PISUM SATIVUM KAURENE OXIDASE FOR HIGH EFFICIENCY PRODUCTION OF REBAUDIOSIDES

20200165651 ยท 2020-05-28

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided herein are compositions and methods for improved production of steviol glycosides in a host cell. In some embodiments, the host cell is genetically modified to comprise a heterologous nucleotide sequence encoding a Pisum sativum kaurene oxidase or its variant kaurene oxidase. In some embodiments, the host cell further comprises one or more heterologous nucleotide sequence encoding further enzymes of a pathway capable of producing steviol glycosides in the host cell. The compositions and methods described herein provide an efficient route for the heterologous production of steviol glycosides, including but not limited to, rebaudioside D and rebaudioside M.

    Claims

    1. A genetically modified Saccharomyces cerevisiae host cell capable of producing one or more steviol glycosides comprising a heterologous nucleic acid encoding a kaurene oxidase comprising an amino acid sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 1.

    2. The genetically modified Saccharomyces cerevisiae host cell of claim 1 that is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 35%, 40%, 45%, 50%, or 55%.

    3. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the kaurene oxidase comprises an amino acid sequence having the sequence of SEQ ID NO:1.

    4. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the kaurene oxidase is capable of oxidation of the C19 position of kaurene, kaurenol, and/or kaurenal.

    5. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the kaurene oxidase is encoded by a heterologous nucleic acid, wherein the heterologous nucleic acid comprises a nucleotide sequence having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO:15.

    6. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the kaurene oxidase is encoded by a heterologous nucleic acid having the sequence of SEQ ID NO:15.

    7. The genetically modified Saccharomyces cerevisiae host cell of claim 1, that is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 35%, 40%, 45%, 50%, or 55%, and wherein the kaurene oxidase comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO:1.

    8. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the kaurene oxidase is a polypeptide having a functional domain with at least 80%, 85%, 90%, or 95% sequence identity to a functional domain of SEQ ID NO:1.

    9. The genetically modified Saccharomyces cerevisiae host cell of claim 1 that is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 55%.

    10. The genetically modified Saccharomyces cerevisiae host cell of claim 1 that is capable of producing kaurenoic acid, steviol, RebD, and/or RebM.

    11-13. (canceled)

    14. The genetically modified Saccharomyces cerevisiae host cell of claim 1 that is capable of producing 4 RebM and RebM2 at a ratio of at least 10:1, 100:1, or 1000:1.

    15. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the genetically modified host cell produces an undetectable level of RebM2.

    16. The genetically modified Saccharomyces cerevisiae host cell of claim 1, wherein the genetically modified host cell further comprises one or more heterologous nucleic acids encoding one or more enzymes of a pathway for making steviol, a steviol glycoside, RebA, RebM, RebD, and/or RebE.

    17-20. (canceled)

    21. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more enzymes of the pathway comprise a geranylgeranyl diphosphate synthase, copalyl diphosphate synthase, ent-kaurene synthase, kaurenoic acid hydroxylase, cytochrome P450 reductase, and one or more uridine 5-diphosphate-dependent glycosyltransferases.

    22-26. (canceled)

    27. The genetically modified Saccharomyces cerevisiae host cell of claim 16 wherein the one or more enzymes of the pathway comprise Os_UGT_91C1, Sl_UGT_101249881, UGT40087, sr.UGT_9252778, Bd_UGT10840, Hv_UGT_V1, Bd_UGT10850, or Ob_UGT91B1_like.

    28. The genetically modified Saccharomyces cerevisiae host cell of claim 16 wherein the one or more enzymes of the pathway comprise UGT74G1, UGT76G1, UGT85C2, UGT91D, or UGT40087 or its variant.

    29. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more enzymes of the pathway comprise a geranylgeranyl diphosphate synthase, a copalyl diphosphate synthase, a ent-kaurene synthase, a kaurene oxidase, a kaurenoic acid hydroxylase, a cytochrome P450 reductase, a UGTAD, UGT74G1, UGT76G1, UGT85C2, and UGT91D.

    30. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more enzymes of the pathway comprise a geranylgeranyl diphosphate synthase, a copalyl diphosphate synthase, a ent-kaurene synthase, a kaurene oxidase, a kaurenoic acid hydroxylase, a cytochrome P450 reductase, UGT40087 or a variant thereof, UGT74G1, UGT76G1, UGT85C2, and UGT91D.

    31. The genetically modified Saccharomyces cerevisiae host cell of claim 30, wherein the UGT40087 or a variant thereof is according to SEQ ID NO:17, 18, or 33.

    32. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more enzymes of the pathway comprises a bifunctional copalyl diphosphate synthase and kaurene synthase.

    33. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more heterologous nucleic acids encoding one or more enzymes of the pathway are under control of a single transcriptional regulator.

    34. The genetically modified Saccharomyces cerevisiae host cell of claim 16, wherein the one or more heterologous nucleic acids encoding one or more enzymes of the pathway are under control of multiple heterologous transcriptional regulators.

    35-38. (canceled)

    39. A method for producing RebD comprising: (a) culturing a population of the genetically modified host cells of claim 1 in a medium with a carbon source under conditions suitable for making RebD; and (b) recovering said RebD from the medium.

    40. A method for producing RebM comprising: (a) culturing a population of the genetically modified host cells of claim 1 in a medium with a carbon source under conditions suitable for making RebM; and (b) recovering said RebM from the medium.

    41. (canceled)

    42. A fermentation composition comprising: (a) a genetically modified host cell comprising a heterologous nucleic acid encoding a kaurene oxidase having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO:1 and capable of converting kaurene to kaurenoic acid; and (b) steviol glycosides produced from the genetically modified host cell.

    43. The fermentation composition of claim 42, wherein the steviol glycosides comprise RebA, RebD and ReM at a ratio of RebA:RebD:RebM of at least 1:7:50.

    44. A non-naturally occurring kaurene oxidase having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO:1.

    45. A non-naturally occurring kaurene oxidase that is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 35%, 40%, 45%, 50%, or 55% in vivo.

    46. A non-naturally occurring nucleic acid encoding the non-naturally occurring kaurene oxidase of claim 44 or 45.

    47. A method for producing a steviol glycoside comprising culturing a population of the genetically modified host cells of claim 1 in a medium with a carbon source under conditions suitable for making a steviol glycoside.

    Description

    5. BRIEF DESCRIPTION OF THE FIGURES

    [0017] FIG. 1A provides a schematic representation of the conversion of farnesyl pyrophosphate to steviol.

    [0018] FIG. 1B provides a schematic representation of the conversion of geranyl geranyl pyrophosphate (GGPP) to RebM.

    [0019] FIG. 1C provides a schematic representation of the conversion of ent-kaurene to kaurenol to kaurenal to kaurenoic acid.

    [0020] FIG. 1D provides a schematic diagram of the mevalonate pathway.

    [0021] FIG. 2 provides an exemplary pathway of steviol to RebM.

    [0022] FIG. 3A provides a schematic diagram of landing pad design used to insert individual KO enzymes for screening for kaurenoic acid production in yeast.

    [0023] FIG. 3B provides a schematic diagram of a KO genetic construct for screening for kaurenoic acid production conversion in yeast.

    [0024] FIG. 4 provides a chart illustrating the relative increase of kaurenoic acid produced in vivo with different kaurene oxidases.

    [0025] FIG. 5 provides a bar chart illustrating the relative levels of ent-kaurene, karuenol, and karuenal, normalized to the total amount of kaurenoic acid produced in vivo in a yeast strain with high flux to RebM.

    [0026] FIG. 6 provides a chart illustrating the relative levels of RebM titers in high flux strains containing either Sr.KO or Ps.KO.

    6. DETAILED DESCRIPTION OF THE EMBODIMENTS

    6.1 Terminology

    [0027] As used herein, the term heterologous refers to what is not normally found in nature. The term heterologous nucleotide sequence refers to a nucleotide sequence not normally found in a given cell in nature. As such, a heterologous nucleotide sequence may be: (a) foreign to its host cell (i.e., is exogenous to the cell); (b) naturally found in the host cell (i.e., endogenous) but present at an unnatural quantity in the cell (i.e., greater or lesser quantity than naturally found in the host cell); or (c) be naturally found in the host cell but positioned outside of its natural locus. The term heterologous enzyme refers to an enzyme that is not normally found in a given cell in nature. The term encompasses an enzyme that is: (a) exogenous to a given cell (i.e., encoded by a nucleotide sequence that is not naturally present in the host cell or not naturally present in a given context in the host cell); and (b) naturally found in the host cell (e.g., the enzyme is encoded by a nucleotide sequence that is endogenous to the cell) but that is produced in an unnatural amount (e.g., greater or lesser than that naturally found) in the host cell.

    [0028] On the other hand, the term native or endogenous as used herein with reference to molecules, and in particular enzymes and nucleic acids, indicates molecules that are expressed in the organism in which they originated or are found in nature, independently of the level of expression that can be lower, equal, or higher than the level of expression of the molecule in the native microorganism. It is understood that expression of native enzymes or polynucleotides may be modified in recombinant microorganisms.

    [0029] As used herein, the term parent cell refers to a cell that has an identical genetic background as a genetically modified host cell disclosed herein except that it does not comprise one or more particular genetic modifications engineered into the modified host cell, for example, one or more modifications selected from the group consisting of: heterologous expression of an enzyme of a steviol pathway, heterologous expression of an enzyme of a steviol glycoside pathway, heterologous expression of a geranylgeranyl diphosphate synthase, heterologous expression of a copalyl diphosphate synthase, heterologous expression of a kaurene synthase, heterologous expression of a kaurene oxidase (e.g., Pisum sativum kaurene oxidase), heterologous expression of a steviol synthase (kaurenic acid hydroxylase), heterologous expression of a cytochrome P450 reductase, heterologous expression of a UGT74G1, heterologous expression of a UGT76G1, heterologous expression of a UGT85C2, heterologous expression of 91D, and heterologous expression of a UGT40087 or its variant.

    [0030] As used herein, the term naturally occurring refers to what is found in nature. For example, a kaurene oxidase that is present in an organism that can be isolated from a source in nature and that has not been intentionally modified by a human in the laboratory is naturally occurring kaurene oxidase. Conversely, as used herein, the term non-naturally occurring refers to what is not found in nature but is created by human intervention.

    [0031] The term medium refers to a culture medium and/or fermentation medium.

    [0032] The term fermentation composition refers to a composition which comprises genetically modified host cells and products or metabolites produced by the genetically modified host cells. An example of a fermentation composition is a whole cell broth, which can be the entire contents of a vessel (e.g., a flasks, plate, or fermentor), including cells, aqueous phase, and compounds produced from the genetically modified host cells.

    [0033] As used herein, the term production generally refers to an amount of steviol or steviol glycoside produced by a genetically modified host cell provided herein. In some embodiments, production is expressed as a yield of steviol or steviol glycoside by the host cell. In other embodiments, production is expressed as a productivity of the host cell in producing the steviol or steviol glycoside.

    [0034] As used herein, the term productivity refers to production of a steviol or steviol glycoside by a host cell, expressed as the amount of steviol or steviol glycoside produced (by weight) per amount of fermentation broth in which the host cell is cultured (by volume) over time (per hour).

    [0035] As used herein, the term yield refers to production of a steviol or steviol glycoside by a host cell, expressed as the amount of steviol or steviol glycoside produced per amount of carbon source consumed by the host cell, by weight.

    [0036] As used herein, the term an undetectable level of a compound (e.g., RebM2, steviol glycosides, or other compounds) means a level of a compound that is too low to be measured and/or analyzed by a standard technique for measuring the compound. For instance, the term includes the level of a compound that is not detectable by the analytical methods described in Example 6.

    [0037] The term kaurene refers to the compound kaurene, including any stereoisomer of kaurene. In particular embodiments, the term refers to the enantiomer known in the art as ent-kaurene. In particular embodiments, the term refers to the compound according to the following structure:

    ##STR00001##

    [0038] The term kaurenol refers to the compound kaurenol, including any stereoisomer of kaurenol. In particular embodiments, the term refers to the enantiomer known in the art as ent-kaurenol. In particular embodiments, the term refers to the compound according to the following structure.

    ##STR00002##

    [0039] The term kaurenal refers to the compound kaurenal, including any stereoisomer of kaurenal. In particular embodiments, the term refers to the enantiomer known in the art as ent-kaurenal. In particular embodiments, the term refers to the compound according to the following structure.

    ##STR00003##

    [0040] The term kaurenoic acid refers to the compound kaurenoic acid, including any stereoisomer of kaurenoic acid. In particular embodiments, the term refers to the enantiomer known in the art as ent-kaurenoic acid. In particular embodiments, the term refers to the compound according to the following structure.

    ##STR00004##

    [0041] As used herein, the term steviol glycoside(s) refers to a glycoside of steviol, including, but not limited to, naturally occurring steviol glycosides, e.g. steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside M, rebaudioside D, rebaudioside N, rebaudioside 0, synthetic steviol glycosides, e.g. enzymatically glucosylated steviol glycosides and combinations thereof.

    [0042] As used herein, the term variant refers to a polypeptide differing from a specifically recited reference polypeptide (e.g., a wild-type sequence) by amino acid insertions, deletions, mutations, and/or substitutions, but retains an activity that is substantially similar to the reference polypeptide. In some embodiments, the variant is created by recombinant DNA techniques, such as mutagenesis. In some embodiments, a variant polypeptide differs from its reference polypeptide by the substitution of one basic residue for another (i.e. Arg for Lys), the substitution of one hydrophobic residue for another (i.e. Leu for Ile), or the substitution of one aromatic residue for another (i.e. Phe for Tyr), etc. In some embodiments, variants include analogs wherein conservative substitutions resulting in a substantial structural analogy of the reference sequence are obtained. Examples of such conservative substitutions, without limitation, include glutamic acid for aspartic acid and vice-versa; glutamine for asparagine and vice-versa; serine for threonine and vice-versa; lysine for arginine and vice-versa; or any of isoleucine, valine or leucine for each other.

    [0043] As used herein, the term sequence identity or percent identity, in the context or two or more nucleic acid or protein sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same. For example, the sequence can have a percent identity of at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91% at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or higher identity over a specified region to a reference sequence when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithm or by manual alignment and visual inspection. For example, percent of identity is determined by calculating the ratio of the number of identical nucleotides (or amino acid residues) in the sequence divided by the length of the total nucleotides (or amino acid residues) minus the lengths of any gaps.

    [0044] For convenience, the extent of identity between two sequences can be ascertained using computer program and mathematical algorithms known in the art. Such algorithms that calculate percent sequence identity generally account for sequence gaps and mismatches over the comparison region. Programs that compare and align sequences, like Clustal W (Thompson et al., (1994) Nucleic Acids Res., 22: 4673-4680), ALIGN (Myers et al., (1988) CABIOS, 4: 11-17), FASTA (Pearson et al., (1988) PNAS, 85:2444-2448; Pearson (1990), Methods Enzymol., 183: 63-98) and gapped BLAST (Altschul et al., (1997) Nucleic Acids Res., 25: 3389-3402) are useful for this purpose. The BLAST or BLAST 2.0 (Altschul et al., J. Mol. Biol. 215:403-10, 1990) is available from several sources, including the National Center for Biological Information (NCBI) and on the Internet, for use in connection with the sequence analysis programs BLASTP, BLASTN, BLASTX, TBLASTN, and TBLASTX. Additional information can be found at the NCBI web site.

    [0045] In certain embodiments, the sequence alignments and percent identity calculations can be determined using the BLAST program using its standard, default parameters. For nucleotide sequence alignment and sequence identity calculations, the BLASTN program is used with its default parameters (Gap opening penalty=5, Gap extension penalty=2, Nucleic match=2, Nucleic mismatch=3, Expectation value=10.0, Word size=11, Max matches in a query range=0). For polypeptide sequence alignment and sequence identity calculations, BLASTP program is used with its default parameters (Alignment matrix=BLOSUM62; Gap costs: Existence=11, Extension=1; Compositional adjustments=Conditional compositional score, matrix adjustment; Expectation value=10.0; Word size=6; Max matches in a query range=0. Alternatively, the following program and parameters are used: Align Plus software of Clone Manager Suite, version 5 (Sci-Ed Software); DNA comparison: Global comparison, Standard Linear Scoring matrix, Mismatch penalty=2, Open gap penalty=4, Extend gap penalty=1. Amino acid comparison: Global comparison, BLOSUM 62 Scoring matrix. In the embodiments described herein, the sequence identity is calculated using BLASTN or BLASTP programs using their default parameters. In the embodiments described herein, the sequence alignment of two or more sequences are performed using Clustal W using the suggested default parameters (Dealign input sequences: no; Mbed-like clustering guide-tree: yes; Mbed-like clustering iteration: yes; number of combined iterations: default(0); Max guide tree iterations: default; Max HMM iterations: default; Order: input).

    6.2 Host Cells

    [0046] Provided herein are host cells capable of producing kaurenoic acid (KA) from kaurene at high efficiency. In certain embodiments, the host cells can produce kaurenoic acid from kaurene as a starting material. In particular embodiments, the host cells can produce kaurenoic acid from a carbon source in a culture medium. In particular embodiments, the host cells can produce kaurenoic acid from a carbon source in a culture medium and can further produce RebA or RebD from the kaurenoic acid. In particular embodiments, the host cells can further produce rebaudioside M (RebM) from the RebD.

    [0047] In particular embodiments, the host cells comprise the enzyme activity of Pisum sativum kaurene oxidase. A Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at high efficiency. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 35%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 40%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 95%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 50%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 55%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of about 58%. In certain embodiments, a Pisum sativum kaurene oxidase enzyme is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%.

    [0048] In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 35%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 40%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 45%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 50%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 55%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of about 58%. In certain embodiments, the host cell is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%.

    [0049] Efficiency of conversion can be measured by any technique apparent to those of skill in the art. In certain embodiments, efficiency of conversion can be measured by contacting kaurene with an enzyme or host cell under suitable conditions for forming kaurenoic acid. Efficiency can be measured by comparing the molar amount of kaurenoic acid produced compared to the total amount of kaurene and kaurenoic acid in the resulting composition. Efficiency can also be measured by comparing the total amount of kaurenoic acid and downstream products of kaurenoic acid to the total amount of kaurene, kaurenol, kaurenal, kaurenoic acid, and downstream products of kaurenoic acid in the resulting composition. For instance, the conversion efficiencies of strains comprising Ps.KO shown in FIG. 5 was measured by comparing the total amount of kaurenoic acid and all the downstream compounds shown in FIG. 2 to the total amount of kaurene, kaurenol, kaurenal, kaurenoic acid, and all the downstream compounds shown in FIG. 2 in the resulting composition (i.e., steviol, 1 glucose+steviol, 2 glucose+steviol, 3 glucose+steviol, 4 glucose+steviol, 5 glucose+steviol, and 6 glucose+steviol).

    [0050] In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence substantially identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence that is at least 60%, at least 99%, or at least any percentage between 60% and 99% identical to the amino acid sequence of SEQ ID NO:1.

    [0051] In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence described herein, and is capable of converting kaurene to kaurenoic acid. In certain embodiments, provided herein are host cells comprising a kaurene oxidase comprising an amino acid sequence described herein, and is capable of oxidation of the 19 position of each of kaurene, kaurenol, and kaurenal. In certain embodiments, provided herein are host cells comprising a kaurene oxidase capable of converting kaurene to kaurenoic acid at an efficiency greater than 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, or 97%, and wherein the kaurene oxidase comprises an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO:1.

    [0052] In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a Pisum sativum kaurene oxidase comprising the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence substantially identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of SEQ ID NO:1. In certain embodiments, provided herein are host cells comprising a nuclei acid encoding a polypeptide comprising an amino acid sequence that is at least 60%, at least 99%, or any percentage between 60% and 99%.

    [0053] In certain embodiments, provided herein are host cells comprising a heterologous nucleic acid comprising a nucleotide sequence of SEQ ID NO:14 which encodes Pisum sativum kaurene oxidase having the sequence of SEQ ID NO:1. In certain embodiments, provided here are host cells comprising a heterologous nucleic acid comprising a nucleotide sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to the nucleotide sequence of SEQ ID NO:14.

    [0054] In certain embodiments, the host cell comprises a variant of the Pisum sativum kaurene oxidase polypeptide described above. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions relative to the Pisum sativum kaurene oxidase polypeptide. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative amino acid substitutions relative to the Pisum sativum kaurene oxidase polypeptide. In certain embodiments, any of the nucleic acids described herein can be optimized for the host cell, for instance, by codon optimization.

    [0055] In embodiments described herein, any suitable method can be used to determine corresponding amino acid positions or corresponding loop locations of two polypeptides. In certain embodiments, the sequences of a kaurene oxidase and the reference sequence SEQ ID NO:1 can be aligned using Clustal(W) using its default parameters. In other embodiment, the sequences of a kaurene oxidase and the reference sequence SEQ ID NO:1 can be aligned using structural alignments such as SWISS-MODEL, which is a protein structure homology-modelling server, accessible via the ExPASy web server, or from the program DeepView (Swiss Pdb-Viewer).

    [0056] In certain embodiments, kaurene is as shown in FIG. 1C. In certain embodiments, a Pisum sativum kaurene oxidase or a variant Pisum sativum kaurene oxidase is capable of catalyzing the oxidation of kaurene at C-19 to form kaurenol. In certain embodiments, the Pisum sativum kaurene oxidase or variant Pisum sativum kaurene oxidase is capable of catalyzing the oxidation of kaurenol at C-19 to form kaurenal. In certain embodiments, the Pisum sativum kaurene oxidase is capable of kaurene oxidase is capable of catalyzing the oxidation of kaurenal at C-19 to form kaurenoic acid. In particular embodiments, a Pisum sativum kaurene oxidase or a variant Pisum sativum kaurene oxidase is capable of catalyzing the oxidation of kaurene at C-19 to form kaurenol, the oxidation of kaurenol at C-19 to form kaurenal, and the oxidation of kaurenal at C-19 to form kaurenoic acid.

    [0057] In certain embodiments, RebD is as shown in FIG. 2. In certain embodiments, the host cell further comprises one or more enzymes capable of converting kaurenoic acid to steviol. In certain embodiments, the host cell further comprises one or more enzymes capable of converting steviol to one or more steviol glycosides. In certain embodiments, the host cell further comprises one or more enzymes capable of converting RebA to RebD. In certain embodiments, the host cell further comprises one or more enzymes capable of converting RebD to RebM.

    [0058] While the Pisum sativum kaurene oxidase or any variant Pisum sativum kaurene oxidase of the host cells accepts kaurene as a substrate, the source of kaurene can be any source deemed suitable to those of skill in the art. In certain embodiments, the Pisum sativum kaurene oxidase or any variant Pisum sativum kaurene oxidase can be contacted with kaurene. In certain embodiments, the host cell can be contacted with kaurene. In certain embodiments, the Pisum sativum kaurene oxidase or any variant of Pisum sativum kaurene oxidase can be contacted with a composition comprising one or more of kaurene, kaurenol, and kaurenal. In certain embodiments, the composition comprises kaurene. In certain embodiments, the composition comprises kaurenol. In certain embodiments, the composition comprises kaurenal. In certain embodiments, the composition is derived from natural products isolated from Stevia rebaudiana leaves. In certain embodiments, the composition is microbially derived. In certain embodiments, the host cell can be contacted with a composition comprising one or more carbon sources.

    [0059] In certain embodiments, any variant Pisum sativum kaurene oxidase suitable for catalyzing a desired reaction can be screened for any suitable methods known in the art. For example, a suitable variant Pisum sativum kaurene oxidase can be assayed in vivo by expressing a heterologous nucleic acid encoding a variant Pisum sativum kaurene oxidase and screening cells that produce functional variant Pisum sativum kaurene oxidase capable of catalyzing oxidation at a desired location of a substrate (e.g., C-19 position of kaurene, kaurenol, and/or kaurenal). Exemplary screening methods are described in the Examples below. In another example, a suitable variant Pisum sativum kaurene oxidase can be screened in vitro by contacting a variant Pisum sativum kaurene oxidase with a substrate such as kaurene, kaurenol, and/or kaurenal. In this example, assaying the presence of kaurenoic acid, steviol, or a steviol glycoside such as RebD can be used as a test to determine whether a variant Pisum sativum kaurene oxidase is a suitable enzyme. The reaction can be analyzed by LC-MS or other known methods in the art. See, e.g. WO 2013/022989.

    [0060] In certain embodiments, a variant Pisum sativum kaurene oxidase is considered suitable in converting kaurene to kaurenoic acid if it is capable of converting kaurene to kaurenoic acid at an efficiency of greater than 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, or 97% in vivo.

    [0061] In certain embodiments, a variant Pisum sativum kaurene oxidase is considered suitable in converting kaurene to kaurenol if it is capable of converting kaurene to kaurenol acid at an efficiency of greater than 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, or 97% in vivo.

    [0062] In certain embodiments, a variant Pisum sativum kaurene oxidase is considered suitable in converting kaurenol to kaurenal if it is capable of converting kaurenol to kaurenal at an efficiency of greater than 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, or 97% in vivo.

    [0063] In certain embodiments, a variant Pisum sativum kaurene oxidase is considered suitable in converting kaurenal to kaurenoic acid if it is capable of converting kaurenal to kaurenoic acid at an efficiency of greater than 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, or 97% in vivo.

    [0064] In certain embodiments, a variant Pisum sativum kaurene oxidase is considered suitable in converting kaurene to kaurenoic acid if the conversion efficiency is greater than 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, or 97% in vivo, wherein the conversion efficiency is calculated by the total amount of kaurenoic acid and all the downstream compounds shown in FIG. 2 divided by the total amount of kaurene, kaurenol, kaurenal, kaurenoic acid, and all the downstream compounds shown in FIG. 2 in the resulting composition (times 100 percent).

    [0065] In advantageous embodiments, the host cell can comprise one or more enzymatic pathways capable of making kaurene, said pathways taken individually or together. In certain embodiments, the host cells comprise one or more enzymes capable of converting geranylgeranyl diphosphate to kaurene. Useful enzymes and nucleic acids encoding the enzymes are known to those of skill. In certain embodiments, the host cells comprise one or more enzymes capable of converting geranylgeranyl diphosphate to kaurene. In further advantageous embodiments, the host cell can comprise one or more enzymatic pathways capable of converting kaurenoic acid to steviol and/or to steviol glycosides, said pathways taken individually or together. Useful enzymes and nucleic acids encoding the enzymes are known to those of skill. Particularly useful enzymes and nucleic acids are described in the sections below and further described, for example, in US 2014/0329281 A1, US 2014/0357588 A1, US 2015/0159188, WO 2016/038095 A2, and US 2016/0198748 A1.

    [0066] In further embodiments, the host cells further comprise one or more enzymes capable of making geranylgeranyl diphosphate from a carbon source. These include enzymes of the DXP pathway and enzymes of the MEV pathway. Useful enzymes and nucleic acids encoding the enzymes are known to those of skill in the art. Exemplary enzymes of each pathway are described below and further described, for example, in US 2016/0177341 A1. The MEV pathway is also shown in FIG. 1D.

    [0067] In certain embodiments, the additional enzymes are native. In advantageous embodiments, the additional enzymes are heterologous. In certain embodiments, two enzymes can be combined in one polypeptide.

    6.3 Non-Naturally Occurring Kaurene Oxidase Polypeptides and Nucleic Acids

    [0068] In another aspect, provided herein are non-naturally occurring, variant kaurene oxidases which include modification(s) of amino acid residues compared to a reference sequence (e.g., SEQ ID NO:1) and yet still retains the activity as a kaurene oxidase to convert kaurene to kaurenoic acid, kaurene to kaurenol, kaurenol to kaurenal, and/or kaurenal to kaurenoic acid. In certain embodiments, non-naturally occurring, variant kaurene oxidases can include up to 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions, deletions, additions, and/or insertions at certain amino acid positions or locations compared to a reference sequence (e.g., SEQ ID NO:1). In certain embodiments, non-naturally occurring, variant kaurene oxidases comprise any of the variant kaurene oxidases described herein.

    [0069] In another aspect, provided herein are non-naturally occurring, variant kaurene oxidases which include modification(s) of nucleic acid residues compared to a reference sequence (e.g., SEQ ID NO:15), and yet, when translated into a protein, the protein retains the activity as a kaurene oxidase to convert kaurene to kaurenoic acid, kaurene to kaurenol, kaurenol to kaurenal, and/or kaurenal to kaurenoic acid. In certain embodiments, non-naturally occurring, variant kaurene oxidases can encode any of the variant kaurene oxidases described herein.

    6.4 Cell Strains

    [0070] Host cells useful compositions and methods provided herein include archae, prokaryotic, or eukaryotic cells.

    [0071] Suitable prokaryotic hosts include, but are not limited, to any of a variety of gram-positive, gram-negative, or gram-variable bacteria. Examples include, but are not limited to, cells belonging to the genera: Agrobacterium, Alicyclobacillus, Anabaena, Anacystis, Arthrobacter, Azobacter, Bacillus, Brevibacterium, Chromatium, Clostridium, Corynebacterium, Enterobacter, Erwinia, Escherichia, Lactobacillus, Lactococcus, Mesorhizobium, Methylobacterium, Microbacterium, Phormidium, Pseudomonas, Rhodobacter, Rhodopseudomonas, Rhodospirillum, Rhodococcus, Salmonella, Scenedesmun, Serratia, Shigella, Staphylococcus, Strepromyces, Synnecoccus, and Zymomonas. Examples of prokaryotic strains include, but are not limited to: Bacillus subtilis, Bacillus amyloliquefacines, Brevibacterium ammoniagenes, Brevibacterium immariophilum, Clostridium beigerinckii, Enterobacter sakazakii, Escherichia coli, Lactococcus lactis, Mesorhizobium loti, Pseudomonas aeruginosa, Pseudomonas mevalonii, Pseudomonas pudica, Rhodobacter capsulatus, Rhodobacter sphaeroides, Rhodospirillum rubrum, Salmonella enterica, Salmonella typhi, Salmonella typhimurium, Shigella dysenteriae, Shigella flexneri, Shigella sonnei, and Staphylococcus aureus. In a particular embodiment, the host cell is an Escherichia coli cell.

    [0072] Suitable archae hosts include, but are not limited to, cells belonging to the genera: Aeropyrum, Archaeglobus, Halobacterium, Methanococcus, Methanobacterium, Pyrococcus, Sulfolobus, and Thermoplasma. Examples of archae strains include, but are not limited to: Archaeoglobus fulgidus, Halobacterium sp Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Thermoplasma acidophilum, Thermoplasma volcanium, Pyrococcus horikoshii, Pyrococcus abyssi, and Aeropyrum pernix.

    [0073] Suitable eukaryotic hosts include, but are not limited to, fungal cells, algal cells, insect cells, and plant cells. In some embodiments, yeasts useful in the present methods include yeasts that have been deposited with microorganism depositories (e.g. IFO, ATCC, etc.) and belong to the genera Aciculoconidium, Ambrosiozyma, Arthroascus, Arxiozyma, Ashbya, Babjevia, Bensingtonia, Botryoascus, Botryozyma, Brettanomyces, Bullera, Bulleromyces, Candida, Citeromyces, Clavispora, Cryptococcus, Cystofilobasidium, Debaryomyces, Dekkara, Dipodascopsis, Dipodascus, Eeniella, Endomycopsella, Eremascus, Eremothecium, Erythrobasidium, Fellomyces, Filobasidium, Galactomyces, Geotrichum, Guilliermondella, Hanseniaspora, Hansenula, Hasegawaea, Holtermannia, Hormoascus, Hyphopichia, Issatchenkia, Kloeckera, Kloeckeraspora, Kluyveromyces, Kondoa, Kuraishia, Kurtzmanomyces, Leucosporidium, Lipomyces, Lodderomyces, Malassezia, Metschnikowia, Mrakia, Myxozyma, Nadsonia, Nakazawaea, Nematospora, Ogataea, Oosporidium, Pachysolen, Phachytichospora, Phaffia, Pichia, Rhodosporidium, Rhodotorula, Saccharomyces, Saccharomycodes, Saccharomycopsis, Saitoella, Sakaguchia, Saturnospora, Schizoblastosporion, Schizosaccharomyces, Schwanniomyces, Sporidiobolus, Sporobolomyces, Sporopachydermia, Stephanoascus, Sterigmatomyces, Sterigmatosporidium, Symbiotaphrina, Sympodiomyces, Sympodiomycopsis, Torulaspora, Trichosporiella, Trichosporon, Trigonopsis, Tsuchiyaea, Udeniomyces, Waltomyces, Wickerhamia, Wickerhamiella, Williopsis, Yamadazyma, Yarrowia, Zygoascus, Zygosaccharomyces, Zygowilliopsis, and Zygozyma, among others.

    [0074] In some embodiments, the host microbe is Saccharomyces cerevisiae, Pichia pastoris, Schizosaccharomyces pombe, Dekkera bruxellensis, Kluyveromyces lactis (previously called Saccharomyces lactis), Kluveromyces marxianus, Arxula adeninivorans, or Hansenula polymorpha (now known as Pichia angusta). In some embodiments, the host microbe is a strain of the genus Candida, such as Candida hpolytica, Candida guilliermondii, Candida krusei, Candida pseudotropicalis, or Candida utilis.

    [0075] In a particular embodiment, the host microbe is Saccharomyces cerevisiae. In some embodiments, the host is a strain of Saccharomyces cerevisiae selected from the group consisting of Baker's yeast, CBS 7959, CBS 7960, CBS 7961, CBS 7962, CBS 7963, CBS 7964, IZ-1904, TA, BG-1, CR-1, SA-1, M-26, Y-904, PE-2, PE-5, VR-1, BR-1, BR-2, ME-2, VR-2, MA-3, MA-4, CAT-1, CB-1, NR-1, BT-1, and AL-1. In some embodiments, the host microbe is a strain of Saccharomyces cerevisiae selected from the group consisting of PE-2, CAT-1, VR-1, BG-1, CR-1, and SA-1. In a particular embodiment, the strain of Saccharomyces cerevisiae is PE-2. In another particular embodiment, the strain of Saccharomyces cerevisiae is CAT-1. In another particular embodiment, the strain of Saccharomyces cerevisiae is BG-1.

    [0076] In some embodiments, the host microbe is a microbe that is suitable for industrial fermentation. In particular embodiments, the microbe is conditioned to subsist under high solvent concentration, high temperature, expanded substrate utilization, nutrient limitation, osmotic stress due to sugar and salts, acidity, sulfite and bacterial contamination, or combinations thereof, which are recognized stress conditions of the industrial fermentation environment.

    6.5 The Steviol and Steviol Glycoside Biosynthesis Pathways

    [0077] In some embodiments, a steviol biosynthesis pathway and/or a steviol glycoside biosynthesis pathway is activated in the genetically modified host cells provided herein by engineering the cells to express polynucleotides and/or polypeptides encoding one or more enzymes of the pathway. FIG. 1B illustrates an exemplary steviol biosynthesis pathway. FIG. 2 illustrates an exemplary steviol glycoside biosynthesis pathway starting from geranylgeranyl pyrophosphate to various steviol glycosides.

    [0078] Thus, in some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having geranylgeranyl diphosphate synthase (GGPPS) activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having copalyl diphosphate synthase or ent-copalyl pyrophosphate synthase (CDPS; also referred to as ent-copalyl pyrophosphate synthase or CPS) activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having kaurene synthase (KS; also referred to as ent-kaurene synthase) activity. In particular embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having kaurene oxidase activity (KO; also referred to as ent-kaurene 19-oxidase) as described herein. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having steviol synthase (also referred to as ent-kaurenoic acid 13-hydroxylase or KAH) activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having cytochrome P450 reductase (CPR) activity.

    [0079] In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having UGT74G1 activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having UGT76G1 activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having UGT85C2 activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having UGT91D activity. In some embodiments, the genetically modified host cells provided herein comprise a heterologous polynucleotide encoding a polypeptide having UDP glycosyltransferase activity.

    [0080] In certain embodiments, the host cell comprises a variant. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions relative to the relevant polypeptide. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative amino acid substitutions relative to the reference polypeptide. In certain embodiments, any of the nucleic acids described herein can be optimized for the host cell, for instance codon optimized.

    [0081] Exemplary nucleic acids and enzymes of a steviol biosynthesis pathway and/or a steviol glycoside biosynthesis pathway are described below.

    [0082] 6.5.1 Geranylgeranyl diphosphate synthase (GGPPS)

    [0083] Geranylgeranyl diphosphate synthases (EC 2.5.1.29) catalyze the conversion of farnesyl pyrophosphate into geranylgeranyl diphosphate. Illustrative examples of enzymes include those of Stevia rebaudiana (accession no. ABD92926), Gibberella fujikuroi (accession no. CAA75568), Mus musculus (accession no. AAH69913), Thalassiosira pseudonana (accession no. XP_002288339), Streptomyces clavuligerus (accession no. ZP_05004570), Sulfulobus acidocaldarius (accession no. BAA43200), Synechococcus sp. (accession no. ABC98596), Arabidopsis thaliana (accession no. NP_195399), Blakeslea trispora (accession no. AFC92798.1) and US 2014/0329281 A1. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these GGPPS nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, 95% sequence identity to at least one of these GGPPS enzymes.

    [0084] 6.5.2 Copalyl Diphosphate Synthase (CDPS)

    [0085] Copalyl diphosphate synthases (EC 5.5.1.13) catalyze the conversion of farnesyl pyrophosphate into geranylgeranyl diphosphate. Illustrative examples of enzymes include those of Stevia rebaudiana (accession no. AAB87091), Streptomyces clavuligerus (accession no. EDY51667), Bradyrhizobium japonicum (accession no. AAC28895.1), Zea mays (accession no. AY562490), Arabidopsis thaliana (accession no. NM_116512), Oryza sativa (accession no. Q5MQ85.1) and US 2014/0329281 A1. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these CDPS nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 95%, 90%, or 95% sequence identity to at least one of these CDPS enzymes.

    [0086] 6.5.3 Kaurene Synthase (KS)

    [0087] Kaurene synthases (EC 4.2.3.19) catalyze the conversion of copalyl diphosphate into kaurene and diphosphate. Illustrative examples of enzymes include those of Bradyrhizobium japonicum (accession no. AAC28895.1), Phaeosphaeria sp. (accession no. O13284), Arabidopsis thaliana (accession no. Q9SAK2), Picea glauca (accession no. ADB55711.1) and US 2014/0329281 A1. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these KS nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 85%, 90%, or 95% sequence identity to at least one of these KS enzymes.

    [0088] 6.5.4 Bifunctional Copalyl Diphosphate Synthase (CDPS) and Kaurene Synthase (KS)

    [0089] CDPS-KS bifunctional enzymes (EC 5.5.1.13 and EC 4.2.3.19) also can be used. Illustrative examples of enzymes include those of Phomopsis amygdali (accession no. BAG30962), Physcomitrella patens (accession no. BAF61135), Gibberella fujikuroi (accession no. Q9UVY5.1), and US 2014/0329281 A1, US 2014/0357588 A1, US 2015/0159188, and WO 2016/038095 A2. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these CDPS-KS nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these CDPS-KS enzymes.

    [0090] 6.5.5 Ent-Kaurene Oxidase (KO)

    [0091] Ent-kaurene oxidases (EC 1.14.13.78; also referred to as kaurene oxidases) are described herein. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these kaurene oxidase nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these kaurene oxidase enzymes.

    [0092] 6.5.6 Steviol Synthase (KAH)

    [0093] Steviol synthases, or kaurenoic acid hydroxylases (KAH), (EC 1.14.13) catalyze the conversion of kaurenoic acid into steviol. Illustrative examples of enzymes include those of Stevia rebaudiana (accession no. ACD93722), Stevia rebaudiana (SEQ ID NO:10) Arabidopsis thaliana (accession no. NP_197872), Vitis vinifera (accession no. XP_002282091), Medicago trunculata (accession no. ABC59076), and US 2014/0329281 A1, US 2014/0357588 A1, US 2015/0159188, and WO 2016/038095 A2. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these KAH nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these KAH enzymes.

    [0094] 6.5.7 Cytochrome P450 Reductase (CPR)

    [0095] Cytochrome P450 reductases (EC 1.6.2.4) are capable of assisting or facilitating the activity of KO and/or KAH above. Illustrative examples of enzymes include those of Stevia rebaudiana (accession no. ABB88839) Arabidopsis thaliana (accession no. NP_194183), Gibberella fujikuroi (accession no. CAE09055), Artemisia annua (accession no. ABC47946.1) and US 2014/0329281 A1, US 2014/0357588 A1, US 2015/0159188, and WO 2016/038095 A2. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these CPR nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these CPR enzymes.

    [0096] 6.5.8 UDP Glycosyltransferase 74G1 (UGT74G1)

    [0097] A UGT74G1 is capable of functioning as a uridine 5-diphospho glucosyl: steviol 19-COOH transferase and as a uridine 5-diphospho glucosyl: steviol-13-O-glucoside 19-COOH transferase. As shown in FIG. 2, a UGT74G1 is capable of converting steviol to 19-glycoside. A UGT74G1 is also capable of converting steviolmonoside to rubusoside. A UGT74G1 may be also capable of converting steviolbioside to stevioside. Illustrative examples of enzymes include those of Stevia rebaudiana (e.g., those of Richman et al., 2005, Plant J. 41: 56-67 and US 2014/0329281 and WO 2016/038095 A2 and accession no. AAR06920.1). Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT74G1 nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT74G1 enzymes.

    [0098] 6.5.9 UDP Glycosyltransferase 76G1 (UGT76G1)

    [0099] A UGT76G1 is capable of transferring a glucose moiety to the C-3 of the C-13-0-glucose of the acceptor molecule, a steviol 1,2 glycoside. Thus, a UGT76G1 is capable of functioning as a uridine 5-diphospho glucosyl: steviol 13-O-1,2 glucoside C-3 glucosyl transferase and a uridine 5-diphospho glucosyl: steviol-19-O-glucose, 13-O-1,2 bioside C-3 glucosyl transferase. As shown in FIG. 2, a UGT76G1 is capable of converting steviolbioside to RebB. A UGT76G1 is also capable of converting stevioside to RebA. A UGT76G1 is also capable of converting RebD to RebM. Illustrative examples of enzymes include those of Stevia rebaudiana (e.g., those of Richman et al., 2005, Plant J. 41: 56-67 and US 2014/0329281 A1 and WO 2016/038095 A2 and accession no. AAR06912.1). Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT76G1 nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT76G1 enzymes.

    [0100] 6.5.10 UDP Glycosyltransferase 85C2 (UGT85C2)

    [0101] A UGT85C2 is capable of functioning as a uridine 5-diphospho glucosyl:steviol 13-OH transferase, and a uridine 5-diphospho glucosyl:steviol-19-O-glucoside 13-OH transferase. Thus, as shown in FIG. 2, a UGT85C2 is capable of converting steviol to steviolmonoside, and is also capable of converting 19-glycoside to rubusoside. Illustrative examples of enzymes include those of Stevia rebaudiana (e.g., those of Richman et al., 2005, Plant J. 41: 56-67 and US 2014/0329281 A1 and WO 2016/038095 A2 and accession no. AAR06916.1). Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT85C2 nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT85C2 enzymes.

    [0102] 6.5.11 UDP-Glycosyltransferase 91D (UGT91D)

    [0103] A UGT91D is capable of functioning as a uridine 5-diphosphoglucosyl:steviol-13-O-glucoside transferase, transferring a glucose moiety to the C-2 of the 13-O-glucose of the acceptor molecule, steviol-13-O-glucoside (steviolmonoside) to produce steviobioside. A UGT91D is also capable of functioning as a uridine 5-diphospho glucosyl:rubusoside transferase, transferring a glucose moiety to the C-2 of the 13-O-glucose of the acceptor molecule, rubusoside, to provide stevioside as shown in FIG. 2. A UGT91D is also referred to as UGT91D2, UGT91D2e, or UGT91D-like3. Illustrative examples of UGT91D enzymes include those of Stevia rebauidana (e.g., those of UGT sequence with accession no. ACE87855.1, US 2014/0329281 A1, WO 2016/038095 A2, and SEQ ID NO:7). Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT91D nucleic acids. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGT91D enzymes.

    [0104] 6.5.12 Uridine Diphosphate-Dependent Glycosyl Transferase Capable of Converting RebA to RebD (UGT.sub.AD)

    [0105] A uridine diphosphate-dependent glycosyl transferase (UGT.sub.AD) is capable of transferring a glucose moiety to the C-2 position of the 19-O-glucose of RebA to produce RebD as shown in FIG. 2. A UGT.sub.AD is also capable of transferring a glucose moiety to the C-2 position of the 19-O-glucose of stevioside to produce RebE. Useful examples of UGTs include Os_UGT_91C1 from Oryza sativa (also referred to as EUGT11 in Houghton-Larsen et al., WO 2013/022989 A2; XP_015629141.1) and S1_UGT_101249881 from Solanum lycopersicum (also referred to as UGTSL2 in Markosyan et al., WO2014/193888 A1; XP_004250485.1). Further useful UGTs include UGT40087 (XP_004982059.1), sr.UGT_9252778 (SEQ ID NO:16), Bd_UGT10840 (XP_003560669.1), Hv_UGT_V1 (BAJ94055.1), Bd_UGT10850 (XP_010230871.1), and Ob_UGT91B1_like (XP_006650455.1). Any UGT or UGT variant can be used in the compositions and methods described herein. Nucleic acids encoding these enzymes are useful in the cells and methods provided herein. In certain embodiments, provided herein are cells and methods using a nucleic acid having at least 80%, 85%, 90%, or 95% sequence identity to at least one of the UGTs. In certain embodiments, provided herein are cells and methods using a nucleic acid that encodes a polypeptide having at least 80%, 85%, 90%, or 95% sequence identity to at least one of these UGTs. In certain embodiments, provided herein are a nucleic acid that encodes a UGT variant described herein.

    [0106] In certain embodiments, the genetically modified host cells comprise a heterologous nucleic acid encoding a UDP-glycosyltransferase comprising an amino acid sequence having at least 80%, 85%, 90%, or 95% sequence identity to the sequence of UGT40087 (e.g., SEQ ID NO:17 or SEQ ID NO:18. In certain embodiments, the genetically modified host cell is capable of converting RebA to RebD at an efficiency greater than 90%, 95%, 96%, or 97%. In certain embodiments, the genetically modified host cell comprises a UDP-glycosyltransferase comprising a sugar acceptor domain, wherein the amino acid sequence of the sugar acceptor domain has at least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of the sugar acceptor domain of SEQ ID NO:17 or SEQ ID NO:18. In certain embodiments, the genetically modified host cell comprises a UDP-glycosyltransferase which comprises a loop1 amino acid sequence, a variant loop1 amino acid sequence, a loop2 amino acid sequence, a variant loop2 amino acid sequence, a loop3_1 amino acid sequence, a variant loop3_1 amino acid sequence, a loop3_2 amino acid sequence, a variant loop3_2 amino acid sequence, a loop4_1 amino acid sequence, a variant loop4_1 amino acid sequence, a loop4_2 amino acid sequence, or any combination thereof. In certain embodiments, the genetically modified host cell comprises a UDP-glycosyltransferase comprising an amino acid sequence having at least 61%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the sugar acceptor domain of SEQ ID NO:17 or SEQ ID NO:18, and further comprises the loop4_1 amino acid sequence of SEQ ID NO:17 or SEQ ID NO:18.

    [0107] As used herein, the term variant loop1 amino acid sequence refers to an amino acid sequence which differs from the reference loop1 amino acid sequence of SEQ ID NO:17 or 18 (or a modified loop1 sequence of UGT40087 having the sequence of SEQ ID NO:28) by, one, two, three, four, five, six, seven, eight, nine, or ten amino acid insertions, deletions, mutations, and/or substitutions, but allows a UDP-glycosyltransferase comprising a variant loop1 amino acid sequence, inserted at a location which corresponds to the loop1 amino acid sequence location of SEQ ID NO:17 or 18, respectively, to catalyze conversion of RebA to RebD and/or stevioside to RebE.

    [0108] As used herein, the term variant loop2 amino acid sequence refers to an amino acid sequence which differs from the reference loop2 amino acid sequence of SEQ ID NO:17 or 18 by one, two, three, four, five, six, seven, eight, nine, or ten amino acid insertions, deletions, mutations, and/or substitutions, but allows a UDP-glycosyltransferase comprising a variant loop2 amino acid sequence, inserted at a location which corresponds to the loop2 amino acid sequence location of SEQ ID NO:17 or 18, respectively, to catalyze conversion of RebA to RebD and/or stevioside to RebE.

    [0109] As used herein, the term variant loop3_1 amino acid sequence refers to an amino acid sequence which differs from the reference loop3_1 amino acid sequence of SEQ ID NO:17 or 18 by one, two, three, four, five, six, seven, eight, nine, or ten amino acid insertions, deletions, mutations, and/or substitutions, but allows a UDP-glycosyltransferase comprising a variant loop3_1 amino acid sequence, inserted at a location which corresponds to the loop3_1 amino acid sequence location of SEQ ID NO:17 or 18, to catalyze conversion of RebA to RebD and/or stevioside to RebE. As used herein, the term variant loop3_2 amino acid sequence refers to an amino acid sequence which differs from the reference loop3_2 amino acid sequence of SEQ ID NO:17 or 18 by one, two, three, four, five, six, seven, eight, nine, or ten amino acid insertions, deletions, mutations, and/or substitutions, but allows a UDP-glycosyltransferase comprising a variant loop3_2 amino acid sequence, inserted at a location that corresponds to the loop3_2 amino acid sequence location of SEQ ID NO:17 or 18, respectively to catalyze conversion of RebA to RebD and/or stevioside to RebE. In certain embodiments, a variant loop3_2 amino acid sequence differs from the reference loop3_2 amino acid sequence by, one, two, three, four, five six, seven, eight, nine, ten, or up to thirty amino acid insertions, deletions, mutations, and/or substitutions.

    [0110] As used herein, the term variant loop4_1 amino acid sequence refers to an amino acid sequence which differs from the reference loop4_1 amino acid sequence of SEQ ID NO:17 or 18 by one, two, three, four, five, six, seven, eight, nine, ten, or up to 30 amino acid insertions, deletions, mutations, and/or substitutions, but allows a UDP-glycosyltransferase comprising a variant loop4_1 sequence, inserted at a location that corresponds to the loop4_1 amino acid location of SEQ ID NO:17 or 18, to catalyze conversion of RebA to RebD and/or stevioside to RebE.

    [0111] In certain embodiments, the host cells comprise a functional domain of a UGT40087, wherein the UGT40087 comprises the amino acid sequence of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising the N-terminal sugar acceptor domain of a UGT40087 comprising the amino acid sequence of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising the C-terminal sugar donor domain of a UGT40087 comprising the amino acid sequence of SEQ ID NO:17 or 18. In certain embodiments, the sugar acceptor domain of a UGT40087 comprises about amino acid positions 1 to 214 of SEQ ID NO: 18 (which correspond to amino acid positions 1 to 215 of SEQ ID NO:17). In certain embodiments, the sugar donor domain of UGT40087 comprises about amino acid positions 215 to 435 of SEQ ID NO:18 (which correspond to amino acid positions 216 to 436 of SEQ ID NO:17). In certain embodiments, the sugar acceptor domain of UGT40087 comprises about amino acid positions 1 to 215 of SEQ ID NO:17. In certain embodiments, the sugar donor domain of comprises about amino acid positions of 216 to 436 of SEQ ID NO:17. In certain embodiments, the sugar acceptor domain and the sugar donor domain of a UGT40087 comprises a narrower range of amino acid residues than 1 to 214 or 215 to 435, respectively, in relation to SEQ ID NO:18. In certain embodiments, the sugar acceptor domain and the sugar donor domain of a UGT40087 comprises a narrower range of amino acid residues than 1 to 215 or 216 to 436, respectively, relation to SEQ ID NO:17.

    [0112] In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence substantially identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, provided here are host cells comprising a polypeptide comprising an amino acid sequence that is at least 60%, at least 99%, or any percentage between 60% and 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18.

    [0113] In certain embodiments, the host cells comprise a nucleic acid encoding a UGT40087 comprising the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence substantially identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18.

    [0114] In certain embodiments, when three-dimensional modeled structures of UGT40087 and another UDP-glycosyltransferase were compared and analyzed, they revealed four loops (i.e., loop1, loop2, loop3, and loop4) that possess significant conformational differences at the N terminal sugar acceptor domain. The experimental results from exchanges of corresponding loop sequences between the two UGTs indicated that the loop1, loop2, loop3_1, loop3_2, and loop4_1 of UGT40087 can be substituted with their respective, corresponding loop sequences from other UDP-glycosyltransferases which are capable of converting RebA to RebD. In these embodiments, two versions of loop3 (i.e., loop3_1 and loop3_2) and loop_4 (i.e., loop4_1 and loop4_2) were designed to account for two possible loop lengths.

    [0115] Thus, in certain embodiments, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence that is at least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO: 17 or 18. In certain embodiments, the host cells comprise a heterologous nucleic acid encoding a UDP-glycosyltransferase comprising an amino acid sequence that is that least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18. In certain embodiments, the UDP-glycosyltransferase further comprises a loop1 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop1 location of SEQ ID NO:17 or 18, respectively. In certain embodiments, the loop1 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:30. In certain embodiments, the loop1 amino acid sequence has the sequence of SEQ ID NO:28. In certain embodiments, the UDP-glycosyltransferase further comprises a variant loop1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop1 location of SEQ ID NO:17 or 18, respectively. The variant loop1 amino acid sequence refers an amino acid sequence which differs from the reference loop1 amino acid sequence of SEQ ID NO:17 or 18 or the loop1 amino acid sequence having SEQ ID NO:28, but allows the UDP-glycosyltransferase comprising the variant loop1 amino acid to retain its activity to convert RebA to RebD and/or to convert stevioside to RebE.

    [0116] In certain embodiments, the UDP-glycosyltransferase further comprises loop2 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop2 location of SEQ ID NO:17 or 18, respectively. In certain embodiments, the loop2 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:24. In certain embodiments, the UDP-glycosyltransferase further comprises a variant loop2 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop2 location of SEQ ID NO:17 or 18, respectively. The variant loop2 amino acid sequence refers to an amino acid sequence which differs from the reference loop2 amino acid sequence of SEQ ID NO:17 or 18, but allows the UDP-glycosyltransferase comprising the variant loop2 amino acid to retain its activity to convert RebA to RebD and/or to convert stevioside to RebE.

    [0117] In certain embodiments, the UDP-glycosyltransferase further comprises loop3_1 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop3_1 location of SEQ ID NO:17 or 18, respectively. In certain embodiments, the loop3_1 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:25. In certain embodiments, the UDP-glycosyltransferase further comprises a variant loop3_1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop3_1 location of SEQ ID NO:17 or 18, respectively. The variant loop3_1 amino acid sequence refers to an amino acid sequence which differs from the reference loop3_1 amino acid sequence of SEQ ID NO:17 or 18, but allows the UDP-glycosyltransferase comprising the variant loop3_1 amino acid to retain its activity to convert RebA to RebD and/or to convert stevioside to RebE.

    [0118] In certain embodiments, the UDP-glycosyltransferase further comprises loop3_2 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop3_2 location of SEQ ID NO:17 or 18, respectively. In certain embodiments, the loop3_2 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:26. In certain embodiments, the UDP-glycosyltransferase further comprises a variant loop3_2 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop3_2 location of SEQ ID NO:17 or 18, respectively. The variant loop3_2 amino acid sequence refers to an amino acid sequence which differs from the reference loop3_2 amino acid sequence of SEQ ID NO:17 or 18, but allows the UDP-glycosyltransferase comprising the variant loop3_2 amino acid to retain its activity to convert RebA to RebD and/or to convert stevioside to RebE.

    [0119] In certain embodiments, the UDP-glycosyltransferase further comprises loop4_1 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop4_1 location of SEQ ID NO:17 or 18, respectively. In certain embodiments, the loop4_1 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:27. In certain embodiments, the UDP-glycosyltransferase further comprises a variant loop4_1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop4_1 location of SEQ ID NO:17 or 18, respectively. The variant loop4_1 amino acid sequence refers to an amino acid sequence which differs from the reference loop4_1 amino acid sequence of SEQ ID NO:17 or 18, but allows the UDP-glycosyltransferase comprising the variant loop4_1 amino acid to retain its activity to convert RebA to RebD and/or to convert stevioside to RebE.

    [0120] In certain embodiments, the UDP-glycosyltransferase further comprises loop4_2 amino acid sequence of UGT40087 (i.e., SEQ ID NO:17 or 18), at a location of the UDP-glycosyltransferase that corresponds to the loop4_2 location of SEQ ID NO:17 or 18, respectively. The loop4_2 amino acid sequence of SEQ ID NO:17 or 18 has the amino acid sequence of SEQ ID NO:28.

    [0121] In certain embodiments, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence that is at least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18, or a heterologous nucleic acid encoding the UDP-glycosyltransferase thereof, and further comprising any combination of the following:

    [0122] (a) The loop1 amino acid sequence of SEQ ID NO:17 or 18, the amino acid sequence of SEQ ID NO:30, or a variant loop1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop1 location of SEQ ID NO:17 or 18, respectively;

    [0123] (b) the loop2 amino acid sequence of SEQ ID NO:17 or 18, or a variant loop2 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop2 location of SEQ ID NO:17 or 18, respectively;

    [0124] (c) the loop3_1 amino acid sequence of SEQ ID NO:17 or 18, or a variant loop3_1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop 3_1 location of SEQ ID NO:17 or 18, respectively;

    [0125] (d) the loop3_2 amino acid sequence of SEQ ID NO:17 or 18, or a variant loop3_2 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop3_2 location of SEQ ID NO:17 or 18, respectively;

    [0126] (e) the loop4_1 amino acid sequence of SEQ ID NO:17 or 18, or a variant loop4_1 amino acid sequence, at a location of the UDP-glycosyltransferase that corresponds to the loop4_1 location of SEQ ID NO:17 or 18, respectively; and

    [0127] (f) the loop4_2 amino acid sequence of SEQ ID NO:17 or 18, at a location of the UDP-glycosyltransferase that corresponds to the loop4_2 location of SEQ ID NO:17 or 18, respectively.

    [0128] In certain embodiments, when three-dimensional modeled structures of UDP-glycosyltransferases capable of converting RebA to RebD were compared and analyzed, it was discovered that loop4_1 of UGT40087, when incorporated into the corresponding loop4_1 location of another UDP-glycosyltransferase (and replacing its native loop4_1 amino acid sequence) led to superior activity of a variant UDP-glycosyltransferase in terms of its ability to convert RebA to RebD. See Example 12. These results indicate that the loop4_1 amino acid sequence of any suitable UDP-glycosyltransferase can be substituted with the loop4_1 amino acid sequence of SEQ ID NO:17 or 18 to convert RebA to RebD.

    [0129] Therefore, in certain embodiments, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence that is at least 61%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18, and further comprises the loop4_1 amino acid sequence (i.e., SEQ ID NO:27) of UGT40087 (i.e., SEQ ID NO:17 or 18). In certain embodiments, the host cells comprise a heterologous nucleic acid encoding an UDP-glycosyltransferase comprising an amino acid sequence that is at least 61%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18, and further comprises the loop4_1 amino acid sequence (e.g., SEQ ID NO:27) of SEQ ID NO:17 or 18. In certain embodiments, any suitable UDP-glycosyltransferase which comprises an amino acid sequence that is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% to SEQ ID NO:17 or 18 can be used to integrate the loop4_1 amino acid sequence from SEQ ID NO:17 or 18 at its corresponding loop4_1 location (replacing its native loop4_1 amino acid sequence). For example, Ob_UGT91B_like, Hv_UGT_V1, Sl_UGT_101249881, Sr.UGT_g252778, Os_UGT_91C1, Bd_UGT10840, Bd_UGT10850, or Si91Dlike can be used as a base to integrate the loop4_1 amino acid sequence from SEQ ID NO:17 or 18 at its corresponding loop4_1 location. In certain embodiments, the UDP-glycosyltransferase comprises an amino acid sequence of SEQ ID NO:33.

    [0130] In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence substantially identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18.

    [0131] In certain embodiments, the host cells comprise a nucleic acid encoding a UGT40087 comprising the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence substantially identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 60% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 65% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 75% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 80% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 85% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 90% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 95% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 96% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 97% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 98% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a nucleic acid encoding a polypeptide comprising an amino acid sequence that is at least 99% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18.

    [0132] Thus, in certain embodiments, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the host cells comprise a heterologous nucleic acid encoding a UDP-glycosyltransferase comprising an amino acid sequence that is that least 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the amino acid sequence of the C-terminal sugar donor domain of SEQ ID NO:17 or 18. In certain embodiments, the UDP-glycosyltransferase further comprises a C-terminal sugar donor domain from other UDP-glycosyltransferase. Examples of other UDP-glycosyltransferases with suitable C-terminal sugar donor domains include Ob_UGT91B_like, Hv_UGT_V1, SI_UGT_101249881, Sr.UGT_g252778, Os_UGT_91C1, Bd_UGT10840, Bd_UGT10850, or Si91Dlike.

    [0133] In certain embodiments, it was discovered that certain amino acid residues in the N-terminal sugar acceptor domain can restore the catalytic activity of a non-functional, putative UDP-glycosyltransferase into an active UDP-glycosyltransferase. Therefore, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of the N-terminal sugar acceptor domain of SEQ ID NO:17 or 18, and further comprises one or more of the following amino acid residues:

    [0134] (a) valine at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 11 of SEQ ID NO:18;

    [0135] (b) isoleucine at an amino acid position of UDP-glycosyltransferase that corresponds to amino acid position 12 of SEQ ID NO:18;

    [0136] (c) proline at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 55 of SEQ ID NO:18;

    [0137] (d) glutamic acid at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 90 of SEQ ID NO:18;

    [0138] (e) serine at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 203 of SEQ ID NO:18;

    [0139] (f) glutamic acid at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 223 of SEQ ID NO:18; or

    [0140] (g) valine at an amino acid position of the UDP-glycosyltransferase that corresponds to amino acid position 413 of SEQ ID NO:18,

    [0141] wherein the amino acid positions of the UDP-glycosyltransferase that correspond to the amino acid positions of SEQ ID NO:18 are determined by sequence alignment.

    [0142] In certain embodiments, the host cells comprise a UDP-glycosyltransferase comprising an amino acid sequence of SEQ ID NO:32.

    [0143] In certain embodiments, the host cell comprises a variant of the UGT40087 polypeptide described above. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitutions relative to the UGT40087 polypeptide. In certain embodiments, the variant can comprise up to 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative amino acid substitutions relative to the UGT40087 polypeptide. In certain embodiments, any of the nucleic acids described herein can be optimized for the host cell, for instance codon optimized. Useful nucleic acids include SEQ ID NO:35 and 36.

    6.6 MEV Pathway FPP and/or GGPP Production

    [0144] In some embodiments, a genetically modified host cell provided herein comprises one or more heterologous enzymes of the MEV pathway, useful for the formation of FPP and/or GGPP. See FIG. 1D. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that condenses acetyl-CoA with malonyl-CoA to form acetoacetyl-CoA. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that condenses two molecules of acetyl-CoA to form acetoacetyl-CoA. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that condenses acetoacetyl-CoA with acetyl-CoA to form HMG-CoA. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that converts HMG-CoA to mevalonate. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that phosphorylates mevalonate to mevalonate 5-phosphate. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that converts mevalonate 5-phosphate to mevalonate 5-pyrophosphate. In some embodiments, the one or more enzymes of the MEV pathway comprise an enzyme that converts mevalonate 5-pyrophosphate to isopentenyl pyrophosphate.

    [0145] In some embodiments, the one or more enzymes of the MEV pathway are selected from the group consisting of acetyl-CoA thiolase, acetoacetyl-CoA synthetase, HMG-CoA synthase, HMG-CoA reductase, mevalonate kinase, phosphomevalonate kinase and mevalonate pyrophosphate decarboxylase. In some embodiments, with regard to the enzyme of the MEV pathway capable of catalyzing the formation of acetoacetyl-CoA, the genetically modified host cell comprises either an enzyme that condenses two molecules of acetyl-CoA to form acetoacetyl-CoA, e.g., acetyl-CoA thiolase; or an enzyme that condenses acetyl-CoA with malonyl-CoA to form acetoacetyl-CoA, e.g., acetoacetyl-CoA synthase. In some embodiments, the genetically modified host cell comprises both an enzyme that condenses two molecules of acetyl-CoA to form acetoacetyl-CoA, e.g., acetyl-CoA thiolase; and an enzyme that condenses acetyl-CoA with malonyl-CoA to form acetoacetyl-CoA, e.g., acetoacetyl-CoA synthase.

    [0146] In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding more than one enzyme of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding two enzymes of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding an enzyme that can convert HMG-CoA into mevalonate and an enzyme that can convert mevalonate into mevalonate 5-phosphate. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding three enzymes of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding four enzymes of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding five enzymes of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding six enzymes of the MEV pathway. In some embodiments, the host cell comprises one or more heterologous nucleotide sequences encoding seven enzymes of the MEV pathway. In some embodiments, the host cell comprises a plurality of heterologous nucleic acids encoding all of the enzymes of the MEV pathway.

    [0147] In some embodiments, the genetically modified host cell further comprises a heterologous nucleic acid encoding an enzyme that can convert isopentenyl pyrophosphate (IPP) into dimethylallyl pyrophosphate (DMAPP). In some embodiments, the genetically modified host cell further comprises a heterologous nucleic acid encoding an enzyme that can condense IPP and/or DMAPP molecules to form a polyprenyl compound. In some embodiments, the genetically modified host cell further comprise a heterologous nucleic acid encoding an enzyme that can modify IPP or a polyprenyl to form an isoprenoid compound such as FPP.

    [0148] 6.6.1 Conversion of Acetyl-CoA to Acetoacetyl-CoA

    [0149] In some embodiments, the genetically modified host cell comprises a heterologous nucleotide sequence encoding an enzyme that can condense two molecules of acetyl-coenzyme A to form acetoacetyl-CoA, e.g., an acetyl-CoA thiolase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (NC 000913 REGION: 2324131.2325315; Escherichia coli), (D49362; Paracoccus denitrificans), and (L20428; Saccharomyces cerevisiae).

    [0150] Acetyl-CoA thiolase catalyzes the reversible condensation of two molecules of acetyl-CoA to yield acetoacetyl-CoA, but this reaction is thermodynamically unfavorable; acetoacetyl-CoA thiolysis is favored over acetoacetyl-CoA synthesis. Acetoacetyl-CoA synthase (AACS) (alternately referred to as acetyl-CoA:malonyl-CoA acyltransferase; EC 2.3.1.194) condenses acetyl-CoA with malonyl-CoA to form acetoacetyl-CoA. In contrast to acetyl-CoA thiolase, AACS-catalyzed acetoacetyl-CoA synthesis is essentially an energy-favored reaction, due to the associated decarboxylation of malonyl-CoA. In addition, AACS exhibits no thiolysis activity against acetoacetyl-CoA, and thus the reaction is irreversible.

    [0151] In host cells comprising acetyl-CoA thiolase and a heterologous ADA and/or phosphotransacetylase (PTA), the reversible reaction catalyzed by acetyl-CoA thiolase, which favors acetoacetyl-CoA thiolysis, may result in a large acetyl-CoA pool. In view of the reversible activity of ADA, this acetyl-CoA pool may in turn drive ADA towards the reverse reaction of converting acetyl-CoA to acetaldehyde, thereby diminishing the benefits provided by ADA towards acetyl-CoA production. Similarly, the activity of PTA is reversible, and thus, a large acetyl-CoA pool may drive PTA towards the reverse reaction of converting acetyl-CoA to acetyl phosphate. Therefore, in some embodiments, in order to provide a strong pull on acetyl-CoA to drive the forward reaction of ADA and PTA, the MEV pathway of the genetically modified host cell provided herein utilizes an acetoacetyl-CoA synthase to form acetoacetyl-CoA from acetyl-CoA and malonyl-CoA.

    [0152] In some embodiments, the AACS is from Streptomyces sp. strain CL190 (Okamura et al., Proc Natl Acad Sci USA 107(25):11265-70 (2010). Representative AACS nucleotide sequences of Streptomyces sp. strain CL190 include accession number AB540131.1. Representative AACS protein sequences of Streptomyces sp. strain CL190 include accession numbers D7URV0, BAJ10048. Other acetoacetyl-CoA synthases useful for the compositions and methods provided herein include, but are not limited to, Streptomyces sp. (AB183750; KO-3988 BAD86806); S. anulatus strain 9663 (FN178498; CAX48662); Streptomyces sp. KO-3988 (AB212624; BAE78983); Actinoplanes sp. A40644 (AB113568; BAD07381); Streptomyces sp. C (NZ_ACEW010000640; ZP_05511702); Nocardiopsis dassonvillei DSM 43111 (NZ_ABUI01000023; ZP_04335288); Mycobacterium ulcerans Agy99 (NC_008611; YP_907152); Mycobacterium marinum M (NC_010612; YP_001851502); Streptomyces sp. Mg1 (NZ_DS570501; ZP_05002626); Streptomyces sp. AA4 (NZ_ACEV01000037; ZP_05478992); S. roseosporus NRRL 15998 (NZ_ABYB01000295; ZP_04696763); Streptomyces sp. ACTE (NZ_ADFD01000030; ZP_06275834); S. viridochromogenes DSM 40736 (NZ_ACEZ01000031; ZP_05529691); Frankia sp. CcI3 (NC_007777; YP_480101); Nocardia brasihensis (NC_018681; YP_006812440.1); and Austwickia chelonae (NZ_BAGZ01000005; ZP_10950493.1). Additional suitable acetoacetyl-CoA synthases include those described in U.S. Patent Application Publication Nos. 2010/0285549 and 2011/0281315, the contents of which are incorporated by reference in their entireties.

    [0153] Acetoacetyl-CoA synthases also useful in the compositions and methods provided herein include those molecules which are said to be derivatives of any of the acetoacetyl-CoA synthases described herein. Such a derivative has the following characteristics: (1) it shares substantial homology with any of the acetoacetyl-CoA synthases described herein; and (2) is capable of catalyzing the irreversible condensation of acetyl-CoA with malonyl-CoA to form acetoacetyl-CoA. A derivative of an acetoacetyl-CoA synthase is said to share substantial homology with acetoacetyl-CoA synthase if the amino acid sequences of the derivative is at least 80%, and more preferably at least 90%, and most preferably at least 95%, the same as that of acetoacetyl-CoA synthase.

    [0154] 6.6.2 Conversion of Acetoacetyl-CoA to HMG-CoA

    [0155] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can condense acetoacetyl-CoA with another molecule of acetyl-CoA to form 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA), e.g., a HMG-CoA synthase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (NC_001145. complement 19061.20536; Saccharomyces cerevisiae), (X96617; Saccharomyces cerevisiae), (X83882; Arabidopsis thaliana), (AB037907; Kitasatospora griseola), (BT007302; Homo sapiens), and (NC_002758, Locus tag SAV2546, GeneID 1122571; Staphylococcus aureus).

    [0156] 6.6.3 Conversion of HMG-CoA to Mevalonate

    [0157] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can convert HMG-CoA into mevalonate, e.g., a HMG-CoA reductase. In some embodiments, HMG-CoA reductase is an NADH-using hydroxymethylglutaryl-CoA reductase-CoA reductase. HMG-CoA reductases (EC 1.1.1.34; EC 1.1.1.88) catalyze the reductive deacylation of (S)-HMG-CoA to (R)-mevalonate, and can be categorized into two classes, class I and class II HMGrs. Class I includes the enzymes from eukaryotes and most archaea, and class II includes the HMG-CoA reductases of certain prokaryotes and archaea. In addition to the divergence in the sequences, the enzymes of the two classes also differ with regard to their cofactor specificity. Unlike the class I enzymes, which utilize NADPH exclusively, the class II HMG-CoA reductases vary in the ability to discriminate between NADPH and NADH. See, e.g., Hedl et al., Journal of Bacteriology 186 (7): 1927-1932 (2004). Co-factor specificities for select class II HMG-CoA reductases are provided below.

    [0158] Co-Factor Specificities for Select Class II HMG-CoA Reductases

    TABLE-US-00001 Coenzyme Source specificity K.sub.m.sup.NADPH (M) K.sub.m.sup.NADH (M) P. mevalonii NADH 80 A. fulgidus NAD(P)H 500 160 S. aureus NAD(P)H 70 100 E. faecalis NADPH 30

    [0159] Useful HMG-CoA reductases for the compositions and methods provided herein include HMG-CoA reductases that are capable of utilizing NADH as a cofactor, e.g., HMG-CoA reductase from P. mevalonii, A. fulgidus or S. aureus. In particular embodiments, the HMG-CoA reductase is capable of only utilizing NADH as a cofactor, e.g., HMG-CoA reductase from P. mevalonii, S. pomeroyi or D. acidovorans.

    [0160] In some embodiments, the NADH-using HMG-CoA reductase is from Pseudomonas mevalonii. The sequence of the wild-type mvaA gene of Pseudomonas mevalonii, which encodes HMG-CoA reductase (EC 1.1.1.88), has been previously described. See Beach and Rodwell, J. Bacteriol. 171:2994-3001 (1989). Representative mvaA nucleotide sequences of Pseudomonas mevalonii include accession number M24015. Representative HMG-CoA reductase protein sequences of Pseudomonas mevalonii include accession numbers AAA25837, P13702, MVAA_PSEMV.

    [0161] In some embodiments, the NADH-using HMG-CoA reductase is from Silicibacter pomeroyi. Representative HMG-CoA reductase nucleotide sequences of Silicibacter pomeroyi include accession number NC_006569.1. Representative HMG-CoA reductase protein sequences of Silicibacter pomeroyi include accession number YP_164994.

    [0162] In some embodiments, the NADH-using HMG-CoA reductase is from Delftia acidovorans. A representative HMG-CoA reductase nucleotide sequences of Delftia acidovorans includes NC_010002 REGION: complement (319980 . . . 321269). Representative HMG-CoA reductase protein sequences of Delftia acidovorans include accession number YP_001561318.

    [0163] In some embodiments, the NADH-using HMG-CoA reductases is from Solanum tuberosum (Crane et al., J. Plant Physiol. 159:1301-1307 (2002)).

    [0164] NADH-using HMG-CoA reductases also useful in the compositions and methods provided herein include those molecules which are said to be derivatives of any of the NADH-using HMG-CoA reductases described herein, e.g., from P. mevalonii, S. pomeroyi and D. acidovorans. Such a derivative has the following characteristics: (1) it shares substantial homology with any of the NADH-using HMG-CoA reductases described herein; and (2) is capable of catalyzing the reductive deacylation of (S)-HMG-CoA to (R)-mevalonate while preferentially using NADH as a cofactor. A derivative of an NADH-using HMG-CoA reductase is said to share substantial homology with NADH-using HMG-CoA reductase if the amino acid sequences of the derivative is at least 80%, and more preferably at least 90%, and most preferably at least 95%, the same as that of NADH-using HMG-CoA reductase.

    [0165] As used herein, the phrase NADH-using means that the NADH-using HMG-CoA reductase is selective for NADH over NADPH as a cofactor, for example, by demonstrating a higher specific activity for NADH than for NADPH. In some embodiments, selectivity for NADH as a cofactor is expressed as a k.sub.cat.sup.(NADH)/k.sub.cat.sup.(NADPH) ratio. In some embodiments, the NADH-using HMG-CoA reductase has a k.sub.cat.sup.(NADH)/k.sub.cat.sup.(NADPH) ratio of at least 5, 10, 15, 20, 25 or greater than 25. In some embodiments, the NADH-using HMG-CoA reductase uses NADH exclusively. For example, an NADH-using HMG-CoA reductase that uses NADH exclusively displays some activity with NADH supplied as the sole cofactor in vitro, and displays no detectable activity when NADPH is supplied as the sole cofactor. Any method for determining cofactor specificity known in the art can be utilized to identify HMG-CoA reductases having a preference for NADH as cofactor, including those described by Kim et al., Protein Science 9:1226-1234 (2000); and Wilding et al., J. Bacteriol. 182(18):5147-52 (2000), the contents of which are hereby incorporated in their entireties.

    [0166] In some embodiments, the NADH-using HMG-CoA reductase is engineered to be selective for NADH over NAPDH, for example, through site-directed mutagenesis of the cofactor-binding pocket. Methods for engineering NADH-selectivity are described in Watanabe et al., Microbiology 153:3044-3054 (2007), and methods for determining the cofactor specificity of HMG-CoA reductases are described in Kim et al., Protein Sci. 9:1226-1234 (2000), the contents of which are hereby incorporated by reference in their entireties.

    [0167] In some embodiments, the NADH-using HMG-CoA reductase is derived from a host species that natively comprises a mevalonate degradative pathway, for example, a host species that catabolizes mevalonate as its sole carbon source. Within these embodiments, the NADH-using HMG-CoA reductase, which normally catalyzes the oxidative acylation of internalized (R)-mevalonate to (S)-HMG-CoA within its native host cell, is utilized to catalyze the reverse reaction, that is, the reductive deacylation of (S)-HMG-CoA to (R)-mevalonate, in a genetically modified host cell comprising a mevalonate biosynthetic pathway. Prokaryotes capable of growth on mevalonate as their sole carbon source have been described by: Anderson et al., J. Bacteriol, 171(12):6468-6472 (1989); Beach et al., J. Bacteriol. 171:2994-3001 (1989); Bensch et al., J. Biol. Chem. 245:3755-3762; Fimongnari et al., Biochemistry 4:2086-2090 (1965); Siddiqi et al., Biochem. Biophys. Res. Commun. 8:110-113 (1962); Siddiqi et al., J. Bacteriol. 93:207-214 (1967); and Takatsuji et al., Biochem. Biophys. Res. Commun. 110:187-193 (1983), the contents of which are hereby incorporated by reference in their entireties.

    [0168] In some embodiments of the compositions and methods provided herein, the host cell comprises both a NADH-using HMGr and an NADPH-using HMG-CoA reductase. Illustrative examples of nucleotide sequences encoding an NADPH-using HMG-CoA reductase include, but are not limited to: (NM 206548; Drosophila melanogaster), (NC_002758, Locus tag SAV2545, GeneID 1122570; Staphylococcus aureus), (AB015627; Streptomyces sp. KO 3988), (AX128213, providing the sequence encoding a truncated HMG-CoA reductase; Saccharomyces cerevisiae), and (NC_001145: complement (115734.118898; Saccharomyces cerevisiae).

    [0169] 6.6.4 Conversion of Mevalonate to Mevalonate-5-Phosphate

    [0170] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can convert mevalonate into mevalonate 5-phosphate, e.g., a mevalonate kinase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (L77688; Arabidopsis thaliana), and (X55875; Saccharomyces cerevisiae).

    [0171] 6.6.5 Conversion of Mevalonate-5-Phosphate to Mevalonate-5-Pyrophosphate

    [0172] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can convert mevalonate 5-phosphate into mevalonate 5-pyrophosphate, e.g., a phosphomevalonate kinase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (AF429385; Hevea brasiliensis), (NM 006556; Homo sapiens), and (NC_001145. complement 712315.713670; Saccharomyces cerevisiae).

    [0173] 6.6.6 Conversion of Mevalonate-5-Pyrophosphate to IPP

    [0174] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can convert mevalonate 5-pyrophosphate into isopentenyl diphosphate (IPP), e.g., a mevalonate pyrophosphate decarboxylase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (X97557; Saccharomyces cerevisiae), (AF290095; Enterococcus faecium), and (U49260; Homo sapiens).

    [0175] 6.6.7 Conversion of IPP to DMAPP

    [0176] In some embodiments, the host cell further comprises a heterologous nucleotide sequence encoding an enzyme that can convert IPP generated via the MEV pathway into dimethylallyl pyrophosphate (DMAPP), e.g., an IPP isomerase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (NC_000913, 3031087.3031635; Escherichia coli), and (AF082326; Haematococcus pluvialis).

    [0177] 6.6.8 Polyprenyl Synthases

    [0178] In some embodiments, the host cell further comprises a heterologous nucleotide sequence encoding a polyprenyl synthase that can condense IPP and/or DMAPP molecules to form polyprenyl compounds containing more than five carbons.

    [0179] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can condense one molecule of IPP with one molecule of DMAPP to form one molecule of geranyl pyrophosphate (GPP), e.g., a GPP synthase. Illustrative examples of nucleotide sequences encoding such an enzyme include, but are not limited to: (AF513111; Abies grandis), (AF513112; Abies grandis), (AF513113; Abies grandis), (AY534686; Antirrhinum majus), (AY534687; Antirrhinum majus), (Y17376; Arabidopsis thaliana), (AE016877, Locus AP11092; Bacillus cereus; ATCC 14579), (AJ243739; Citrus sinensis), (AY534745; Clarkia breweri), (AY953508; Ips pini), (DQ286930; Lycopersicon esculentum), (AF182828; Menthapiperita), (AF182827; Menthapiperita), (MPI249453; Menthapiperita), (PZE431697, Locus CAD24425; Paracoccus zeaxanthinifaciens), (AY866498; Picrorhiza kurrooa), (AY351862; Vitis vinifera), and (AF203881, Locus AAF12843; Zymomonas mobilis).

    [0180] In some embodiments, the host cell comprises a heterologous nucleotide sequence encoding an enzyme that can condense two molecules of IPP with one molecule of DMAPP, or add a molecule of IPP to a molecule of GPP, to form a molecule of farnesyl pyrophosphate (FPP), e.g., a FPP synthase. Illustrative examples of nucleotide sequences that encode such an enzyme include, but are not limited to: (ATU80605; Arabidopsis thaliana), (ATHFPS2R; Arabidopsis thaliana), (AAU36376; Artemisia annua), (AF461050; Bos taurus), (D00694; Escherichia coli K-12), (AE009951, Locus AAL95523; Fusobacterium nucleatum subsp. nucleatum ATCC 25586), (GFFPPSGEN; Gibberella fujikuroi), (CP000009, Locus AAW60034; Gluconobacter oxydans 621H), (AF019892; Helianthus annuus), (HUMFAPS; Homo sapiens), (KLPFPSQCR; Kluyveromyces lactis), (LAU15777; Lupinus albus), (LAU20771; Lupinus albus), (AF309508; Mus musculus), (NCFPPSGEN; Neurospora crassa), (PAFPS1; Parthenium argentatum), (PAFPS2; Parthenium argentatum), (RATFAPS; Rattus norvegicus), (YSCFPP; Saccharomyces cerevisiae), (D89104; Schizosaccharomyces pombe), (CP000003, Locus AAT87386; Streptococcus pyogenes), (CP000017, Locus AAZ51849; Streptococcus pyogenes), (NC_008022, Locus YP_598856; Streptococcus pyogenes MGAS10270), (NC_008023, Locus YP_600845; Streptococcus pyogenes MGAS2096), (NC_008024, Locus YP_602832; Streptococcus pyogenes MGAS10750), (MZEFPS; Zea mays), (AE000657, Locus AAC06913; Aquifex aeolicus VF5), (NM 202836; Arabidopsis thaliana), (D84432, Locus BAA12575; Bacillus subtilis), (U12678, Locus AAC28894; Bradyrhizobium japonicum USDA 110), (BACFDPS; Geobacillus stearothermophilus), (NC_002940, Locus NP_873754; Haemophilus ducreyi 35000HP), (L42023, Locus AAC23087; Haemophilus influenzae Rd KW20), (J05262; Homo sapiens), (YP_395294; Lactobacillus sakei subsp. sakei 23K), (NC_005823, Locus YP_000273; Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130), (AB003187; Micrococcus luteus), (NC_002946, Locus YP_208768; Neisseria gonorrhoeae FA 1090), (U00090, Locus AAB91752; Rhizobium sp. NGR234), (J05091; Saccharomyces cerevisae), (CP000031, Locus AAV93568; Silicibacter pomeroyi DSS-3), (AE008481, Locus AAK99890; Streptococcus pneumoniae R6), and (NC_004556, Locus NP_779706; Xylella fastidiosa Temeculal).

    [0181] In some embodiments, the host cell further comprises a heterologous nucleotide sequence encoding an enzyme that can combine IPP and DMAPP or IPP and FPP to form geranylgeranyl pyrophosphate (GGPP). Illustrative examples of nucleotide sequences that encode such an enzyme include, but are not limited to: (ATHGERPYRS; Arabidopsis thaliana), (BT005328; Arabidopsis thaliana), (NM 119845; Arabidopsis thaliana), (NZ_AAJM01000380, Locus ZP_00743052; Bacillus thuringiensis serovar israelensis, ATCC 35646 sq1563), (CRGGPPS; Catharanthus roseus), (NZ AABF02000074, Locus ZP_00144509; Fusobacterium nucleatum subsp. vincentii, ATCC 49256), (GFGGPPSGN; Gibberella fujikuroi), (AY371321; Ginkgo biloba), (AB055496; Hevea brasiliensis), (AB017971; Homo sapiens), (MCI276129; Mucor circinelloides f. lusitanicus), (AB016044; Mus musculus), (AABX01000298, Locus NCU01427; Neurospora crassa), (NCU20940; Neurospora crassa), (NZ AAKL01000008, Locus ZP_00943566; Ralstonia solanacearum UW551), (AB118238; Rattus norvegicus), (SCU31632; Saccharomyces cerevisiae), (AB016095; Synechococcus elongates), (SAGGPS; Sinapis alba), (SSOGDS; Sulfolobus acidocaldarius), (NC_007759, Locus YP_461832; Syntrophus aciditrophicus SB), (NC_006840, Locus YP_204095; Vibrio fischeri ES114), (NM 112315; Arabidopsis thaliana), (ERWCRTE; Pantoea agglomerans), (D90087, Locus BAA14124; Pantoea ananatis), (X52291, Locus CAA36538; Rhodobacter capsulatus), (AF195122, Locus AAF24294; Rhodobacter sphaeroides), and (NC_004350, Locus NP_721015; Streptococcus mutans UA159).

    [0182] While examples of the enzymes of the mevalonate pathway are described above, in certain embodiments, enzymes of the DXP pathway can be used as an alternative or additional pathway to produce DMAPP and IPP in the host cells, compositions and methods described herein. Enzymes and nucleic acids encoding the enzymes of the DXP pathway are well-known and characterized in the art. WO 2012/135591 A2.

    6.7 Methods of Producing Steviol Glycosides

    [0183] In another aspect, provided herein is a method for the production of a steviol glycoside, the method comprising the steps of: (a) culturing a population of any of the genetically modified host cells described herein that are capable of producing a steviol glycoside in a medium with a carbon source under conditions suitable for making the steviol glycoside compound; and (b) recovering said steviol glycoside compound from the medium.

    [0184] In some embodiments, the genetically modified host cell produces an increased amount of the steviol glycoside compared to a parent cell not comprising the one or more modifications, or a parent cell comprising only a subset of the one or more modifications of the genetically modified host cell, but is otherwise genetically identical. In some embodiments, the increased amount is at least 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% or greater than 100%, as measured, for example, in yield, production, productivity, in grams per liter of cell culture, milligrams per gram of dry cell weight, on a per unit volume of cell culture basis, on a per unit dry cell weight basis, on a per unit volume of cell culture per unit time basis, or on a per unit dry cell weight per unit time basis.

    [0185] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is greater than about 10 grams per liter of fermentation medium. In some such embodiments, the steviol glycoside is produced in an amount from about 10 to about 50 grams, more than about 15 grams, more than about 20 grams, more than about 25 grams, or more than about 30 grams per liter of cell culture.

    [0186] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is greater than about 50 milligrams per gram of dry cell weight. In some such embodiments, the steviol glycoside is produced in an amount from about 50 to about 1500 milligrams, more than about 100 milligrams, more than about 150 milligrams, more than about 200 milligrams, more than about 250 milligrams, more than about 500 milligrams, more than about 750 milligrams, or more than about 1000 milligrams per gram of dry cell weight.

    [0187] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or at least about 1,000-fold, or more, higher than the level of steviol glycoside produced by a parent cell, on a per unit volume of cell culture basis.

    [0188] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or at least about 1,000-fold, or more, higher than the level of steviol glycoside produced by the parent cell, on a per unit dry cell weight basis.

    [0189] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or at least about 1,000-fold, or more, higher than the level of steviol glycoside produced by the parent cell, on a per unit volume of cell culture per unit time basis.

    [0190] In some embodiments, the host cell produces an elevated level of a steviol glycoside that is at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or at least about 1,000-fold, or more, higher than the level of steviol glycoside produced by the parent cell, on a per unit dry cell weight per unit time basis.

    [0191] In most embodiments, the production of the elevated level of steviol glycoside by the host cell is inducible by an inducing compound. Such a host cell can be manipulated with ease in the absence of the inducing compound. The inducing compound is then added to induce the production of the elevated level of steviol glycoside by the host cell. In other embodiments, production of the elevated level of steviol glycoside by the host cell is inducible by changing culture conditions, such as, for example, the growth temperature, media constituents, and the like.

    6.8 Culture Media and Conditions

    [0192] Materials and methods for the maintenance and growth of microbial cultures are well known to those skilled in the art of microbiology or fermentation science (see, for example, Bailey et al., Biochemical Engineering Fundamentals, second edition, McGraw Hill, New York, 1986). Consideration must be given to appropriate culture medium, pH, temperature, and requirements for aerobic, microaerobic, or anaerobic conditions, depending on the specific requirements of the host cell, the fermentation, and the process.

    [0193] The methods of producing steviol glycosides provided herein may be performed in a suitable culture medium (e.g., with or without pantothenate supplementation) in a suitable container, including but not limited to a cell culture plate, a flask, or a fermentor. Further, the methods can be performed at any scale of fermentation known in the art to support industrial production of microbial products. Any suitable fermentor may be used including a stirred tank fermentor, an airlift fermentor, a bubble fermentor, or any combination thereof. In particular embodiments utilizing Saccharomyces cerevisiae as the host cell, strains can be grown in a fermentor as described in detail by Kosaric, et al, in Ullmann's Encyclopedia of Industrial Chemistry, Sixth Edition, Volume 12, pages 398-473, Wiley-VCH Verlag GmbH & Co. KDaA, Weinheim, Germany.

    [0194] In some embodiments, the culture medium is any culture medium in which a genetically modified microorganism capable of producing an steviol glycoside can subsist, i.e., maintain growth and viability. In some embodiments, the culture medium is an aqueous medium comprising assimilable carbon, nitrogen and phosphate sources. Such a medium can also include appropriate salts, minerals, metals and other nutrients. In some embodiments, the carbon source and each of the essential cell nutrients, are added incrementally or continuously to the fermentation media, and each required nutrient is maintained at essentially the minimum level needed for efficient assimilation by growing cells, for example, in accordance with a predetermined cell growth curve based on the metabolic or respiratory function of the cells which convert the carbon source to a biomass.

    [0195] Suitable conditions and suitable media for culturing microorganisms are well known in the art. In some embodiments, the suitable medium is supplemented with one or more additional agents, such as, for example, an inducer (e.g., when one or more nucleotide sequences encoding a gene product are under the control of an inducible promoter), a repressor (e.g., when one or more nucleotide sequences encoding a gene product are under the control of a repressible promoter), or a selection agent (e.g., an antibiotic to select for microorganisms comprising the genetic modifications).

    [0196] In some embodiments, the carbon source is a monosaccharide (simple sugar), a disaccharide, a polysaccharide, a non-fermentable carbon source, or one or more combinations thereof. Non-limiting examples of suitable monosaccharides include glucose, galactose, mannose, fructose, xylose, ribose, and combinations thereof. Non-limiting examples of suitable disaccharides include sucrose, lactose, maltose, trehalose, cellobiose, and combinations thereof. Non-limiting examples of suitable polysaccharides include starch, glycogen, cellulose, chitin, and combinations thereof. Non-limiting examples of suitable non-fermentable carbon sources include acetate and glycerol.

    [0197] The concentration of a carbon source, such as glucose, in the culture medium should promote cell growth, but not be so high as to repress growth of the microorganism used. Typically, cultures are run with a carbon source, such as glucose, being added at levels to achieve the desired level of growth and biomass, but at undetectable levels (with detection limits being about <0.1 g/l). In other embodiments, the concentration of a carbon source, such as glucose, in the culture medium is greater than about 1 g/L, preferably greater than about 2 g/L, and more preferably greater than about 5 g/L. In addition, the concentration of a carbon source, such as glucose, in the culture medium is typically less than about 100 g/L, preferably less than about 50 g/L, and more preferably less than about 20 g/L. It should be noted that references to culture component concentrations can refer to both initial and/or ongoing component concentrations. In some cases, it may be desirable to allow the culture medium to become depleted of a carbon source during culture.

    [0198] Sources of assimilable nitrogen that can be used in a suitable culture medium include, but are not limited to, simple nitrogen sources, organic nitrogen sources and complex nitrogen sources. Such nitrogen sources include anhydrous ammonia, ammonium salts and substances of animal, vegetable and/or microbial origin. Suitable nitrogen sources include, but are not limited to, protein hydrolysates, microbial biomass hydrolysates, peptone, yeast extract, ammonium sulfate, urea, and amino acids. Typically, the concentration of the nitrogen sources, in the culture medium is greater than about 0.1 g/L, preferably greater than about 0.25 g/L, and more preferably greater than about 1.0 g/L. Beyond certain concentrations, however, the addition of a nitrogen source to the culture medium is not advantageous for the growth of the microorganisms. As a result, the concentration of the nitrogen sources, in the culture medium is less than about 20 g/L, preferably less than about 10 g/L and more preferably less than about 5 g/L. Further, in some instances it may be desirable to allow the culture medium to become depleted of the nitrogen sources during culture.

    [0199] The effective culture medium can contain other compounds such as inorganic salts, vitamins, trace metals or growth promoters. Such other compounds can also be present in carbon, nitrogen or mineral sources in the effective medium or can be added specifically to the medium.

    [0200] The culture medium can also contain a suitable phosphate source. Such phosphate sources include both inorganic and organic phosphate sources. Preferred phosphate sources include, but are not limited to, phosphate salts such as mono or dibasic sodium and potassium phosphates, ammonium phosphate and mixtures thereof. Typically, the concentration of phosphate in the culture medium is greater than about 1.0 g/L, preferably greater than about 2.0 g/L and more preferably greater than about 5.0 g/L. Beyond certain concentrations, however, the addition of phosphate to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of phosphate in the culture medium is typically less than about 20 g/L, preferably less than about 15 g/L and more preferably less than about 10 g/L.

    [0201] A suitable culture medium can also include a source of magnesium, preferably in the form of a physiologically acceptable salt, such as magnesium sulfate heptahydrate, although other magnesium sources in concentrations that contribute similar amounts of magnesium can be used. Typically, the concentration of magnesium in the culture medium is greater than about 0.5 g/L, preferably greater than about 1.0 g/L, and more preferably greater than about 2.0 g/L. Beyond certain concentrations, however, the addition of magnesium to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of magnesium in the culture medium is typically less than about 10 g/L, preferably less than about 5 g/L, and more preferably less than about 3 g/L. Further, in some instances it may be desirable to allow the culture medium to become depleted of a magnesium source during culture.

    [0202] In some embodiments, the culture medium can also include a biologically acceptable chelating agent, such as the dihydrate of trisodium citrate. In such instance, the concentration of a chelating agent in the culture medium is greater than about 0.2 g/L, preferably greater than about 0.5 g/L, and more preferably greater than about 1 g/L. Beyond certain concentrations, however, the addition of a chelating agent to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the concentration of a chelating agent in the culture medium is typically less than about 10 g/L, preferably less than about 5 g/L, and more preferably less than about 2 g/L.

    [0203] The culture medium can also initially include a biologically acceptable acid or base to maintain the desired pH of the culture medium. Biologically acceptable acids include, but are not limited to, hydrochloric acid, sulfuric acid, nitric acid, phosphoric acid and mixtures thereof. Biologically acceptable bases include, but are not limited to, ammonium hydroxide, sodium hydroxide, potassium hydroxide and mixtures thereof. In some embodiments, the base used is ammonium hydroxide.

    [0204] The culture medium can also include a biologically acceptable calcium source, including, but not limited to, calcium chloride. Typically, the concentration of the calcium source, such as calcium chloride, dihydrate, in the culture medium is within the range of from about 5 mg/L to about 2000 mg/L, preferably within the range of from about 20 mg/L to about 1000 mg/L, and more preferably in the range of from about 50 mg/L to about 500 mg/L.

    [0205] The culture medium can also include sodium chloride. Typically, the concentration of sodium chloride in the culture medium is within the range of from about 0.1 g/L to about 5 g/L, preferably within the range of from about 1 g/L to about 4 g/L, and more preferably in the range of from about 2 g/L to about 4 g/L.

    [0206] In some embodiments, the culture medium can also include trace metals. Such trace metals can be added to the culture medium as a stock solution that, for convenience, can be prepared separately from the rest of the culture medium. Typically, the amount of such a trace metals solution added to the culture medium is greater than about 1 mL/L, preferably greater than about 5 mL/L, and more preferably greater than about 10 mL/L. Beyond certain concentrations, however, the addition of a trace metals to the culture medium is not advantageous for the growth of the microorganisms. Accordingly, the amount of such a trace metals solution added to the culture medium is typically less than about 100 mL/L, preferably less than about 50 mL/L, and more preferably less than about 30 mL/L. It should be noted that, in addition to adding trace metals in a stock solution, the individual components can be added separately, each within ranges corresponding independently to the amounts of the components dictated by the above ranges of the trace metals solution.

    [0207] The culture media can include other vitamins, such as pantothenate, biotin, calcium, pantothenate, inositol, pyridoxine-HCl, and thiamine-HCl. Such vitamins can be added to the culture medium as a stock solution that, for convenience, can be prepared separately from the rest of the culture medium. Beyond certain concentrations, however, the addition of vitamins to the culture medium is not advantageous for the growth of the microorganisms.

    [0208] The fermentation methods described herein can be performed in conventional culture modes, which include, but are not limited to, batch, fed-batch, cell recycle, continuous and semi-continuous. In some embodiments, the fermentation is carried out in fed-batch mode. In such a case, some of the components of the medium are depleted during culture, including pantothenate during the production stage of the fermentation. In some embodiments, the culture may be supplemented with relatively high concentrations of such components at the outset, for example, of the production stage, so that growth and/or steviol glycoside production is supported for a period of time before additions are required. The preferred ranges of these components are maintained throughout the culture by making additions as levels are depleted by culture. Levels of components in the culture medium can be monitored by, for example, sampling the culture medium periodically and assaying for concentrations. Alternatively, once a standard culture procedure is developed, additions can be made at timed intervals corresponding to known levels at particular times throughout the culture. As will be recognized by those in the art, the rate of consumption of nutrient increases during culture as the cell density of the medium increases. Moreover, to avoid introduction of foreign microorganisms into the culture medium, addition is performed using aseptic addition methods, as are known in the art. In addition, a small amount of anti-foaming agent may be added during the culture.

    [0209] The temperature of the culture medium can be any temperature suitable for growth of the genetically modified cells and/or production of steviol glycoside. For example, prior to inoculation of the culture medium with an inoculum, the culture medium can be brought to and maintained at a temperature in the range of from about 20 C. to about 45 C., preferably to a temperature in the range of from about 25 C. to about 40 C., and more preferably in the range of from about 28 C. to about 32 C.

    [0210] The pH of the culture medium can be controlled by the addition of acid or base to the culture medium. In such cases when ammonia is used to control pH, it also conveniently serves as a nitrogen source in the culture medium. Preferably, the pH is maintained from about 3.0 to about 8.0, more preferably from about 3.5 to about 7.0, and most preferably from about 4.0 to about 6.5.

    [0211] In some embodiments, the carbon source concentration, such as the glucose concentration, of the culture medium is monitored during culture. Glucose concentration of the culture medium can be monitored using known techniques, such as, for example, use of the glucose oxidase enzyme test or high pressure liquid chromatography, which can be used to monitor glucose concentration in the supernatant, e.g., a cell-free component of the culture medium. As stated previously, the carbon source concentration should be kept below the level at which cell growth inhibition occurs. Although such concentration may vary from organism to organism, for glucose as a carbon source, cell growth inhibition occurs at glucose concentrations greater than at about 60 g/L, and can be determined readily by trial. Accordingly, when glucose is used as a carbon source the glucose is preferably fed to the fermentor and maintained below detection limits. Alternatively, the glucose concentration in the culture medium is maintained in the range of from about 1 g/L to about 100 g/L, more preferably in the range of from about 2 g/L to about 50 g/L, and yet more preferably in the range of from about 5 g/L to about 20 g/L. Although the carbon source concentration can be maintained within desired levels by addition of, for example, a substantially pure glucose solution, it is acceptable, and may be preferred, to maintain the carbon source concentration of the culture medium by addition of aliquots of the original culture medium. The use of aliquots of the original culture medium may be desirable because the concentrations of other nutrients in the medium (e.g. the nitrogen and phosphate sources) can be maintained simultaneously. Likewise, the trace metals concentrations can be maintained in the culture medium by addition of aliquots of the trace metals solution.

    [0212] Other suitable fermentation medium and methods are described in, e.g., WO 2016/196321.

    6.9 Fermentation Compositions

    [0213] In another aspect, provided herein are fermentation compositions comprising a genetically modified host cell described herein and steviol glycosides produced from genetically modified host cell. The fermentation compositions may further comprise a medium. In certain embodiments, the fermentation compositions comprise a genetically modified host cell, and further comprise RebA, RebD, and RebM. In certain embodiments, the fermentation compositions provided herein comprise RebM as a major component of the steviol glycosides produced from the genetically modified host cell. In certain embodiments, the fermentation compositions comprise RebA, RebD, and RebM at a ratio of at least 1:7:50. In certain embodiments, the fermentation compositions comprise RebA, RebD, and RebM at a ratio of at least 1:7:50 to 1:100:1000. In certain embodiments, the fermentation compositions comprise a ratio of at least 1:7:50 to 1:200:2000. In certain embodiments, the ratio of RebA, RebD, and RebM are based on the total content of steviol glycosides that are associated with the genetically modified host cell and the medium. In certain embodiments, the ratio of RebA, RebD, and RebM are based on the total content of steviol glycosides in the medium. In certain embodiments, the ratio of RebA, RebD, and RebM are based on the total content of steviol glycosides that are associated with the genetically modified host cell.

    [0214] In certain embodiments, the fermentation compositions provided herein contain RebM2 at an undetectable level. In certain embodiments, the fermentation compositions provided herein contain non-naturally occurring steviol glycosides at an undetectable level. In certain embodiments, the fermentation compositions provided herein, when subjected to GC-chromatography, does not produce a steviol+2 glucose peak between a RebA peak and a RebB at a detectable level.

    6.10 Recovery of Steviol Glycosides

    [0215] Once the steviol glycoside is produced by the host cell, it may be recovered or isolated for subsequent use using any suitable separation and purification methods known in the art. In some embodiments, an organic phase comprising the steviol glycoside is separated from the fermentation by centrifugation. In other embodiments, an organic phase comprising the steviol glycoside separates from the fermentation spontaneously. In other embodiments, an organic phase comprising the steviol glycoside is separated from the fermentation by adding a demulsifier and/or a nucleating agent into the fermentation reaction. Illustrative examples of demulsifiers include flocculants and coagulants. Illustrative examples of nucleating agents include droplets of the steviol glycoside itself and organic solvents such as dodecane, isopropyl myristrate, and methyl oleate.

    [0216] The steviol glycoside produced in these cells may be present in the culture supernatant and/or associated with the host cells. In embodiments where the steviol glycoside is associated with the host cell, the recovery of the steviol glycoside may comprise a method of permeabilizing or lysing the cells. Alternatively or simultaneously, the steviol glycoside in the culture medium can be recovered using a recovery process including, but not limited to, chromatography, extraction, solvent extraction, membrane separation, electrodialysis, reverse osmosis, distillation, chemical derivatization and crystallization.

    [0217] In some embodiments, the steviol glycoside is separated from other products that may be present in the organic phase. In some embodiments, separation is achieved using adsorption, distillation, gas-liquid extraction (stripping), liquid-liquid extraction (solvent extraction), vacuum extraction, evaporation, ultrafiltration, and standard chromatographic techniques. Other suitable fermentation medium and methods are described in, e.g., US 2016/0185813.

    6.11 Methods of Making Genetically Modified Cells

    [0218] Also provided herein are methods for producing a host cell that is genetically engineered to comprise one or more of the modifications described above, e.g., one or more nucleic heterologous nucleic acids encoding Pisum sativum kaurene oxidase, and/or biosynthetic pathway enzymes, e.g., for a steviol glycoside compound. Expression of a heterologous enzyme in a host cell can be accomplished by introducing into the host cells a nucleic acid comprising a nucleotide sequence encoding the enzyme under the control of regulatory elements that permit expression in the host cell. In some embodiments, the nucleic acid is an extrachromosomal plasmid. In other embodiments, the nucleic acid is a chromosomal integration vector that can integrate the nucleotide sequence into the chromosome of the host cell.

    [0219] Nucleic acids encoding these proteins can be introduced into the host cell by any method known to one of skill in the art without limitation (see, for example, Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA 75:1292-3; Cregg et al. (1985) Mol. Cell. Biol. 5:3376-3385; Goeddel et al. eds, 1990, Methods in Enzymology, vol. 185, Academic Press, Inc; CA; Krieger, 1990, Gene Transfer and ExpressionA Laboratory Manual, Stockton Press, NY; Sambrook et al., 1989, Molecular CloningA Laboratory Manual, Cold Spring Harbor Laboratory, NY; and Ausubel et al., eds., Current Edition, Current Protocols in Molecular Biology, Greene Publishing Associates and Wiley Interscience, NY). Exemplary techniques include, but are not limited to, spheroplasting, electroporation, PEG 1000 mediated transformation, and lithium acetate or lithium chloride mediated transformation.

    [0220] The copy number of an enzyme in a host cell may be altered by modifying the transcription of the gene that encodes the enzyme. This can be achieved for example by modifying the copy number of the nucleotide sequence encoding the enzyme (e.g., by using a higher or lower copy number expression vector comprising the nucleotide sequence, or by introducing additional copies of the nucleotide sequence into the genome of the host cell or by deleting or disrupting the nucleotide sequence in the genome of the host cell), by changing the order of coding sequences on a polycistronic mRNA of an operon or breaking up an operon into individual genes each with its own control elements, or by increasing the strength of the promoter or operator to which the nucleotide sequence is operably linked. Alternatively or in addition, the copy number of an enzyme in a host cell may be altered by modifying the level of translation of an mRNA that encodes the enzyme. This can be achieved for example by modifying the stability of the mRNA, modifying the sequence of the ribosome binding site, modifying the distance or sequence between the ribosome binding site and the start codon of the enzyme coding sequence, modifying the entire intercistronic region located upstream of or adjacent to the 5 side of the start codon of the enzyme coding region, stabilizing the 3-end of the mRNA transcript using hairpins and specialized sequences, modifying the codon usage of enzyme, altering expression of rare codon tRNAs used in the biosynthesis of the enzyme, and/or increasing the stability of the enzyme, as, for example, via mutation of its coding sequence.

    [0221] The activity of an enzyme in a host cell can be altered in a number of ways, including, but not limited to, expressing a modified form of the enzyme that exhibits increased or decreased solubility in the host cell, expressing an altered form of the enzyme that lacks a domain through which the activity of the enzyme is inhibited, expressing a modified form of the enzyme that has a higher or lower Kcat or a lower or higher Km for the substrate, or expressing an altered form of the enzyme that is more or less affected by feed-back or feed-forward regulation by another molecule in the pathway.

    [0222] In some embodiments, a nucleic acid used to genetically modify a host cell comprises one or more selectable markers useful for the selection of transformed host cells and for placing selective pressure on the host cell to maintain the foreign DNA.

    [0223] In some embodiments, the selectable marker is an antibiotic resistance marker. Illustrative examples of antibiotic resistance markers include, but are not limited to, the BLA, NAT1, PAT, AUR1-C, PDR4, SMR1, CAT, mouse dhfr, HPH, DSDA, KAN.sup.R, and SH BLE gene products. The BLA gene product from E. coli confers resistance to beta-lactam antibiotics (e.g., narrow-spectrum cephalosporins, cephamycins, and carbapenems (ertapenem), cefamandole, and cefoperazone) and to all the anti-gram-negative-bacterium penicillins except temocillin; the NAT1 gene product from S. noursei confers resistance to nourseothricin; the PAT gene product from S. viridochromogenes Tu94 confers resistance to bialophos; the AUR1-C gene product from Saccharomyces cerevisiae confers resistance to Auerobasidin A (AbA); the PDR4 gene product confers resistance to cerulenin; the SMR1 gene product confers resistance to sulfometuron methyl; the CAT gene product from Tn9 transposon confers resistance to chloramphenicol; the mouse dhfr gene product confers resistance to methotrexate; the HPH gene product of Klebsiella pneumonia confers resistance to Hygromycin B; the DSDA gene product of E. coli allows cells to grow on plates with D-serine as the sole nitrogen source; the KAN.sup.R gene of the Tn903 transposon confers resistance to G418; and the SH BLE gene product from Streptoalloteichus hindustanus confers resistance to Zeocin (bleomycin). In some embodiments, the antibiotic resistance marker is deleted after the genetically modified host cell disclosed herein is isolated.

    [0224] In some embodiments, the selectable marker rescues an auxotrophy (e.g., a nutritional auxotrophy) in the genetically modified microorganism. In such embodiments, a parent microorganism comprises a functional disruption in one or more gene products that function in an amino acid or nucleotide biosynthetic pathway and that when non-functional renders a parent cell incapable of growing in media without supplementation with one or more nutrients. Such gene products include, but are not limited to, the HIS3, LEU2, LYS1, LYS2, MET15, TRP1, ADE2, and URA3 gene products in yeast. The auxotrophic phenotype can then be rescued by transforming the parent cell with an expression vector or chromosomal integration construct encoding a functional copy of the disrupted gene product, and the genetically modified host cell generated can be selected for based on the loss of the auxotrophic phenotype of the parent cell. Utilization of the URA3, TRP1, and LYS2 genes as selectable markers has a marked advantage because both positive and negative selections are possible. Positive selection is carried out by auxotrophic complementation of the URA3, TRP1, and LYS2 mutations, whereas negative selection is based on specific inhibitors, i.e., 5-fluoro-orotic acid (FOA), 5-fluoroanthranilic acid, and aminoadipic acid (aAA), respectively, that prevent growth of the prototrophic strains but allows growth of the URA3, TRP1, and LYS2 mutants, respectively. In other embodiments, the selectable marker rescues other non-lethal deficiencies or phenotypes that can be identified by a known selection method.

    [0225] Described herein are specific genes and proteins useful in the methods, compositions and organisms of the disclosure; however it will be recognized that absolute identity to such genes is not necessary. For example, changes in a particular gene or polynucleotide comprising a sequence encoding a polypeptide or enzyme can be performed and screened for activity. Typically such changes comprise conservative mutations and silent mutations. Such modified or mutated polynucleotides and polypeptides can be screened for expression of a functional enzyme using methods known in the art.

    [0226] Due to the inherent degeneracy of the genetic code, other polynucleotides which encode substantially the same or functionally equivalent polypeptides can also be used to clone and express the polynucleotides encoding such enzymes.

    [0227] As will be understood by those of skill in the art, it can be advantageous to modify a coding sequence to enhance its expression in a particular host. The genetic code is redundant with 64 possible codons, but most organisms typically use a subset of these codons. The codons that are utilized most often in a species are called optimal codons, and those not utilized very often are classified as rare or low-usage codons. Codons can be substituted to reflect the preferred codon usage of the host, in a process sometimes called codon optimization or controlling for species codon bias. Codon optimization for other host cells can be readily determined using codon usage tables or can be performed using commercially available software, such as CodonOp (www.idtdna.com/CodonOptfrom) from Integrated DNA Technologies.

    [0228] Optimized coding sequences containing codons preferred by a particular prokaryotic or eukaryotic host (Murray et al., 1989, Nucl Acids Res. 17: 477-508) can be prepared, for example, to increase the rate of translation or to produce recombinant RNA transcripts having desirable properties, such as a longer half-life, as compared with transcripts produced from a non-optimized sequence. Translation stop codons can also be modified to reflect host preference. For example, typical stop codons for S. cerevisiae and mammals are UAA and UGA, respectively. The typical stop codon for monocotyledonous plants is UGA, whereas insects and E. coli commonly use UAA as the stop codon (Dalphin et al., 1996, Nucl Acids Res. 24: 216-8).

    [0229] Those of skill in the art will recognize that, due to the degenerate nature of the genetic code, a variety of DNA molecules differing in their nucleotide sequences can be used to encode a given enzyme of the disclosure. The native DNA sequence encoding the biosynthetic enzymes described above are referenced herein merely to illustrate an embodiment of the disclosure, and the disclosure includes DNA molecules of any sequence that encode the amino acid sequences of the polypeptides and proteins of the enzymes utilized in the methods of the disclosure. In similar fashion, a polypeptide can typically tolerate one or more amino acid substitutions, deletions, and insertions in its amino acid sequence without loss or significant loss of a desired activity. The disclosure includes such polypeptides with different amino acid sequences than the specific proteins described herein so long as the modified or variant polypeptides have the enzymatic anabolic or catabolic activity of the reference polypeptide. Furthermore, the amino acid sequences encoded by the DNA sequences shown herein merely illustrate embodiments of the disclosure.

    [0230] In addition, homologs of enzymes useful for the compositions and methods provided herein are encompassed by the disclosure. In some embodiments, two proteins (or a region of the proteins) are substantially homologous when the amino acid sequences have at least about 30%, 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In one embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, typically at least 40%, more typically at least 50%, even more typically at least 60%, and even more typically at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid identity is equivalent to amino acid or nucleic acid homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.

    [0231] When homologous is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions. A conservative amino acid substitution is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of homology may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art (See, e.g., Pearson W. R., 1994, Methods in Mol Biol 25: 365-89).

    [0232] The following six groups each contain amino acids that are conservative substitutions for one another: 1) Serine (S), Threonine (T); 2) Aspartic Acid (D), Glutamic Acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Alanine (A), Valine (V), and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).

    [0233] Sequence homology for polypeptides, which is also referred to as percent sequence identity, is typically measured using sequence analysis software. A typical algorithm used comparing a molecule sequence to a database containing a large number of sequences from different organisms is the computer program BLAST. When searching a database containing sequences from a large number of different organisms, it is typical to compare amino acid sequences.

    [0234] Furthermore, any of the genes encoding the foregoing enzymes (or any others mentioned herein (or any of the regulatory elements that control or modulate expression thereof)) may be optimized by genetic/protein engineering techniques, such as directed evolution or rational mutagenesis, which are known to those of ordinary skill in the art. Such action allows those of ordinary skill in the art to optimize the enzymes for expression and activity in yeast.

    [0235] In addition, genes encoding these enzymes can be identified from other fungal and bacterial species and can be expressed for the modulation of this pathway. A variety of organisms could serve as sources for these enzymes, including, but not limited to, Saccharomyces spp., including S. cerevisiae and S. uvarum, Kluyveromyces spp., including K. thermotolerans, K. lactis, and K. marxianus, Pichia spp., Hansenula spp., including H. polymorpha, Candida spp., Trichosporon spp., Yamadazyma spp., including Y. spp. stipitis, Torulaspora pretoriensis, Issatchenkia orientalis, Schizosaccharomyces spp., including S. pombe, Cryptococcus spp., Aspergillus spp., Neurospora spp., or Ustilago spp. Sources of genes from anaerobic fungi include, but are not limited to, Piromyces spp., Orpinomyces spp., or Neocallimastix spp. Sources of prokaryotic enzymes that are useful include, but are not limited to, Escherichia. coli, Zymomonas mobilis, Staphylococcus aureus, Bacillus spp., Clostridium spp., Corynebacterium spp., Pseudomonas spp., Lactococcus spp., Enterobacter spp., and Salmonella spp.

    [0236] Techniques known to those skilled in the art may be suitable to identify additional homologous genes and homologous enzymes. Generally, analogous genes and/or analogous enzymes can be identified by functional analysis and will have functional similarities. Techniques known to those skilled in the art may be suitable to identify analogous genes and analogous enzymes. For example, to identify homologous or analogous UDP glycosyltransferases, PTA, or any biosynthetic pathway genes, proteins, or enzymes, techniques may include, but are not limited to, cloning a gene by PCR using primers based on a published sequence of a gene/enzyme of interest, or by degenerate PCR using degenerate primers designed to amplify a conserved region among a gene of interest. Further, one skilled in the art can use techniques to identify homologous or analogous genes, proteins, or enzymes with functional homology or similarity. Techniques include examining a cell or cell culture for the catalytic activity of an enzyme through in vitro enzyme assays for said activity (e.g. as described herein or in Kiritani, K., Branched-Chain Amino Acids Methods Enzymology, 1970), then isolating the enzyme with said activity through purification, determining the protein sequence of the enzyme through techniques such as Edman degradation, design of PCR primers to the likely nucleic acid sequence, amplification of said DNA sequence through PCR, and cloning of said nucleic acid sequence. To identify homologous or similar genes and/or homologous or similar enzymes, analogous genes and/or analogous enzymes or proteins, techniques also include comparison of data concerning a candidate gene or enzyme with databases such as BRENDA, KEGG, or MetaCYC. The candidate gene or enzyme may be identified within the above mentioned databases in accordance with the teachings herein.

    7. EXAMPLES

    Example 1: Generation of a Base Yeast Strain Capable of High Flux to Farnesylpyrophosphate (FPP) and the Isoprenoid Farnesene

    [0237] A farnesene production strain was created from a wild-type Saccharomyces cerevisiae strain (CEN.PK2) by expressing the genes of the mevalonate pathway (FIG. 1D) under the control of GAL1 or GAL10 promoters. This strain comprised the following chromosomally integrated mevalonate pathway genes from S. cerevisiae: acetyl-CoA thiolase, HMG-CoA synthase, HMG-CoA reductase, mevalonate kinase, phosphomevalonate kinase, mevalonate pyrophosphate decarboxylase, and IPP:DMAPP isomerase. All genes described herein were codon optimized using publicly available or other suitable algorithms. In addition, the strain contained six copies of farnesene synthase from Artemisinin annua, also under the control of either GAL1 or GAL10 promoters. The strain also contained a deletion of the GAL80 gene and an additional copy of GAL4 under GAL4oc promoter, wherein the coding sequence of the GAL4 gene of Saccharomyces cerevisiae is under regulatory control of an operative constitutive version of its native promoter (PGAL4oc; see, e.g., Griggs & Johnston (1991) PNAS 88(19):8597-8601). Lastly the ERGS gene, encoding squalene synthase, is downregulated by replacing the native promoter with promoter of the yeast gene MET3 (Westfall et al PNAS 2012).

    Example 2. Generation of a Base Yeast Strain Capable of High Flux to Rebaudioside A (RebA)

    [0238] FIG. 1B shows an exemplary biosynthetic pathway from FPP to the steviol. FIG. 2 shows an exemplary biosynthetic pathway from steviol to glycoside RebM. To convert the farnesene base strain described above to have high flux to the C-20 isoprenoid kaurene, six copies of a geranylgeranylpyrophosphate synthase (GGPPs) were integrated into the genome, followed by four copies each of a copalyldiphosphate synthase and kaurene synthase. Table 1 lists all genes and promoters used to convert FPP to RebA. At this point, the six copies of farnesene synthase were removed from the strain. Once the new strain was confirmed to make ent-kaurene, the remaining genes for converting ent-kaurene to RebA were inserted into the genome. Each gene was integrated with a single copy, except for the Sr.KAH enzyme which had two copies (Table 1.) The strain containing all genes described in Table 1 primarily produced RebA. The enzyme UGT91D_like3 has some low activity to convert RebA to Rebaudioside D (RebD). We measured a single copy of 91D_like3 is able to convert approximately (3%) of the RebA in the strain to RebD in vivo in the yeast strain described above (FIG. 3 and Table 2). UGT76G1 then can convert RebD to the final product Rebaudioside M (RebM).

    Example 3. Screening Kaurene Oxidase (KO) Enzymes to Convert Kaurene to Kaurenoic Acid with Higher Efficiency

    [0239] To generate a strain with high flux to RebM, the strain described in Example 2 was transformed with a single copy of the gene UGT40087 (as described in Example 8 and the tables and figures in PCT Application AM-7400 PCT, which is attached as an appendix herein) under the GAL1 promoter. This strain produces primarily RebM. To screen different KO alleles for the conversion of kaurene to kaurenoic acid in vivo, the Stevia rebuaudiana KO gene in this RebM strain was removed and replaced with a landing pad containing only the GAL1 promoter and terminator, with a F-CphI restriction sequence in between the promoter and terminator (FIG. 3). This screening strain now lacks any KO enzyme and only makes ent-kaurene.

    [0240] Thirteen KO enzymes (Table 1) obtained from the literature were codon optimized for optimal expression in S. cerevisiae and synthesized with 60 bp of sequence homologous to the PGAL1 and yeast terminator flanking the F-CphI sequences in the landing pad described in FIG. 3A. Each synthesized KO gene was tested individually, with a single copy, for the ability to convert ent-kaurene to kaurenoic acid in vivo in the yeast strain described above. Yeast were transformed with KO donor DNA and a plasmid containing the endonuclease F-CphI to cut the DNA in the landing pad. Correct integrations were verified by colony PCR using a reverse primer internal to the specific KO gene in each transformation and a universal forward primer at the end of the GAL1 promoter. FIG. 3B shows the final genetic construct after correct F-CphI cutting and homologous recombination with a KO DNA.

    TABLE-US-00002 TABLE 1 Kaurene oxidase enzymes tested in yeast for higher conversion of kaurene to kaurenoic acid. Uniprot Species Abbreviation number SEQ ID NO Arabidopsis thaliana At Q93ZB2 SEQ ID NO: 3 Cucurbita maxima Cm Q9FQY5 SEQ ID NO: 4 Cucumis sativus Cs J7I3T1 SEQ ID NO: 5 Gibberella fujikuroi Gf O94142 SEQ ID NO: 6 Gibberella moniliformis Gm B6HY18 SEQ ID NO: 7 Lactuca sativa Ls_1 B5MEX5 SEQ ID NO: 8 Lactuca sativa Ls_2 B5MEX6 SEQ ID NO: 9 Oryza sativa subsp. Os Q5Z5R4 SEQ ID NO: 10 japonica Physcomitrella patens Pp A9TVB8 SEQ ID NO: 11 subsp. patens Pisum Sativum Ps Q6XAF4 SEQ ID NO: 1 Sphaceloma manihoticola Sm B5DBY4 SEQ ID NO: 12 Stevia rebaudiana Sr Q4VCL5 SEQ ID NO: 2 Zea mays Zm B4FYL7 SEQ ID NO: 13

    [0241] FIG. 4 shows the results of the KO screen. One KO enzyme (Ps.KO), from the plant Pisum sativum (garden pea), was found to have increased ability (improved approximately 3.5) to convert ent-kaurene to kaurenoic acid compared to the KO enzyme from over Stevia rebaudiana (Sr.KO) in this strain background. The codon optimized nucleic acid sequence of Pisum sativum KO enzyme used for expression in yeast cells are shown as SEQ ID NO:15.

    Example 4. Generation of a High Flux RebM Strain with Improved Conversion of Ent-Kaurene to Kaurenoic Acid

    [0242] The activity of Ps.KO was then tested against the Sr.KO in a strain with very high flux to RebM. The KO enzymes normally act in most plants to produce the plant hormone gibberellin. Levels of gibberellin in plant cells are orders of magnitude lower than the levels of RebM produced in yeast for industrial production, and therefore the KO enzymes are not expected to carry the high flux required to produce RebM for commercial manufacturing. Table 3 lists all genes and promoters contained in a strain with higher RebM flux than the strain used to initially screen the KO enzymes (i.e. the KO base strain). All genes in Table 3 were inserted into the yeast genome. The KO enzyme takes ent-kaurene through three rounds of subsequent oxidation to produce kaurenoic acid. The order of reactions and intermediates are: the first oxidation takes ent-kaurene to kaurenol (K-OL), the second oxidation takes kaurenol to kaurenal (K-AL), and the third oxidation takes kaurenal to kaurenoic acid (-acid) (FIG. 1C). To achieve the maximum flux from ent-kaurene to RebM, the KO enzyme should completely oxidize ent-kaurene to K-acid. Incomplete conversion will waste carbon, reduce overall RebM titers, and produce potentially toxic intermediate compounds. Data in FIG. 5 show that in a strain with high carbon flux to RebM, the Sr.KO allele accumulates significant quantities of the upstream intermediates ent-kaurene, kaurenol (K-OL), kaurenal (K-AL), whereas the Ps.KO enzyme shows significantly reduced accumulation of these intermediates.

    [0243] FIG. 6 shows that the Ps.KO increases the amount of RebM made in the cell, due to the higher amount of kaurenoic acid produced with Ps.KO compared to Sr.KO. In the high flux RebM strain, there is an increase of 16% of RebM titers in a strain with Ps.KO compared to an identical strain with Sr.KO. This higher RebM titer is due to more kaurenoic acid being produced in the Ps.KO strain.

    Example 5. Yeast Culturing Conditions

    [0244] Yeast colonies verified to contain the expected kaurene oxidase gene were picked into 96-well microtiter plates containing Bird Seed Media (BSM, originally described by van Hoek et al., Biotechnology and Bioengineering 68(5), 2000, pp. 517-523) with 20 g/L sucrose and 37.5 g/L ammonium sulfate. Cells were cultured at 30 C. in a high capacity microtiter plate incubator shaking at 1000 RPM and 80% humidity for 3 days until the cultures reached carbon exhaustion. The growth-saturated cultures were subcultured into fresh plates containing BSM with 40 g/L sucrose and 150 g/L ammonium sulfate by taking 14.4 L from the saturated cultures and diluting into 360 L of fresh media. Cells in the production media were cultured at 30 C. in a high capacity microtiter plate shaker at 1000 RPM and 80% humidity for an additional 3 days prior to extraction and analysis. Upon completion the whole cell broth is diluted with 360 L of 100% ethanol, sealed with a foil seal, and shaken at 1250 rpm for 30 min to extract the rebaudiosides. 490 L of 50:50 ethanol:water is added to a new 1.1-mL assay plate and 10 uL of the culture/ethanol mixture is added to the assay plate. The mixture is centrifuged to pellet any solids, and 400 L of the solution is transferred to a new 1.1-mL plate and assayed by LC-MS.

    Example 6. Analytical Methods

    Mass Spectrometer Detection of Steviol and Steviol Glycosides:

    [0245] Samples are analyzed by LC-MS mass spectrometer (AB QTrap 4000) using a Sigma Ascentis Express Peptide ES-C18 (5 cm, 2.1 mm, 2.7 m; part #53301-U) with the following gradient:

    TABLE-US-00003 Time (min) % B 1 0 25 2 2.50 25 3 10.00 60 4 10.50 100 5 12.50 100 6 12.51 25 Mobile Phase A: Water + 0.1% formic acid Mobile Phase B: Acetonitrile + 0.1% formic acid Flow Rate: 250 uL/min

    [0246] The mass spectrometer was operated in negative ion multiple reaction monitoring mode. Each rebaudioside isomer was identified by retention time, determined from an authentic standard, and MRM transition:

    TABLE-US-00004 RT Q1 Mass Q3 Mass (min) Compound (Da) (Da) 10.5 Steviol 317.328 317.300 8.2 Steviolmonoside 479.354 317.200 7.9 19-glycoside 479.369 317.100 7.4 Steviolbioside 641.451 479.300 6.9 Rubusoside 641.491 479.400 7.3 RebB 803.612 641.500 6.2 Stevioside 803.550 641.400 3.3 RebE 965.441 479.400 6.2 RebA 965.441 803.700 3.8 RebD 1127.140 803.500 4.5 RebM 1289.540 803.400 2.4 RebM2 1289.540 641.400

    Kaurene Quantification:

    [0247] Titer of ent-Kaurene in culture broth is measured using a gas chromatograph equipped with a limited thermal mass oven and a flame ionization detector. Broth samples are extracted using equal parts broth and methanol and shaken in sealed container for 30 min to recover the ent-kaurene from the cells. A 240 uL aliquot of the broth:methanol solution is then diluted with 1 mL of ethyl acetate, sealed, and shaken for an additional 30 min to extract ent-kaurene into the organic phase. The organic phase is diluted as appropriate to fall within the linear range of the assay and aliquoted into a sample vial. Samples are injected at the appropriate split ratio to fall within the linear range. Sample separation occurs on a Agilent DB-1MS LTM II column, with hydrogen as the carrier gas in constant pressure mode, using the temperature gradient: (1) initial temperature 150 C. for 0 min, (2) increasing temperature 25 C./min to a temperature of 230 C., (3) increasing temperature 1800 C./min to a temperature of 320 C. and held for 1 min. External calibration using an authentic ent-kaurene standard is used to determine the ent-kaurene quantity.

    Kaurenoic Acid, Kaurenol, and Kaurenal Quantification:

    [0248] Titers of kaurenoic acid, kaurenol, and kaurenal in culture broth is determined using a high pressure liquid chromatograph equipped with a variable wavelength detector. A broth sample (100 L) is diluted into 300 L of ethanol and shaken in a sealed container for 30 min. 200 L of water is added to the broth:ethanol mixture, mixed and centrifuged. An aliquot of the resulting solution (avoiding the cell pellet) is transferred to a sample vial and analyzed using HPLC. Sample separation occurs on a Aglient Eclipse Plus C18 USP L1 (4.6 mm50 mm1.8 m) with the following solvents:

    [0249] Mobile Phase A: 0.1% Formic Acid in water (v/v)

    [0250] Mobile Phase B: 0.1% Formic Acid in acetonitrile (v/v) with the solvent gradient:

    TABLE-US-00005 Time (min) Channel A (%) Channel B (%) 0.00 50 50 2.50 50 50 5.75 0 100 8.00 0 100 8.10 50 50 9.0 50 50
    Analytes are detected using UV absorbance at 200 nm, and quantified with external calibration with relative response factors to a Steviol standard.

    Rebaudioside M Quantification Method Used for the Data Shown in FIG. 6:

    [0251] Titers of Rebaudioside M in broth is determined using a high pressure liquid chromatograph equipped with a triple quadrupole mass spectrometer. A broth sample is aliquoted into an Eppendorf tube diluted between 200- and 800-fold in 50:50 Ethanol:Water, mixed for 20 min, centrifuged to pellet cells and debris, and an aliquot of the supernatant is transferred to a sample vial for analysis. Samples are run in flow injection mode where analytes are quantified based on signal intensity of MRM transitions. The mobile phase 40% water+0.1% formic acid and 60% acetonitrile+0.1% formic acid with a flow rate of 1.1 mL/min. Rebaudioside M concentration is determined by its response normalized to that of an internal standard (Rebaudioside N).

    TABLE-US-00006 TABLE 2 Genes, promoters, and amino acid sequences of the enzymes used to convert FPP to RebA. Enzyme name Accession number or sequence ID Promoter Btrispora.GGPPS AFC92798.1 PGAL1 ent-CDPS_Os Q5MQ85.1.sup.1 PGAL1 KS_Pg ADB55711.1 PGAL1 Sr.KO AAQ63464.1 PGAL1 Sr.KAH SEQ ID: 10 PGAL1 Aa.CPR ABC47946.1 PGAL3 UGT85C2 AAR06916.1 PGAL1 UGT74G1 AAR06920.1 PGAL10 UGT91D_like3 SEQ ID NO: 7 PGAL1 UGT76G1 AAR06912.1 PGAL10 .sup.1First 65 amino acids removed and replaced with methionine

    TABLE-US-00007 TABLE 3 Genes, promoters, copy number, and amino acid sequences of the enzymes in a strain producing RebM. Gene copy Accession number or Enzyme name number sequence ID Promoter Btrispora.GGPPS 6 AFC92798.1 PGAL1 ent-CDPS_Os 4 Q5MQ85.1.sup.1 PGAL1 KS_Pg 4 ADB55711.1 PGAL1 Sr.KO 1 AAQ63464.1 PGAL1 Sr.KAH 3 SEQ ID: 10 PGAL1 ATR2 1 NP_194750.1 PGAL3 UGT85C2 2 AAR06916.1 PGAL1 or PGAL10 UGT74G1 2 AAR06920.1 PGAL1 or PGAL10 UGT91D_like3 2 SEQ ID NO: 7 PGAL1 or PGAL10 UGT76G1 4 AAR06912.1 PGAL1 or PGAL10 .sup.1First 65 amino acids removed and replaced with methionine

    [0252] All publications, patents and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.

    TABLE-US-00008 SEQUENCELISTING >Seq_ID_1 MDTLTLSLGFLSLFLFLFLLKRSTHKHSKLSHVPVVPGLPVIGNLLQLKEKKPHKTFTKMAQKYGPIFSIKAGSS KIIVLNTAHLAKEAMVTRYSSISKRKLSTALTILTSDKCMVAMSDYNDFHKMVKKHILASVLGANAQKRLRFHRE VMMENMSSKFNEHVKTLSDSAVDFRKIFVSELFGLALKQALGSDIESIYVEGLTATLSREDLYNTLVVDFMEGAI EVDWRDFFPYLKWIPNKSFEKKIRRVDRQRKIIMKALINEQKKRLTSGKELDCYYDYLVSEAKEVTEEQMIMLLW EPIIETSDTTLVTTEWAMYELAKDKNRQDRLYEELLNVCGHEKVTDEELSKLPYLGAVFHETLRKHSPVPIVPLR YVDEDTELGGYHIPAGSEIAINIYGCNMDSNLWENPDQWIPERFLDEKYAQADLYKTMAFGGGKRVCAGSLQAML IACTAIGRLVQEFEWELGHGEEENVDTMGLTTHRLHPLQVKLKPRNRIY >Seq_ID_2 MDAVTGLLTVPATAITIGGTAVALAVALIFWYLKSYTSARRSQSNHLPRVPEVPGVPLLGNLLQLKEKKPYMTFT RWAATYGPIYSIKTGATSMVVVSSNEIAKEALVTRFQSISTRNLSKALKVLTADKTMVAMSDYDDYHKTVKRHIL TAVLGPNAQKKHRIHRDIMMDNISTQLHEFVKNNPEQEEVDLRKIFQSELFGLAMRQALGKDVESLYVEDLKITM NRDEIFQVLVVDPMMGAIDVDWRDFFPYLKWVPNKKFENTIQQMYIRREAVMKSLIKENKKRIASGEKLNSYIDY LLSEAQTLTDQQLLMSLWEPIIESSDTTMVTTEWAMYELAKNPKLQDRLYRDIKSVCGSEKITEEHLSQLPYITA IFHETLRRHSPVPIIPLRHVHEDTVLGGYHVPAGTELAVNIYGCNMDKNVWENPEEWNPERFMKENETIDFQKTM AFGGGKRVCAGSLQALLTASIGIGRMVQEFEWKLKDMTQEEVNTIGLTTQMLRPLRAIIKPRI >Seq_ID_3 MAFFSMISILLGFVISSFIFIFFFKKLLSFSRKNMSEVSTLPSVPVVPGFPVIGNLLQLKEKKPHKTFTRWSEIY GPIYSIKMGSSSLIVLNSTETAKEAMVTRFSSISTRKLSNALTVLTCDKSMVATSDYDDFHKLVKRCLLNGLLGA NAQKRKRHYRDALIENVSSKLHAHARDHPQEPVNFRAIFEHELFGVALKQAFGKDVESIYVKELGVTLSKDEIFK VLVHDMMEGAIDVDWRDFFPYLKWIPNKSFEARIQQKHKRRLAVMNALIQDRLKQNGSESDDDCYLNFLMSEAKT LTKEQIAILVWETIIETADTTLVTTEWAIYELAKHPSVQDRLCKEIQNVCGGEKFKEEQLSQVPYLNGVFHETLR KYSPAPLVPIRYAHEDTQIGGYHVPAGSEIAINIYGCNMDKKRWERPEDWWPERFLDDGKYETSDLHKTMAFGAG KRVCAGALQASLMAGIAIGRLVQEFEWKLRDGEEENVDTYGLTSQKLYPLMAIINPRRS >Seq_ID_4 MAVATDPLGCMQKLVQMLQAPPYVAAAVQSSALLLTFFIGDWRKRRRSPLPLLPAIPGIPVLGNLLQLKEKKPHK TFAQWSETYGPIYSIKAGASTVIVLNSSDLAKEAMVTRYSSISSRKLSKALTILTADKCMVAMSDYNDFHKLVKR YILANVLGANAQKRLRQRRDTMIDNISRELFACVKDSSSESVNFRKIFESELFGLALKETFGRDMESLYVDGLGT TLLREDLFRTLVIDPMEGAIEVDWRDFFPYLRWIPNKGVEDRIRKMDFRRRVTMKSLMEEKKKQIAAGEDLNCYS EFLLSEAKSLTEEQISMLLWEIIIETSDTTLVVTEWAMYELAQNPKRQERLYQHIQSVCGSAKITEENLSQLPYL TAVFHETLRKYSPVSIVPLRYAHEDTQLGGYFIPAGSEVAVNIYACNMDKKQWESPEEWKPERFLDESYDPMDLY KTMAFGGGKRVCAGAPKAMLIACTTLGRLVQGFTWKLREGEEDKVDTLGLTARKLQPLHIVAKPRIN >Seq_ID_5 MAVVTDPLASMQLLANTIPAPPYAAAAVLGGVSLVLSVFFVADCRKKRRNFLPPVPAVPGVPVLGNLLQLKEKKP HKTFARWAETYGAVYSIRTGASTVIVLNTTEVAKEAMVTRYGSISSRKLSKALTILTADKCMVAMSDYNEFHKMV KRYILANVLGANAQKKHRQRRDAMIENISRELFAHVKEFPLDTVNFRKIFEAELFRLALKETLGKDIESIYVDGL GTTLPREDLFRILVIDPMEGAIEVDWRDFFPYLRWIPNKRVENKIRNMDFRRRMTMKKLMEEPKKRIAAGEETYC YADFLLSEAKTLTEDQISMLLWETIIETSDTTLVVTEWAMYELSKDPRRQDYLYQQIQSVCGSATLTEENLSQLP YLTAIFHETLRKHSPVPVVPLRYAHEDTQLGGYFVPAGSEIAVNIYACNMDKDHWESPEEWKPERFLDDKYDPMD LHKTMAFGGGKRVCAGALKAMLIACTTIGRMVQEFEWKLREGEEEKVDTLGLTARKLQPLHVVIKPRNN >Seq_ID_6 MSKSNSMNSTSHETLFQQLVLGLDRMPLMDVHWLIYVAFGAWLCSYVIHVLSSSSTVKVPVVGYRSVFEPTWLLR LRFVWEGGSIIGQGYNKFKDSIFQVRKLGTDIVIIPPNYIDEVRKLSQDKTRSVEPFINDFAGQYTRGMVFLQSD LQNRVIQQRLTPKLVSLTKVMKEELDYALTKEMPDMKNDEWVEVDISSIMVRLISRISARVFLGPEHCRNQEWLT TTAEYSESLFITGFILRVVPHILRPFIAPLLPSYRTLLRNVSSGRRVIGDIIRSQQGDGNEDILSWMRDAATGEE KQIDNIAQRMLILSLASIHTTAMTMTHAMYDLCACPEYIEPLRDEVKSVVGASGWDKTALNRFHKLDSFLKESQR FNPVFLLTFNRIYHQSMTLSDGTNIPSGTRIAVPSHAMLQDSAHVPGPTPPTEFDGFRYSKIRSDSNYAQKYLFS MTDSSNMAFGYGKYACPGRFYASNEMKLTLAILLLQFEFKLPDGKGRPRNITIDSDMIPDPRARLCVRKRSLRDE >Seq_ID_7 MNKFNSMNNTINETLLRQLVSGLDEIPLMDIHWLIYVAFGAWLCSYVIHLLSSPSTVNVPFVGYRSVFEPTWFLR LRFVWEGGSIISQGYSKFKDSIFQVRKLGTDIVIIPPNYIDEVRKLSQDKTRSVEPFINDFAGDYTRGMVFLQSD LQNRVIQQRLTPKLVSLTKVMKEELDYALTKGMPDMKDDEWVEADIASIMVRLISRISARVFLGPEHCRNQEWLT TTAEYSESLFMTGFILRVVPHILRPFVAPLLPSYRTLLRSVSSGRKVIGDIIRSQQGSENEDILSWMVEAATGEE KQVDNIAQRMLILSLASIHTTAMTMTHAMYDLCARPEYTKPLREEVKGVVGASGWDKTALNRLHKLDSFLKESQR FNPVFLLTFNRIYHQPMTLSDGTNLPSGTRIAVPSHAMLQDSAHVPGPAPPTDFDGFRYSKIRSDSNYAQKYLFS MTDSSNMAFGYGKYACPGRFYASNEMKLTLAILLLQFEFKLPDGKGRPRNITIDSDMVPDPRARLCVRKRSLREE >Seq_ID_8 MDLQTMAPMGSAAIAIGGPAVAVAGGISLLFLKSFLSQQPGNPNHLPSVPAVPGVPLLGNLLELKEKKPYKTFTK WAETYGPIYSIKTGATSMVVVNSNQLAKEAMVTRFDSISTRKLSKALQILTADKTMVAMSDYDDYHKTVKRNLLT SILGPAAQKRHRAHRDAMGDNLSRQLHALALNSPQEAINFRQIFQSELFTLAFKQTFGRDIESIFVGDLGTTMTR EEMFQILVVDPMMGAIDVDWRDFFPYLKWIPNAKLEEKIEQMYIRRKAVMKAVIQEHRKRIDSGENLDSYIDFLL AEAQPLTEKQLLMSLWEPIIETSDTTMVTTEWAMYELSKHPNKQQRLYNEIRNICGSEKITEEKLCKMPYLSAVF HETLRVHSPVSIIPLRYVHENTELGGYHVPAGTELAVNIYGCNMEREIWENPEEWSPERFLAENEPVNLQKTMAF GAGKRVCAGAMQAMLLACVGIGRMVQEFEWRLKDDVEEDVNTLGLTTQRLNPMLAVIKPRN >Seq_ID_9 MDGVIDMQTIPLRTAIAIGGTAVALVVALYFWFLRSYASPSHHSNHLPPVPEVPGVPVLGNLLQLKEKKPYMTFT KWAEMYGPIYSIRTGATSMVVVSSNEIAKEVVVTRFPSISTRKLSYALKVLTEDKSMVAMSDYHDYHKTVKRHIL TAVLGPNAQKKFRAHRDTMMENVSNELHAFFEKNPNQEVNLRKIFQSQLFGLAMKQALGKDVESIYVKDLETTMK REEIFEVLVVDPMMGAIEVDWRDFFPYLKWVPNKSFENIIHRMYTRREAVMKALIQEHKKRIASGENLNSYIDYL LSEAQTLTDKQLLMSLWEPIIESSDTTMVTTEWAMYELAKNPNMQDRLYEEIQSVCGSEKITEENLSQLPYLYAV FQETLRKHCPVPIMPLRYVHENTVLGGYHVPAGTEVAINIYGCNMDKKVWENPEEWNPERFLSEKESMDLYKTMA FGGGKRVCAGSLQAMVISCIGIGRLVQDFEWKLKDDAEEDVNTLGLTTQKLHPLLALINPRKS >Seq_ID_10 MEAFVPGGAGAAAAAVGGFVAAAALAERAGVIAPRKRPNAPPAVPGLPIIGNLHQLKEKKPHQTFAKWAEIYGPI YTIRTGASSVVVLNSTEVAKEAMVAKFSSISTRKLSKALTVLTRDKSMVATSDYCDFHKMVKRYVMSSMLGTSAQ KQFRDIRDMMIHNMLSTFHKLVKDDPHAPLIFRDVFKDELFRLSMIQSLGEDVSSVYVDEFGRDISKEETYNATV TDMMMCAIEVDWRDFFPYLSWVPNKSFETRVFTTETRRTAVMRALIKQQKERIVRGEAKTCYLDFLLAENTLTDE QLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQERLYQEIREVCGDETVTEEHLPRLPYLNAVFHETLRRHSP VPLIPPRFVHEDTKLAGYDVPAGTEMVINLYGCNMNRKEWESPEEWVPERFAGGRLEVADMYKTMAFGAGRRACA GSLQATHIACAAVARFVQEFGWRLREGDEEKVDTVQLTAYKLHPLHVHLTRRGRM >Seq_ID_11 MLETKVIAHHVSHSPCAAIPGGLPVLGNLLQLTEKKPHRTFTAWSKEHGPIFTIKVGSVPQAVVNNSEIAKEVLV TKFASISKRQMPMALRVLTRDKTMVAMSDYGEEHRMLKKLVMTNLLGPTTQNKNRSLRDDALIGMIEGVLAELKA SPTSPKVVNVRDYVQRSLFPFALQQVFGYIPDQVEVLELGTCVSTWDMFDALVVAPLSAVINVDWRDFFPALRWI PNRSVEDLVRTVDFKRNSIMKALIRAQRMRLANLKEPPRCYADIALTEATHLTEKQLEMSLWEPIIESADTTLVT SEWAMYEIAKNPDCQDRLYREIVSVAGTERMVTEDDLPNMPYLGAIIKETLRKYTPVPLIPSRFVEEDITLGGYD IPKGYQILVNLFAIANDPAVWSNPEKWDPERMLANKKVDMGFRDFSLMPFGAGKRMCAGITQAMFIIPMNVAALV QHCEWRLSPQEISNINNKIEDVVYLTTHKLSPLSCEATPRISHRLP >Seq_ID_12 MMDDTTSPYSTYHSVRSIRNQSAWALAPIAVFICYVVLRHNRKSVPAASAGSHSILEPLWLARLRFIRDSRFIIG QGYSKFKDTIFKVTKVGADIIVVAPKYVEEIRRLSRDTGRSVEPFIHDFAGELLGGLNFLESDLQTRVVQQKLTP NLKTIVPVMEDEMHYALVSELDSCLDGSEHWTRVDMIHMLSRIVSRISARIFLGPKYCRNDLWLKTTAEYTENLF LTGTLLRFVPRMLQKWIAPLLPSFRQLQENRQAARKIISEILTDHQPEKHDETSDNGDPYPDILTLMFQAARGKE KDIEDIAQHTLLLSLSSIHTTALTMTQALYDLCAYPQYLDPVKHEIADTLQSEGSWSKAMLDKLHMMDSLLRESQ RLSPVFLLTFNRILHTPLTLSNGIHLPKGTRIAAPSDAILNDPSLVPGPQPADTFDPFRYINHSTGDAKKTKTNF QTTSLQNMAFGYGKYACPGRFYVANEIKLVLGHLLMHYEFKFPPGMGRPVNSTVDTDMYPDLGARLLVRKRKMEE >Seq_ID_13 MESLVAALPAGGAAAAAAFGGLVAAAALAGKVGLVGSKKHLNAPPAVSGLPLIGNLHQLKEKKPHQTFTKWAEIY GPIYTIRTGSSTVVVLNSAQVAKEAMIAKFSSISTRKLSKALSALTRDKTMVATSDYGDFHKMIKRYIMTFMLGT SGQKQFRDTRNMMVDNMLNTFHTLLMDDPNSPLNFREVFKNELFRLSLVQALGEDVSSIYVEEYGKVISKEETYK ATVVDMMMCAIEVDWRDFFPYLSWIPNRTFETRVLTTEARRTTVMQALIKQQKERIARGETRISYLDFLLAENTL TDEQLLMLVWEAVIEAADTTLVTTEWAMYEIAKHPEKQEYLYQEIQKVCGNKTVTEDHLPELPYLNAVFHETMRR HSPVPLVPPRLVHENTNLAGYEVPAGTEIIINLYGCNMNKNDWAEPEEWKPERFLDGRFEAVDMHKTMAFGAGRR ACAGSMQAMNISCTAIGRFVQEFAWRLEEGDEDKVDTIQLTTNRLYPLHVYLAPRGRK >SEQIDNO:14AY245442.1ent-kaureneoxidasemRNA[Pisumsativum] GTGGTGAAGCAACTAGCAGTGGCAGCCATGGATACTCTCACACTTTCTTTGGGTTTTTTA TCTCTCTTTTTGTTCCTCTTCTTACTAAAGAGATCTACTCACAAACATTCCAAGCTTTCC CATGTACCAGTGGTTCCAGGTTTGCCAGTGATTGGGAATCTGCTGCAATTGAAAGAGAAG AAACCTCACAAGACATTCACAAAGATGGCTCAGAAATATGGACCCATTTTTTCCATCAAA GCTGGTTCTTCCAAAATCATTGTTCTCAACACTGCTCATCTTGCTAAAGAGGCAATGGTG ACTAGATATTCATCAATTTCAAAAAGGAAGCTATCAACTGCACTGACGATTCTAACTTCG GATAAATGCATGGTTGCTATGAGCGACTACAATGATTTTCACAAAATGGTTAAAAAACAT ATTCTTGCAAGTGTTCTTGGAGCCAATGCACAGAAGCGACTCCGTTTTCACAGAGAGGTT ATGATGGAAAATATGTCTAGTAAGTTTAATGAACATGTGAAGACCCTCTCAGATTCTGCT GTTGATTTTAGGAAAATATTTGTGTCTGAACTTTTCGGATTAGCACTAAAGCAAGCTCTG GGAAGTGATATTGAATCCATTTATGTGGAGGGTTTGACGGCTACATTATCAAGAGAGGAC TTATATAACACTCTAGTGGTTGATTTTATGGAGGGTGCAATTGAGGTGGATTGGAGAGAT TTCTTCCCGTACCTGAAATGGATTCCAAATAAGAGCTTCGAGAAGAAAATCCGTAGAGTC GATCGCCAAAGAAAAATTATCATGAAGGCACTAATTAATGAGCAAAAGAAGCGGTTGACA TCAGGAAAAGAATTAGATTGTTATTATGATTACCTAGTATCAGAAGCTAAAGAAGTGACT GAAGAACAAATGATCATGCTGCTCTGGGAGCCAATTATTGAGACATCCGATACTACCTTA GTCACGACAGAATGGGCTATGTATGAACTTGCCAAAGACA >Seq_ID_15 ATGGATACCTTAACTTTGTCTTTAGGTTTCTTATCTTTGTTCTTATTTTTATTCTTGTTAAA GAGATCTACTCACAAGCACTCCAAGTTATCCCACGTTCCAGTTGTTCCAGGTTTGCCTGTCA TTGGTAACTTATTGCAATTGAAAGAAAAGAAGCCACACAAGACTTTCACCAAGATGGCTCAA AAGTACGGTCCAATTTTCTCCATCAAAGCCGGTTCTTCTAAAATCATTGTTTTAAACACTGC CCACTTGGCTAAAGAAGCTATGGTTACTAGATATTCTTCCATCTCCAAGAGAAAGTTGTCTA CTGCTTTGACCATCTTGACTTCTGATAAGTGCATGGTTGCTATGTCCGATTATAACGACTTC CACAAGATGGTTAAGAAGCACATCTTGGCTTCTGTTTTGGGTGCCAACGCCCAAAAGAGATT GCGTTTCCACAGAGAAGTCATGATGGAAAACATGTCTTCCAAATTCAATGAACATGTCAAGA CTTTGTCTGATTCTGCTGTTGACTTCAGAAAGATTTTCGTTTCTGAATTATTTGGTTTGGCT TTGAAGCAAGCTTTGGGTTCCGATATCGAATCTATCTACGTTGAAGGTTTGACTGCTACTTT ATCTAGAGAAGATTTGTATAACACCTTGGTCGTCGACTTCATGGAAGGTGCTATCGAAGTTG ATTGGAGAGACTTTTTCCCTTATTTGAAGTGGATTCCAAACAAATCCTTCGAAAAGAAGATC AGAAGAGTTGATAGACAAAGAAAAATTATCATGAAAGCTTTGATCAACGAACAAAAGAAAAG ATTGACCTCTGGTAAGGAATTGGACTGTTACTACGATTACTTAGTTTCTGAAGCTAAGGAAG TCACCGAAGAACAAATGATCATGTTGTTGTGGGAACCAATTATTGAGACTTCTGATACTACT TTAGTTACCACCGAATGGGCTATGTATGAGTTGGCTAAGGACAAGAACCGTCAAGACAGATT GTACGAAGAATTGTTGAACGTTTGTGGTCACGAAAAGGTTACTGATGAAGAATTGTCCAAGT TGCCATACTTAGGTGCTGTCTTTCACGAAACCTTGCGTAAACACTCTCCAGTTCCAATCGTC CCATTGAGATACGTTGATGAAGATACCGAATTGGGTGGTTATCATATTCCTGCCGGTTCCGA AATCGCTATCAACATTTACGGTTGTAATATGGATTCCAACTTGTGGGAGAACCCAGATCAAT GGATCCCTGAAAGATTTTTAGATGAAAAATACGCCCAAGCTGATTTGTATAAGACTATGGCT TTCGGTGGTGGTAAAAGAGTCTGTGCTGGTTCCTTACAAGCTATGTTGATTGCCTGTACTGC TATTGGTAGATTGGTTCAAGAATTTGAATGGGAATTGGGTCACGGTGAAGAAGAAAACGTTG ACACCATGGGTTTAACTACCCATAGATTACACCCATTGCAAGTCAAATTAAAGCCAAGAAAC AGAATTTACTAA >SEQIDNO:16(sr.UGT_g252778) MATNDDDRKQLHVAMFPWLAFGHILPFLELSKLIAQNGHKVSFLSTTRNIQRLPSHLTPLINLVKLTL PRVQELPEDAEATTDIKHDDQDHLLNASDGLQPEVTRFLEEESPDWIIFDYSYYWLPPVAAELGISRA FFMTFPTWTMALTRLPSDQLTAEDLMTLSKISFKKHEIVNLMYGTSTQGDLYRLTMACNGSDCILIRC CYEFEPQWLTLLEKLLPVPVVPVGLLPPEIHGDEKDDDTWVSVKEWLDGQHKGHVVYVALGSEAMVSK DELGELALGLELSGLPFFWALRKPPGSTESDSVELPDGFMERTRNRGVVWTSWAPQLRILSHESVCGF LTHCGVSSIVEGLMFGHPLIMLPIFGDQIMNAQVLADKQVGIEIPRNEEDGWFTKESVAKSLRSVVVD DEGEIYKANARELSKIFSDTDLGKKYISHFIDFLMMEIVKT* SEQIDNO:17(UGT40087version1) MDASDSSPLHIVIFPWLAFGHMLASLELAERLAARGHRVSFVSTPRNISRLRPVPPALAPLIDFVALPLP RVDGLPDGAEATSDIPPGKTELHLKALDGLAAPFAAFLDAACADGSTNKVDWLFLDNFQYWAAAAAADHK IPCALNLTFAASTSAEYGVPRVEPPVDGSTASILQRFVLTLEKCQFVIQRACFELEPEPLPLLSDIFGKP VIPYGLVPPCPPAEGHKREHGNAALSWLDKQQPESVLFIALGSEPPVTVEQLHEIALGLELAGTTFLWAL KKPNGLLLEADGDILPPGFEERTRDRGLVAMGWVPQPIILAHSSVGAFLTHGGWASTIEGVMSGHPMLFL TFLDEQRINAQLIERKKAGLRVPRREKDGSYDRQGIAGAIRAVMCEEESKSVFAANAKKMQEIVSDRNCQ EKYIDELIQRLGSFEK SEQIDNO:18(UGT40087version2) MDASSSPLHIVIFPWLAFGHMLASLELAERLAARGHRVSFVSTPRNISRLRPVPPALAPLIDFVALPLP RVDGLPDGAEATSDIPPGKTELHLKALDGLAAPFAAFLDAACADGSTNKVDWLFLDNFQYWAAAAAADHK IPCALNLTFAASTSAEYGVPRVEPPVDGSTASILQRFVLTLEKCQFVIQRACFELEPEPLPLLSDIFGKP VIPYGLVPPCPPAEGHKREHGNAALSWLDKQQPESVLFIALGSEPPVTVEQLHEIALGLELAGTTFLWAL KKPNGLLLEADGDILPPGFEERTRDRGLVAMGWVPQPIILAHSSVGAFLTHGGWASTIEGVMSGHPMLFL TFLDEQRINAQLIERKKAGLRVPRREKDGSYDRQGIAGAIRAVMCEEESKSVFAANAKKMQEIVSDRNCQ EKYIDELIQRLGSFEK SEQIDNO:19(loop2fromOs_UGT_91C1) EGLPDGAESTNDVPHDRPDMV SEQIDNO:20(loop3_1fromOs_UGT_91C1) SEFLGTACAD SEQIDNO:21(loop3_2fromOs_UGT_91C1) SEFLGTACADWVIVDVFHH SEQIDNO:22(loop4_1fromOs_UGT_91C1) ADRRLERAETESPAAAGQGRPAAAPTFEVARMKLIRTKGSSGM SEQIDNO:23(loop4_2fromOs_UGT_91C1) MMLLGSAHMIASIADRRLERAETESPAAAGQGRPAAAPTFEVARMKLIRTKGSSGM SEQIDNO:24(loop2fromUGT40087) DGLPDGAEATSDIPPGKT SEQIDNO:25(loop3_1fromUGT40087) AAFLDAACADGSTNKVD SEQIDNO:26(loop3_2fromUGT40087) AAFLDAACADGSTNKVDWLFLDNFQY SEQIDNO:27(loop4_1fromUGT40087) GVPRVEPPVDGSTA SEQIDNO:28(loop4_2fromUGT40087) LNLTFAASTSAEYGVPRVEPPVDGSTA SEQIDNO:29(modifiedloop1fromOs_UGT_91C1presentinUGT40087_loop1) TPRNISRLPPVPPALAP SEQIDNO:30(modifiedloop1fromUGT40087presentinOs_UGT_91C1_loop1) TPRNISRLRPVRPALAP SEQIDNO:31(loop1fromOs_UGT_91C1havingSEQIDNO:8) TPRNISRLPPVRPALAP SEQIDNO:32(loop1fromUGT40087havingSEQIDNO:11) TPRNISRLRPVPPALAP SEQIDNO:33(UGT40087/Si91Dlikechimera) MDASSSPLHIVIFPWLAFGHMLASLELAERLAARGHRVSFVSTPRNISRLRPVPPALAPLIDFVALPLPRVDGLP DGAEATSDIPPGKTELHLKALDGLAAPFAAFLDAACADGSTNKVDWLFLDNFQYWAAAAAADHKIPCALNLTFAA STSAEYGVPRVEPPVDGSTASILQRFVLTLEKCQFVIQRACFELEPEPLPLLSDIFGKPVIPYGLVPPCPPAQGH IEHDNAALSWLDKQQPESVLFIALGSEPPVTVEQLHEIALGLELAGTTFLWALKKPNGLLLEADGDILPPGFEER TRDRGLVAMGWVPQLSILAHSSVGAFLTHGGWSSTIEGAMSGHPMVFLTFLDEQRINAQLIERKKAGLRVPRCEK DGSYDRQGIAGAIRAVMCEEESKSVFAANAKKMQEIINDRKCQERYIDELIQRLRSFEK SEQIDNO:34(Os_UGT_91C1_loop4_1) MDSGYSSSYAAAAGMHVVICPWLAFGHLLPCLDLAQRLASRGHRVSFVSTPRNISRLPPVRPALAPLVAFVALPL PRVEGLPDGAESTNDVPHDRPDMVELHRRAFDGLAAPFSEFLGTACADWVIVDVFHHWAAAAALEHKVPCAMMLL GSAHMIASIGVPRVEPPVDGSTASLAERFSLTLSRSSLVVGRSCVEFEPETVPLLSTLRGKPITFLGLMPPLHEG RREDGEDATVRWLDAQPAKSVVYVALGSEVPLGVEKVHELALGLELAGTRFLWALRKPTGVSDADLLPAGFEERT RGRGVVATRWVPQMSILAHAAVGAFLTHCGWNSTIEGLMFGHPLIMLPIFGDQGPNARLIEAKNAGLQVARNDGD GSFDREGVAAAIRAVAVEEESSKVFQAKAKKLQEIVADMACHERYIDGFIQQLRSYKD SEQIDNO:35(unoptimizednucleicacidsequenceofUGT40087havingSEQID NO:17) tcgtgacgcaacagagcaactctcgccggcaccggtcgccccttccgcaggcaggcagca ggctcgcgcgcatggacgcctccgactcctccccgctgcacatcgtcatcttcccgtggc tcgcgttcggccacatgctcgccagcctggagctcgccgagcgcctggccgcgcgaggcc accgcgtgtccttcgtctccaccccgcgcaacatcagccgcctccgcccggtcccgcccg cgctggcgccgctcatcgacttcgtggcgctgccgctgccgcgcgtcgacggcctccccg acggcgcggaggccaccagcgacatcccgcccggcaagaccgagctccacctcaaggccc tagacggcctcgccgcgcccttcgcagctttcctcgacgccgcctgcgccgacgggagca ccaacaaggtggactggctcttcctcgacaacttccaatactgggccgccgccgccgctg ccgaccataagataccctgcgcgctgaacctgacattcgcagcgtcgacgtcagcggagt acggtgtgccacgcgttgagccgccggtggatggctcaacagcctcaatactccagcgat ttgtgctaaccttggagaaatgccagtttgtcatccaacgcgcctgcttcgagctggagc cggagcccctgcctctcctgtcagacatcttcggcaagccggtgatcccgtacggcctag tcccgccgtgtccccccgcagaaggtcacaaaagagagcacggcaacgcagctctgtcat ggctcgacaagcagcagcccgagtctgtcctgttcattgctctgggaagcgagcctccgg tgaccgtcgaacagctgcacgagatcgcgcttgggctggagctcgccgggacgacattcc tctgggctctgaagaagcctaacggcctcctcctcgaggcggacggcgacatcctgcccc caggtttcgaggagcggacgcgtgaccgtgggctcgtggccatgggctgggttcctcagc ccatcatactggctcacagctccgtgggcgcgttcctgacgcacggcggatgggcctcca ccattgaaggggttatgtccgggcatcccatgctcttcctgacgttcttagatgaacaga ggataaacgcgcaactgatcgagaggaagaaggccgggttgcgagtgccaaggcgtgaga aggacggctcgtacgatcgccaaggcatcgccggagcgatccgggctgtcatgtgcgagg aagaaagtaagagcgtcttcgcggctaatgccaagaagatgcaggagattgtgagcgaca ggaattgccaggagaagtacatcgacgagcttatccagcgtctgggatccttcgagaagt gaaataaggtgaaatatcctacaataaccgcctgttgatggcttgatgcaacgatgtagg tggccattcgcgcctctgatctccatgttccggcaataaatccaccatatgttatggctc tgacttactgaatttcctaatatgtatgcccaaacacatgcataggttgctagttgcccc tcgcgccggcattagcgataatgtcaccgcagtcgccagcacaggtgtagcaatttgaca t SEQIDNO:36(UGT40087-1codonoptimizednucleicacidsequence) ATGGATGCTTCCAGTAGTCCTTTACACATCGTTATCTTTCCATGGTTAGCTTTCGGTCATATGTTGGCTTCCTTG GAATTGGCTGAGAGATTGGCTGCTCGTGGTCACAGAGTCTCCTTCGTTTCCACCCCTAGAAACATCTCTAGATTA CGTCCAGTTCCACCAGCTTTAGCTCCATTGATTGATTTTGTCGCTTTGCCATTGCCTAGAGTCGATGGTTTACCA GATGGTGCCGAAGCTACCTCTGACATTCCACCAGGTAAGACCGAATTACACTTGAAGGCTTTGGACGGTTTGGCT GCTCCATTCGCCGCTTTTTTGGACGCTGCCTGTGCTGATGGTTCCACCAACAAGGTTGATTGGTTGTTTTTGGAC AACTTCCAATACTGGGCTGCCGCTGCCGCTGCTGATCACAAAATTCCTTGCGCCTTAAACTTGACTTTTGCCGCT TCCACCTCCGCTGAATACGGTGTTCCACGTGTTGAACCACCAGTTGACGGTTCCACTGCCTCCATCTTACAAAGA TTTGTCTTAACCTTAGAAAAATGTCAATTCGTTATCCAAAGAGCTTGTTTCGAATTGGAACCTGAACCATTGCCA TTGTTGTCCGACATTTTCGGTAAGCCAGTCATCCCATACGGTTTAGTTCCTCCATGTCCACCAGCTGAAGGTCAC AAAAGAGAACACGGTAACGCTGCTTTGTCCTGGTTGGATAAGCAACAACCAGAATCTGTTTTGTTCATCGCTTTG GGTTCTGAACCACCTGTTACCGTCGAACAATTGCACGAAATCGCTTTGGGTTTAGAATTGGCCGGTACCACCTTC TTGTGGGCCTTGAAAAAGCCAAACGGTTTGTTGTTAGAAGCCGATGGTGATATTTTGCCACCAGGTTTCGAAGAA AGAACTAGAGATAGAGGTTTAGTCGCTATGGGTTGGGTTCCACAACCAATTATCTTGGCCCATTCCTCTGTTGGT GCCTTTTTGACTCACGGTGGTTGGGCCTCCACTATTGAAGGTGTCATGTCCGGTCACCCTATGTTGTTCTTAACC TTCTTGGACGAACAACGTATCAACGCCCAATTGATCGAAAGAAAAAAGGCTGGTTTAAGAGTCCCAAGAAGAGAA AAGGATGGTTCCTACGACAGACAAGGTATTGCTGGTGCTATTAGAGCCGTCATGTGTGAAGAAGAATCTAAGTCT GTCTTCGCTGCTAACGCTAAGAAAATGCAAGAGATCGTTTCTGACAGAAACTGTCAAGAAAAGTACATCGACGAA TTGATTCAAAGATTGGGTTCTTTCGAAAAGTAA