3C mutation in the GyrA intein was also introduced yielding plasmid pTXB1-Ub74-76-T3C. ER2566 E. coli cells (50 L)(NEB) were transformed with pTXB1-Ub74-76-T3C and recovered with S.O.C medium (250 L). The cells were incubated for 1 h at 37 C. and then LB medium (150 mL) containing ampicillin (100 g mL.sup.1) was inoculated with the recovered cells (300 L) and the culture was incubated overnight with shaking (200 rpm) at 37 C. LB medium (3 L) containing ampicillin (100 g mL.sup.1) was inoculated with the overnight culture (150 mL) and incubated with shaking (200 rpm) at 37 C. At OD.sub.600 -0.4, the cells were transferred to 25 C. incubator and after 30 min the cells were induced with IPTG (0.2 mM). After 5 h the cells were harvested and suspended in 90 ml lysis buffer (20 mM Na.sub.2HPO.sub.4 pH 7.2, 200 mM NaCl, 1 mM EDTA) and frozen. The thawed cells were lysed by sonication on ice and were clarified by centrifugation (13,000 rpm, 30 min). An empty XK 26/20 column (GE Life Sciences) was filled with chitin beads (30 mL) (NEB) and equilibrated with lysis buffer. At 4 C. the clarified lysate was loaded (flow rate: 1.0 mL min.sup.1) onto the column using an KTA FPLC system. The column was then washed with lysis buffer (600 mL) and equilibrated with 60 mL of cleavage buffer (20 mM Na.sub.2HPO.sub.4, pH 6.0, 200 mM NaCl, 1.0 mM EDTA, 100 mM Sodium 2-mercaptoethanesulfonate). The flow was then stopped and the column incubated for 48 hours at 4 C. to allow S-N transfer and concomitant thiolysis. Liberated Ub-SR was eluted with elution buffer (20 mM Na.sub.2HPO.sub.4, 200 mM NaCl, 1.0 mM EDTA, pH 6.0). The fractions containing Ub-SR were pooled and concentrated to 3.0 mL using an Amicon Ultra-15 centrifugal filter device (Millipore). The protein was then further purified by semi-preparative RP-HPLC (Column: BioBasic-4; Part number: #72305-259270) using the Dionex system. A gradient of 10% buffer A to 80% buffer B was applied at a flow rate of 10 mL min.sup.1 over 30 min (buffer A=0.1% TFA in H.sub.2O, buffer B=0.1% TFA in acetonitrile). Fractions containing Ub-SR were pooled and lyophilized yielding 30 mg.
[0163] UB-N.sub.3 Aminolysis Reaction
[0164] Ub-SR (25.8 mg) was reconstituted (ref. 5) by the addition of DMSO (200 L). On complete dissolution of Ub-SR in DMSO, H.sub.2O (800 L) was added to give a final DMSO concentration of 20% (v/v). 500 L of 2-azidoethanamine (Enamine) in 50% (v/v) aqueous DMSO/MQ (8 M) was then added to the Ub-SR solution. 60.0 l of triethylamine (TEA) was then added raising the solution pH to 9 and the mixture was then briefly vortexed. The resulting solution was incubated at 30 C. for 16 hours and monitored by LC-MS. The protein (Ub-N.sub.3) was then further purified by semi-preparative RP-HPLC (Column: BioBasic-4; Part number: 72305-259270) using the Dionex system. A gradient of 20% buffer A to 50% buffer B was applied at a flow rate of 10 mL min.sup.1 over 60 min (buffer A=0.1% TFA in H.sub.2O, buffer B=0.1% TFA in acetonitrile). Fractions containing Ub-N.sub.3 were pooled and lyophilized (Yield: 80%).
[0165] Conjugation of Ub-N.sub.3 with TDAE by CuAAC Click Reaction
[0166] Ub-N.sub.3 (3.5 mg) was reconstituted by the addition of 100 l DMSO. On complete dissolution of Ub-N3 in DMSO, H.sub.2O (900 L) was added to give a final DMSO concentration of 10% (v/v) and a final Ub-N.sub.3 concentration of 418.6 M.
[0167] Stock solutions of TDAEs 3 or 4 were prepared using DMSO (10 mM stock concentration). TDAEs 3 or 4 (200 L, 10 mM stock) were then mixed with a pre-prepared DMSO/MQ solution (456.2 L, 20% (v/v)). Phosphate buffer (50.0 L, 100 mM Na.sub.2HPO.sub.4 pH 7.5, 150 mM NaCl) and AUb-N3 stock solution (238.6 L, 418.6 M) were then subsequently added. Tris(3-hydroxypropyltriazolylmethyl)amine (THPTA) in H.sub.2O (25 L, 12.5 eq., 50 mM stock solution) was pre-mixed with a freshly prepared solution of CuSO.sub.4 (aq.) (5 L, 2.5 eq., 50 mM stock solution). The THPTA/CuSO.sub.4(aq.) solution (30 L) was then added to the previously prepared TDAE/Ub-N.sub.3 solution. L-ascorbic acid in H.sub.2O (25 L, 100 mM stock solution) was then added to the previously mixed components. The reaction was incubated at 23 C. with shaking (1400 rpm) for 15 minutes. The reaction was then quenched by the addition of EDTA (2.5 mM final concentration) and the product (7 or 8) was purified by semi-preparative RP-HPLC (Column: BioBasic-4; Part number: 72305-259270) using the Dionex system. A gradient of 20% buffer A to 50% buffer B was applied at a flow rate of 10 mL min.sup.1 over 60 minutes (buffer A=0.1% TFA in H.sub.2O, buffer B=0.1% TFA in acetonitrile). Fractions containing Ub-TDAE were pooled and lyophilized (Yield: 60%).
[0168] Synthesis E2-UB Probes 9, 10, 11 and 12
[0169] Ub-TDAE (7.0 mg) was reconstituted by the addition of 50 l DMSO. On complete dissolution of AUb-TDAE, H2O (450 L) was added to give a final DMSO concentration of 10% (v/v) and a final AUb-TDAE concentration of 1.6 mM. AUb-TDAE was then incubated with 0.5 eq. of the desired E2 in 0.8 ml phosphate buffer (100 mM Na.sub.2HPO.sub.4 pH 7.5, 150 mM NaCl, reducing agent free) at 23 C. for two hours and monitored by LC-MS. For probe 10 synthesis, additional 30 C. overnight incubation was required to consistently achieve quantitative elimination to the unsaturated AVS species. The product was purified by gel filtration (0.5 mL min.sup.1, 20 mM Tris-HCl pH 7.5, 150 mM NaCl as mobile buffer, HiLoad 16/600 Superdex 75pg).
[0170] Molecular Modelling of RING- and HECT-Probe Complexes
[0171] The RING-E2Ub model was generated by importing the PDB 4AP4 into the BioLuminate biologics modelling suite (Schrodinger). The AVS-triazole linker present between E2 and Ub in probe 10 was manually built and geometry optimized. Hydrogen atoms were then added using the Protein Preparation tool. E2 Cys85, Ub Leu73, and the linkage between them were selected along with all protein residues within 5 . This substructure was then energy minimized using the OPLS2005 forcefield. Minimized coordinates were then exported as mol2 files and imported into Pymol (Schrodinger) for figure generation. The same procedure was repeated for the HECT-E2Ub model using PDB 3JW0.
[0172] Parkin Activity Assay with UBE2L3*
[0173] Parkin (3 g, 760 nM) was incubated with ubiquitylation assay components in a final volume of 50 l (50 mM Tris-HCl pH 7.5, 5 mM MgCl.sub.2, 240 nM UBA1, 2 M UBE2L3 variant, 2 mM ATP, 58 M Ub and 380 nM of GST-PhPINK1 WT. The reaction was incubated at 30 C. for 1 h. The reaction was quenched by the addition of reducing 4X LDS loading buffer. The reaction mixture was resolved by SDS-PAGE and visualized by coomassie staining.
[0174] Preparation of UBE2L3-ProcK3
[0175] An amber stop codon was introduced at position 3 of the open reading frame in pET156-UBE2L3* by Quikchange site-directed mutagenesis. This yielded the plasmid pET156-UBE2L3*-TAG3 (* corresponds to a C17S and C137S mutant). BL21 (DE3) cells (Merck Biosciences) were transformed with plasmids pET156-UBE2L3*-TAG3 and pCDF-PyIST (plasmid harbouring constitutive copies of the Mb PyIRS and Mb Pyl-tRNA.sub.CUA, a kind gift from Dr. Jason Chin) and used to inoculate 200 ml LB media containing ampicillin (100 g ml.sup.1) and spectinomycin (50 g mL.sup.1). After overnight incubation at 37 C., 200 rpm, 61 L of LB medium containing ampicillin (100 g ml.sup.1) and spectinomycin (25 g mL.sup.1) were each inoculated with 30 mL overnight culture and incubated at 37 C., 200 rpm, until cell density reached OD.sub.600=0.8-0.9. Propargyloxycarbonyl-L-lysine (ProcK; Iris Biotech GmbH, #HAA2095) (300 mM stock solution in H2O and pH adjusted to 7) was then added to a final concentration of 3 mM. Cultures were then incubated for a further 20 min at 37 C. and then induced with IPTG (500 M). After 4 h cells were harvested by centrifugation at 4200 rpm, 30 min at 4 C. Cell pellets from 6 L culture were resuspended in 200 ml lysis buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 25 mM imidazole, 0.5 mg mL.sup.1 lysozyme, 5 g mL.sup.1 Dnasel, 4 tablets of Complete, EDTA-free protease inhibitor cocktail (Roche) and incubated on ice for 30 min. The suspension was then sonicated before clarification at 18,000 rpm, 30 min at 4 C. Ni-NTA resin (600 l of settled resin, Qiagen) was then added to the lysates and rotated at 4 C. for 1 h. Resin was then washed with wash buffer (50 mM Tris pH 7.5, 150 mM NaCl, 25 mM imidazole) and then eluted with elution buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 300 mM Imidazole). The eluate was then concentrated down to 2.5 mL and further purified by size exclusion chromatography using a HiLoad 16/600 Superdex 75 g column (GE Life Sciences) coupled to an KTA Purifier FPLC system (running buffer: 100 mM Na.sub.2HPO.sub.4 pH 8, 150 mM NaCl, 0.1 mM TCEP). Fractions were collected and concentrated (2.4 mg mL.sup.1, 118 M).
[0176] TAMRA Labelling of UBE2L3-ProcK3 by Copper-Catalyzed Azide-Alkyne Cycloaddition (CuAAC)
[0177] UBE2L3-ProcK3 was diluted in buffer (100 mM Na.sub.2HPO.sub.4 pH 8, 150 mM NaCl, 0.1 mM TCEP) to a final concentration of 50 M. CuSO.sub.4 and Tris(3-hydroxypropyltriazolylmethyl)amine (THPTA) (ref. 6) stock solutions were freshly prepared in H.sub.2O and then premixed before being added to the protein at final concentrations of 0.1 mM and 1.0 mM, respectively. TAMRA-azide (Jena Bioscience, #CLK-FA008, M.W.=512.56 g mol.sup.1) was then added to a final concentration of 150 M. Ascorbic acid was added to a final concentration of 4 mM. The reaction was incubated at 23 C. for 1-2 h (or until starting material had been consumed as determined by LC-MS). The reaction was then quenched with 5 mM EDTA for 15 min at 23 C. Small molecule components were then removed by dialysis against 21L buffer (100 mM Na.sub.2HPO.sub.4pH 8.0, 150 mM NaCl, 5 mM EDTA, 0.1 mM TCEP) at 4 C. over 48 h. Protein was snap frozen in liquid nitrogen and stored at 80 C.
[0178] Cell Culture and Lysis Protocol
[0179] Flp-In T-Rex HeLa stable cell lines (HeLa cells stably expressing untagged Parkin WT, S65A, C431 F or H302A) were cultured (37 C., 10% CO.sub.2) in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% (v/v) Fetal Bovine Serum (FBS), 2.0 mM L-glutamine, 1 minimum essential medium (MEM, Life Technologies), 1 non-essential amino acids (NEAA, Life Technologies), 1.0 mM of sodium pyruvate (Life Technologies) and antibiotics (100 units/ mL penicillin, 0.1 mg/mL streptomycin). At 80% confluency cells were either untreated or treated with 10 M CCCP, and incubated for a further 3 h.
[0180] Cells were rinsed with ice-cold PBS and extracted in lysis buffer (50 mM Tris-HCl pH 7.5, 1.0 mM EGTA, 1.0 mM EDTA, 0.27 M sucrose, 10 mM sodium 2-glycerophosphate, 0.2 mM phenylmethane sulfonyl fluoride (PMSF), 1.0 mM benzamidine, 1.0 mM sodium ortho-vanadate, 50 mM sodium fluoride and 5.0 mM sodium pyrophosphate). Lysis was carried out by sonication (Sonic & Materials INC, VC 100, Jencons Scientific LTD, CT,
[0181] USA, 55% amplitude, 12 times (1 sec on, 1 sec off)) and then clarified by centrifugation at 4 C. for 30 min at 14,800 rpm. Supernatants were collected (total cell extracts) and protein concentration determined by Bradford assay.
[0182] SH-SY5Y cells were grown in DMEM/F-12 media supplemented with 15% (v/v) FBS, 2.0 mM L-glutamine and antibiotics (100 units mL.sup.1 penicillin, 100 g mL.sup.1 streptomycin).
[0183] To depolarize mitochondria, cells were treated with 10 M Carbonyl cyanide m-chlorophenyl hydrazine (CCCP), dissolved in DMSO, for the indicated time. Cell extracts were prepared as described for HeLa cells. All cells were cultured at 37 C. in a 5% CO.sub.2 humidified atmosphere.
[0184] In vitro Probe-Labeling Assay
[0185] The indicated E3 ligases were added into Tris buffer (20 mM Tris-HCl pH 7.5, 150 mM NaCl) with 1.0 mM TCEP. 5.0 e.q (unless otherwise indicated) of E2Ub (probe 9 or 10) was incubated with E3 ligase at 30 C. for the indicated time. Reactions were quenched by the addition of 4 LDS loading buffer (supplemented with 680 mM 2-mercaptoethanol) and samples were analyzed by SDS-PAGE (4-12% NuPage gel) followed by coomassie staining or immunoblotting.
[0186] Ubiquitination Assay and In Situ Profiling
[0187] Parkin (1.3 M) was incubated with ubiquitylation assay components in a final volume of 30 l (50 mM Tris-HCl pH 7.5, 5 mM MgCl.sub.2, 0.12 M UBA1, 2 M UBE2L3, 0.83 M His-SUMO-Miro1, 2 mM ATP, 88 M Flag-ubiquitin and 0.31 M TcPINK1 (Tc, WT/KD). Ubiquitylation reactions were incubated at 30 C. and 1050 rpm for 60 min. Ubiquitylation reactions were stopped by the addition of 5 U ml.sup.1 Apyrase (New England BioLabs) and incubated for 10 min at 30 C. and 1050 rpm. Probe profiling was carried out by the addition of 9 or 11 (8 M) and incubated for 10 h at 30 C. and 650 rpm. The reactions were terminated by the addition of LDS sample buffer containing 4% 2-mercaptoethanol.
[0188] Reaction mixtures were resolved by SDS-PAGE and immunoblotted with the following antibodies: anti-FLAG (Sigma, 1:10000), anti-Parkin (Santa-Cruz, 1:500) or anti-His (1:5000). For Fluorescence detection, 20 l of sample were loaded on a 4-12% gel and subjected to SDS-PAGE. Gels were washed with water for 30 minutes and then visualized by scanning with a FLA-5100 imaging system (Filter: LPG, Laser: 532 nm, Voltage: 400, FUJIFILM Life Science). The gel was subsequently coomassie stained.
[0189] DUB Resistance Assay
[0190] His-USP.sub.2259-605, His-USP21.sub.196-565TUB2 and GST-UCHL3 were expressed in E. coli and purified. The DUB-reactive ubiquitin-based probe, Ub-Alk, was used as a positive control and tested in parallel with probes 9 and 10. Probes were diluted to 40 M and DUBs were diluted to 10 M in buffer (20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM TCEP). Probe (10 L) and DUB (10 L) solutions were then mixed and incubated for 2 h at 30 C. Proteins were then resolved by SDS-PAGE and visualized by coomassie staining.
[0191] Tryptic MS/MS Sequencing of Crosslinked Peptides from Parkin and 9
[0192] The coomassie stained SDS-PAGE band corresponding to the probe 9 labeled Parkin was excised and dehydrated and resuspended using standard procedures. LC-MS/MS analysis was performed on an LTQ Orbitrap Velos instrument (Thermo Scientific) coupled to an Ultimate nanoflow HPLC system (Dionex). A gradient running from 3% solvent A to 60% solvent B over 45 min was applied (solvent A=0.1% formic acid in H.sub.2O; solvent B=0.08% formic acid in 80% MeCN). Fragment ions were generated by CID and 1+ and 2+ precursor ions were excluded. Thermo .raw data was converted to .mgf format using the MSConvert software (ProteoWizard). Raw data was searched using the pLink software against UBE2L3* and Parkin sequences with trypsin specificity with up to 3 missed cleavages. A crosslinker monoisotopic mass of 307.1644 was manually added which accounted for the theoretical mass difference associated with formation of a bisthioether between 2 Cys residues together with the acrylate AVS, the triazole linkage and the tryptic Leu73 remnant from the Ub C-terminus.
[0193] ABPP of Total Cell Extracts
[0194] E2Ub probe (5.0 M) was added to total cell extracts with 1.0 mM TCEP and Tris buffer (20 mM Tris-HCl pH 7.5, 150 mM NaCl) and then incubated at 30 C. for the indicated time. Reactions were quenched by the addition of 4 LDS loading buffer (supplemented with betamercaptoethanol) and samples were analyzed by SDS-PAGE (4-12% NuPage gel) followed by immunoblotting.
[0195] Immunoblotting
[0196] Samples were resolved by SDS-PAGE (4-12% NuPage gel, Invitrogen) with MOPS or MES running buffer (without boiling) and transferred on to 0.45 m nitrocellulose membranes (GE Healthcare Life Science). Membranes were blocked with PBS-T buffer (PBS+0.1% Tween-20) containing 5% (w/v) non-fat dried skimmed milk powder (PBS-TM) at room temperature for 1 h. Membranes were subsequently probed with the indicated antibodies in PBS-T containing 5% (w/v) Bovine Serum Albumin (BSA) overnight at 4 C. Detection was performed using HRP-conjugated secondary antibodies in PBS-TM for 1 h at 23 C. ECL Prime substrate (GE Life Sciences) was used for visualization in accordance with the manufacturer's protocol.
[0197] Antibodies
[0198] His-tagged species were probed with 1:10000 anti-His primary antibody (Clontech, cat number: 631212). Anti-Parkin mouse monoclonal was obtained from Santa Cruz (sc-32282) at 1:2000 dilution (HeLa and SH-SYSY samples); anti-Parkin phospho-serine 65 rabbit monoclonal antibody was obtained as previously described (ref. 7) and used at 1:2500 dilution. GAPDH (14C10) rabbit mAb (HRP Conjugate, Cell Signaling Technology) was used at 1:5000 dilution.
[0199] Parkin Disease Mutant In Vitro Profiling
[0200] The different recombinant Parkin mutants (ref. 8) (1.0 M, 1.535 g) were incubated with Pediculus humanus corporis PINK1 (PhPINK1) or kinase dead PhPINK1 (0.77 g), TCEP (1.0 mM), ATP (1.0 mM) and Ub (75 M) in 1 Tris buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5.0 mM MgCl2) at 30 C. for 1.0 h. After 1.0 hour incubation, fluorescent probe 13 was added (5.0 M) and incubated for another 4 or 8 hours in the dark at 30 C. Reactions were quenched by the addition of 4 LDS loading buffer (supplemented with betamercaptoethanol) for the indicated time point and samples were resolved by SDS-PAGE (4-12% NuPage gel). Gels were washed with water for 30 minutes and then visualized by scanning with a FLA-5100 imaging system (Filter: LPG, Laser: 532 nm, Voltage: 400, FUJIFILM Life Science). Quantification was carried out using the Fiji software variant of ImageJ. After scanning, gels were also coomassie stained.
REFERENCES FOR THE FURTHER EXAMPLES MATERIALS AND METHODS
[0201] 1.Plechanovova, A., Jaffray, E. G., Tatham, M. H., Naismith, J. H. & Hay, R. T. Structure of a RING E3 ligase and ubiquitin-loaded E2 primed for catalysis. Nature (2012). doi: 10.1038/nature11376
[0202] 2. Kamadurai, H. B. et al. Insights into ubiquitin transfer cascades from a structure of a UbcH5Bubiquitin-HECT(NEDD4L) complex. Mol Cell 36, 1095-1102 (2009).
[0203] 3. Dadov, J. et al. Vinylsulfonamide and acrylamide modification of DNA for cross-linking with proteins. Angew Chem Int Ed Engl 52, 10515-10518 (2013).
[0204] 4. Virdee, S., Ye, Y., Nguyen, D. P., Komander, D. & Chin, J. W. Engineered diubiquitin synthesis reveals Lys29-isopeptide specificity of an OTU deubiquitinase. Nat. Chem. Biol. 6, 750-757 (2010).
[0205] 5. Oualid, E1, F. et al. Chemical synthesis of ubiquitin, ubiquitin-based probes, and diubiquitin. Angew Chem Int Ed Engl 49, 10149-10153 (2010).
[0206] 6. Hong, V., Presolski, S. I., Ma, C. & Finn, M. G. Angew Chem Int Ed Engl 48, 9879-9883 (2009).
[0207] 7. Kazlauskaite, A. et al. Binding to serine 65-phosphorylated ubiquitin primes Parkin for optimal PINK1-dependent phosphorylation and activation. EMBO reports 16, 939-954 (2015).
[0208] 8. Kazlauskaite, A. et al. Phosphorylation of Parkin at Serine65 is essential for activation: elaboration of a Miro1 substrate-based assay of Parkin E3 ligase activity. Open Biol 4, 130213 (2014).
[0209] Results
[0210] To further profile HECT/RBR ligase activity, for example, the inventors looked to develop probes which included the Ub component in an E2-ubiquitin complex. The following experiments report a scalable and modular strategy for the preparation of reengineered E2Ub conjugates that harbour an electrophile that is positioned using structural and mechanistic knowledge. The conjugates serve as ABPs that allow the profile the transthiolation activity of Parkin for example
[0211] Design of an Activity-Based Probe Based on E2Ub
[0212] We reasoned that an engineered E2Ub conjugate that contained a mechanistically positioned electrophile would serve as an ABP for profiling the transthiolation activity of HECT/RBR E3 ligases. However, the development of such probes presents a number of protein engineering challenges. Firstly, the labile thioester linkage in E2Ub needs to be rendered stable by using an appropriate non-hydrolyzable mimetic. A second challenge is the installation of an electrophile between the Ub and E2 protein conjugate. The electrophile must be appropriately positioned and kinetically tuned for specific covalent labelling of the active site cysteine of an RBR/HECT E3 in an activity-based manner. An additional consideration is that E3s function with numerous E2s and often the physiological E2-E3 pair is unknown.sup.25,30. Hence, a modular strategy that enables the production of probes built on recombinant E2s of choice would be desirable. Also, the probes should not cross-react with deubiquitinating enzymes or be hydrolyzed by their (iso)peptidase activity.sup.31. Furthermore, as such probes would be expected to be powerful structural tools enabling the stabilization of otherwise transient key enzyme intermediates, probe production in milligram quantities would also be highly desirable.
[0213] We reasoned that appending a tosyl-substituted doubly activated ene (TDAE).sup.29 to the C-terminus of Ub would generate a highly electrophilic, but thiol-specific, protein conjugate that could undergo addition-elimination with the catalytic cysteine residue of recombinant E2s allowing the production of a stable mimetic of E2Ub harboring an electrophilic trap. To achieve this the TDAE would need to be rendered tri-functional by the incorporation of an additional, yet orthogonal, reactive handle. We reasoned that an alkyne moiety would satisfy this requirement (
[0214] Trifunctional TDAEs Enable Production of E2Ub Conjugates Harboring Internal Electrophiles
[0215] We designed and synthesized TDAEs 3 and 4 bearing alkyne functionality that would ultimately furnish E2Ub conjugates harbouring thioacrylate and thio-acrylamide AVS electrophiles, respectively. Having complementary electrophiles has been shown to improve coverage of enzyme family members with other ABPs.sup.33, and would also demonstrate generality of this strategy. TDAEs 3 and 4 were prepared by synthesis of the corresponding alkyne-functionalized ene building block.sup.34, in the case of 4, followed by a Phl(OAc)2/KI-mediated reaction with sodium p-toluenesulfinate.sup.35 (
[0216] To generate azide-functionalized Ub we expressed Ub missing C-terminal residues 74-76 as a fusion with an engineered version of the GyrA intein to prevent cellular cleavage.sup.36, and liberated Ub1-73 thioester 5 by thiolysis (
[0217] Construction of a TAMRA Conjugated E2Ub Probe
[0218] To increase the versatility of the probes we constructed derivatives built on UBE2L3* bearing a bio-orthogonal alkyne handle. This would allow the production of probes that could be conjugated to fluorescent reporter tags that would expedite protein profiling by enabling direct in-gel fluorescent scanning and grant access to other powerful ABPP methodologies reliant on probe fluorescence.sup.37. Affinity tags such as biotin could also be attached to allow enrichment of active enzymes and their identification/quantification by mass spectrometry.sup.37. To incorporate alkyne functionality into our probe we expressed UBE2L3* containing the amino acid propargyloxycarbonyl-L-lysine (ProcK) N-terminal to the Hisx6 purification/reporter tag in UBE2L3*, at position 3 (UBE2L3*-ProcK3). This was achieved by amber codon suppression in E. coli using the Methanosarcina barkeri pyrrolysyl tRNA-synthetase/tRNA CUA pair 48. Incorporation of ProcK was confirmed by LC-MS. Azide-functionalized 5-carboxytetramethylrhodamine (TAMRA) was then used to label UBE2L3*-ProcK3 by CuAAC yielding UBE2L3*-TAMRA.
[0219] UBE2L3*-TAMRA was then reacted with Ub-TDAE conjugate 8 for 2 h at 23 C. The fluorescent conjugate was purified by size-exclusion chromatography and characterized by SDS-PAGE and LC-MS yielding fluorescent probe 11 (
[0220] It is expected that high affinity enrichment tags such as azide-functionalized biotin could also be conjugated to presently described probes allowing multiplexed profiling in combination with E3 ligase activity quantification and identification.
[0221] Another potential application of the probes described herein is as structural tools. There is a long- standing interest in the conformational changes and mechanistic aspects of Ub transfer throughout the Ub conjugation cascade. Key intermediates, such as transthiolation intermediates between E1-E2 and E2-E3, are inherently unstable yet define the mechanistic features of these important enzymes. Probe labelling of E3 produces a stable bisthioether cross-link between the ternary E2Ub-E3 complex. A structural understanding of this intermediate is likely to decrypt the arcane multi-domain nature of RBR E3 ligases for example.
[0222] E2Ub Probes Label Parkin in an Activity-Dependent Manner
[0223] To validate our probes we profiled recombinant Parkin with probes 9 and 10. Since phosphorylation of Parkin and Ub have been demonstrated to maximally activate Parkin.sup.26,21, we initially carried out experiments using Ser65-phosphorylated Parkin (-Parkin) in the presence of Ser65-phosphorlyated-Ub (p-Ub). -Parkin and p-Ub were prepared byincubation of Parkin and Ub with PINK1 and ATP and were purified by gel-filtration chromatography.sup.27. Phosphorylation of Ub was quantitative whilst phosphorylation of Parkin was 60%, as determined by LC-MS and Phostag SDS-PAGE. We tested the thioacrylate and thioacrylamide electrophiles by observing the labelling efficiency of 9 and 10 against -Parkin/p-Ub. Probe-treated samples were resolved by SDS-PAGE and then visualized by coomassie staining and immunoblotting against the Hisx6 purification/reporter tag on 9 and 10. This revealed that Parkin was labelled by both probes with 10 being moderately more efficient than 9 (
[0224] We next confirmed that our probes were labelling the catalytic C431 residue in Parkin. We initially generated phosphorylated Cys431Ser (C431S) mutant Parkin (-Parkin C431S) that was 40% phosphorylated. Parallel profiling of -Parkin WT and -Parkin C431S, and tryptic MS/MS sequencing of the cross-linked peptide, confirmed probe labelling of C431 (
[0225] To further confirm that labelling was consistent with Parkin E3 ligase activity we carried out post-probe labelling of Parkin ubiquitination assays that provided three independent readouts of Parkin activity (
[0226] We next tested whether probes 9 and 10 also labelled DUBs or if they were susceptible to DUB-mediated hydrolytic degradation, both of which would restrict the utility of the probes. We found that that whilst the DUB ABP propargylated-Ub (Ub-Alk) 51,52 efficiently labelled DUBs from 3 different subfamilies (USP, OTU and UCH), probes 9 and 10 exhibited no labelling, nor where they degraded by DUB isopeptidase activity.
[0227] p-Ub and -Parkin are Strictly Required for Parkin Transthiolation Activity
[0228] To gain a further understanding of the critical determinants of Parkin activity we next carried out a more comprehensive profiling experiment using probe 9 and combinations of Parkin and -Parkin together with Ub and p-Ub. We also included the first generation UBE2L3-VME probe 36 to assess the role of the Ub component in E2Ub for adopting a cysteine-cysteine juxtaposition Parkin. Interestingly, detectable labelling was only observed with 9 and -Parkin in the presence of p-Ub suggesting that both phosphorylation events are critical for optimal Parkin transthiolation activity (
[0229] However, UBE2L3-VME did not undergo labelling of -Parkin/p-Ub (
[0230] Rapid Profiling of Parkin Disease Mutants Affect Parkin Transthiolation Activity
[0231] As direct, rapid and quantitative profiling of Parkin transthiolation activity could be carried out with fluorescent probe 11, we next profiled a panel of recombinant Parkin disease mutants (K27N, R33Q, R42P, A46P, S65A, K161N, K211N, R275W, G328E, T415N, G430D and C431 F) in parallel, with the non-phosphorylatable S65A mutant, that had been treated with WT Pediculus humanus corporis PINK1 (PhPINK1) in the presence of Ub, to assess activity (
[0232] Determinants of Parkin Activity in the Context of PINK1-Parkin Signalling in Cells
[0233] We next profiled the activity of Parkin using probe 9 in cells by analysing untagged Parkin WT, Parkin S65A and Parkin H302A stably expressing HeLa cells. The H302A mutation significantly impairs p-Ub binding 25,26,54 therefore in combination with S65A, the effects of Ub and Parkin phosphorylation in the context of PINK1-Parkin signalling could be assessed by probe profiling of cell extracts. HeLa cells were chosen as they contain undetectable levels of endogenous Parkin yet support activation of exogenous Parkin in response to mitochondrial depolarization.sup.39. We treated HeLa cells expressing the various forms of Parkin with CCCP for 3 h, in parallel with untreated cells, and then extracted cellular proteomes by mild lysis by sonication. Extracts where then profiled with probe 9 (5 M) for 4 h and were then resolved by SDS-PAGE and immunoblotted against total Parkin and -SerS65-Parkin specific antibodies (
[0234] Profiling of Endogenous Parkin Activity in Dopaminergic SH-SY5Y Cellular Proteomes
[0235] To date the majority of studies in cells examining Parkin activation in response to mitochondrial depolarisation have employed over-expression studies 29,30,55 (often with N-terminal tagging that can aberrantly activate Parkin) and studies on endogenous Parkin have been limited. We therefore used probe 9 to detect the activation status of endogenous Parkin in response to mitochondrial uncoupling in dopaminergic neuroblastoma SH-SY5Y cells. Cells were untreated or treated with CCCP (10 M) for 3, 6 and 9 h and then lysed. Profiling was then carried out with the inclusion of inactive probe 9 F63A as a further control.
[0236] Probe labelling and phosphorylation was undetectable in untreated cells (
[0237] Discussion
[0238] Herein we have reported the construction of a new class of activity-based probe (ABP) that can be used to profile the activity of the PD-linked enzyme Parkin in vitro and in cellular proteomes. In vitro profiling experiments of recombinant Parkin demonstrates that phosphorylation of Parkin and Ub contribute to optimal transthiolation activity. This result suggests that p-Ub binding to Parkin in cells primes it for optimal phosphorylation and activation by PINK1. p-Ub then continues to drive optimal activity of -Parkin activity ensuring p-Ub levels are continuously sensed.
[0239] We also described the construction of fluorescent probe 11. This provides a rapid platform for profiling ligase activity by direct in-gel fluorescence scanning revealing a distinct transthiolation activity signature of Parkin patient mutations. Strikingly, this revealed that all mutations exert their pathogenicity by altering transthiolation activity. Probe profiling of endogenous Parkin in familial and sporadic patient samples could hence provide a much needed biomarker for early diagnosis and prognosis of PD.
[0240] We also showed that our probes can be used to profile the activation status of endogenous Parkin in neuronal SH-SYSY cells. These data clearly demonstrated that endogenous Parkin is phosphorylated and 50% is activated in response to protonophore treatment, whereas activation of the phosphorylated pool approaches 100% Furthermore, time course profiling demonstrated that Parkin levels and probe signals reduce after activation, suggestive of Parkin clearance in the activated state. To our knowledge our analysis also represents the first report that Parkin can be phosphorylated at Ser65 under endogenous conditions providing physiological evidence for Parkin phosphorylation at Ser65.
[0241] A large body of powerful experimental platforms have been developed that are based on fluorescent ABPs. These include in-gel based multiplexed profiling of endogenous enzyme activities in cellular proteomes, inhibitor screening and inhibitor selectivity profiling.sup.37. Fluorescent probe 11 should be valuable tool for discovering small molecules that activate the transthiolation activity of Parkin. In principle, high affinity enrichment tags such as azide-functionalized biotin could also be conjugated to our probes allowing multiplexed profiling in combination with E3 ligase activity quantification and identification. As E3 ligase activities are stringently regulated and dysregulated in pathophysiology, we envisage that such ABPP platforms based on our probes will provide great insight into the roles of other E3 ligases in disease. This could lead to novel biomarkers, therapeutic targets and as drivers for further biological investigation.
REFERENCES
[0242] 25 Smit, J. J. & Sixma, T. K. RBR E3-ligases at work. EMBO Rep 15, 142-154, doi: 10.1002/embr.201338166 (2014).
[0243] 26 Pickrell, A. M. & Youle, R. J. The roles of PINK1, parkin, and mitochondrial fidelity in Parkinson's disease. Neuron 85, 257-273, doi:10.1016/j.neuron.2014.12.007 (2015).
[0244] 27 Kazlauskaite, A. et al. Parkin is activated by PINK1-dependent phosphorylation of ubiquitin at Ser65. The Biochemical journal 460, 127-139, doi:10.1042/BJ20140334 (2014).
[0245] 28 Wauer, T., Simicek, M., Schubert, A. & Komander, D. Mechanism of phospho-ubiquitin-induced PARKIN activation. Nature, doi: 10.1038/nature14879 (2015).
[0246] 29 Stanley, M. et al. Orthogonal Thiol Functionalization at a Single Atomic Center for Profiling Transthiolation Activity of E1 Activating Enzymes. ACS chemical biology, doi: 10.1021/acschembio.5b00118 (2015).
[0247] 30 Ye, Y. & Rape, M. Building ubiquitin chains: E2 enzymes at work. Nat Rev Mol Cell Biol 10, 755-764, doi:10.1038/nrm2780 (2009).
[0248] 31 Komander, D., Clague, M. J. & Urb, S. Breaking the chains: structure and function of the deubiquitinases. Nat Rev Mol Cell Biol 10, 550-563, doi:10.1038/nrm2731 (2009).
[0249] 32 Hong, V., Presolski, S. I., Ma, C. & Finn, M. G. Analysis and optimization of copper-catalyzed azide-alkyne cycloaddition for bioconjugation. Angew Chem Int Ed Engl 48, 9879-9883, doi:10.100/anie.200905087 (2009).
[0250] 33 Borodovsky, A. et al. Chemistry-based functional proteomics reveals novel members of the deubiquitinating enzyme family. Chemistry and biology 9, 1149-1159 (2002).
[0251] 34 Dadov, J. et al. Vinylsulfonamide and acrylamide modification of DNA for cross-linking with proteins. Angew Chem Int Ed Engl 52, 10515-10518, doi:10.1002/anie.201303577 (2013).
[0252] 35 Katrun, P. & Chiampanichayakul, S. PhI(OAc)2/KI-Mediated Reaction of Aryl Sulfinates with Alkenes, Alkynes, and ,-Unsaturated Carbonyl Compounds: Synthesis of Vinyl Sulfones and -lodovinyl Sulfones. Eur J Org Chem, 5633-5641, (2010).
[0253] 36 Cui, C., Zhao, W., Chen, J., Wang, J. & Li, Q. Elimination of in vivo cleavage between target protein and intein in the intein-mediated protein purification systems. Protein expression and purification 50, 74-81, doi: 10.1016/j.pep.2006.05.019 (2006).
[0254] 37 Niphakis, M. J. & Cravatt, B. F. Enzyme inhibitor discovery by activity-based protein profiling. Annu Rev Biochem 83, 341-377, doi:10.1146/annurev-biochem-060713-035708 (2014).
[0255] 38 Weissman, A. M. Themes and variations on ubiquitylation. Nat Rev Mol Cell Biol 2, 169-178, doi: 10.1038/35056563 (2001).
[0256] 39 Lazarou, M. et al. The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy. Nature, doi: 10.1038/nature14893 (2015).