COMPOSITIONS AND METHODS FOR REMEDIATION OF SULFATE REDUCING PROKARYOTES
20200154715 ยท 2020-05-21
Inventors
- Kathleen Manna (Collegeville, PA, US)
- Ian A. Tomlinson (Midland, MI)
- Abhiram Thatipelli (College Station, TX, US)
- Christopher Janes (College Station, TX, US)
- Elizabeth J. Summer (College Station, TX, US)
Cpc classification
C02F1/50
CHEMISTRY; METALLURGY
International classification
C02F1/50
CHEMISTRY; METALLURGY
Abstract
Compositions and methods are provided for use in controlling souring and corrosion causing prokaryotes, such as SRP, by treating oil and gas field environments or treatment fluids with a newly identified bacterial strain ATCC Accession No. PTA-124262 as a self-propagating whole cell that produces an anti-SRP bacteriocin in situ. In another aspect, the methods use one or more toxic peptides or proteins isolated therefrom in methods to control unwanted prokaryotic growth in these environments.
Claims
1. An isolated Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof.
2. The bacterium according to claim 1, wherein said derivatives are characterized by naturally occurring or genetically manipulated mutations.
3. A bacteriocin produced from the bacterium of claim 1, having anti-sulfate reducing prokaryote activity.
4. The bacteriocin according to claim 3, comprising a protein sequence of SEQ ID NO: 1, 2, 3 or 4.
5. A partially purified supernatant extract comprising the bacteriocin of claim 3.
6. A composition having broad range killing activity against sulfate reducing prokaryotes (SRP) comprising: (a) Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof and a suitable carrier; or (b) a bacteriocin produced from the bacterium of (a) and a suitable carrier.
7. The composition according to claim 6, further comprising at least one additional bacterium or at least one additional bacteriocin from an additional bacterium.
8. The composition according to claim 7, wherein said additional bacterium is another strain of P. aeruginosa, or a Thauera aminoaromatica, or an Ideonella, or admixtures thereof.
9. The composition according to claim 8, further comprising the anti-SRP or anti-corrosive bacteriocins.
10. The composition according to claim 6, wherein the carrier comprises an aqueous based fluid or aqueous miscible fluid.
11. The composition according to claim 10, wherein the carrier is water, salt-water, or buffered water.
12. A method of controlling unwanted prokaryotes in an oil or gas field environment or treatment fluid comprising: (a) contacting the environment or fluid with an amount of Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof effective to produce bacteriocin virulent for the unwanted prokaryotes; or (b) a bacteriocin produced from the bacterium of (a), wherein said bacteriocin is virulent for the unwanted prokaryotes.
13. The method according to claim 12, wherein said contacting occurs for a time sufficient to permit the bacterium to produce bacteriocin virulent for the unwanted prokaryotes or for the bacteriocin to kill the unwanted prokaryotes.
14. The method according to claim 13, wherein the unwanted prokaryotes are sulfate reducing prokaryotes (SRP).
15. The method according to claim 14, wherein the SRP is one or more of D. alaskensis, D. desulfuricans, D. longus, or D. vulgaris.
16. The method according to claim 12, further comprising contacting the environment or fluid with whole cell bacteria of, or bacteriocin or bacteriocin extract produced from, another strain of Pseudomonas aeruginosa, or Thauera aminoaromatica or Ideonella that can kill SRP.
Description
DETAILED DESCRIPTION
[0016] Methods and compositions are described for mitigation of souring and MIC in oil and gas pipeline environments, including aqueous (water-containing) environments, as well as for other uses. Composition and methods for remediation of unwanted prokaryotes, particularly SRPs, in aqueous environments in oil and gas pipelines are provided by introduction of whole cells from a novel Pseudomonas aeruginosa strain ATCC PTA-124262, recovered from oil and gas operation waste waters and/or bacteriocin produced by that strain. The use of such methods and compositions are designed to reduce hydrogen sulfide production and associated souring and MIC. The exposure of oil and gas pipelines to these viable bacterial cells that produce and secrete chemicals (bacteriocins) that inhibit the growth of SRPs is a valuable tool for such remediation.
[0017] Exposure of oil and gas pipelines to the anti-SRP Pseudomonas strains leads to co-colonization of new and pre-existing SRP-containing biofilms along the inner surfaces of the pipelines. The close proximity between SRPs and the anti-SRP Pseudomonas strains induce the Pseudomonas strains to produce anti-SRP bacteriocins in order to achieve a competitive advantage.
Definitions and Components of the Compositions and Methods
[0018] Technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs and by reference to published texts, which provide one skilled in the art with a general guide to many of the terms used in the present application. The definitions contained in this specification are provided for clarity in describing the components and compositions herein and are not intended to limit the claimed invention. The following terms are used throughout the specification.
[0019] By bacteriocins is meant proteinaceous (peptide or proteins) anti-microbial toxins normally produced by bacteria to inhibit the growth of taxonomically similar microbial competitors in the nearby environment. Productions of bacteriocins both by Gram positive bacteria (such as lactic acid bacteria or Bacillus), and by Gram negative bacteria (many members of Enterobacteriaceae family, such as Escherichia coli), have been documented. Some of the documented bacteriocins exhibit a broad inhibition spectrum covering many members of Gram positive and Gram negative bacteria. The bacteriocin of ATCC Accession No. PTA-124262 inhibits growth of the SRPs, thereby reducing sulfide production and associated souring and MIC. Bacteriocins showing activity against different strains of SRPs have great potential for environmental applications as natural biocides in oil and gas industries, among others.
[0020] The term unwanted prokaryote, as used herein, refers to single-celled organisms that do not have a nucleus or any other membrane-bound organelles, e.g., bacteria, cyanobacteria, and archaea. These prokaryotes include the strain(s) of prokaryotes, e.g., bacteria, specifically targeted for control by the invention described herein. Typically, but not necessarily, the unwanted prokaryotes are targeted for control because of interference with reactions or processes, such as in the case of unwanted SRPs and/or IRBs in oil and gas drilling and in production waters such as fracturing water, produced water and water. The unwanted prokaryotes need not necessarily be known, isolated, or identified; the sole defining characteristic is that it is the organism(s) desired to be controlled. This invention provides for reduction of invasive prokaryotes and other unwanted and problematic prokaryotes, e.g., SRPs and sulfate-reducing bacteria.
[0021] By oil and gas field environments or oil and gas aqueous environments is meant the fluids naturally occurring in the well itself or any type of fluid employed in a hydrocarbon recovery operation such as pipeline operations, well servicing operations, upstream exploration and production operations, downstream refining, processing, storage and transportation applications, and sterilization of flowback fluids. Such environments include drilling fluids, lost circulation fluids, stimulation fluids, sand control fluids, completion fluids, acidizing fluids, scale inhibiting fluids, water-blocking fluids, clay stabilizer fluids, fracturing fluids, frac-packing fluids, gravel packing fluids, wellbore strengthening fluids, acidizing fluids, sag control fluids, any flow-back fluid, which is a non-hydrocarbon containing fluid that flows from the well to the surface following treatment with another fluid, or wastewater.
[0022] By carrier as used herein includes, but is not limited to, aqueous-based fluids, such as fresh water, seawater, saltwater, or brine (e.g., water containing or saturated with one or more dissolved salts) and any combination thereof. A carrier may also be an aqueous-miscible fluid, such as alcohols, e.g., methanol, ethanol, n-propanol, isopropanol, n-butanol, sec-butanol, isobutanol, and t-butanol; glycerins; glycols, e.g., polyglycols, propylene glycol, and ethylene glycol; polyglycol amines; polyols; any derivative thereof; any in combination with salts, e.g., sodium chloride, calcium chloride, calcium bromide, zinc bromide, potassium carbonate, sodium formate, potassium formate, cesium formate, sodium acetate, potassium acetate, calcium acetate, ammonium acetate, ammonium chloride, ammonium bromide, sodium nitrate, potassium nitrate, ammonium nitrate, ammonium sulfate, calcium nitrate, sodium carbonate, and potassium carbonate. Combinations of one or more aqueous-miscible fluid with an aqueous-based fluid may also serve as carriers for the compositions described herein. Still other suitable carriers include emulsions, such as water-in-oil emulsions or oil-in-water emulsions, which are described in US2014/0090833, incorporated by reference herein.
[0023] By additive is meant pH adjuster or buffering agent, a carbon source, and glycerol, as well as any necessary reagents for cryopreservation until time of use. In one embodiment, the purified or partially purified bacteriocin is stable in just a buffer solution. In another embodiment, to stabilize a formulation containing whole cells, the formulation can include a salt, buffer to maintain pH, optionally a low level of a carbon source, and optionally glycerol.
[0024] Effective amount as used herein means an amount of whole cell sufficient to produce bacteriocin in sufficient concentration to cause a detectable reduction in, or killing of, targeted unwanted prokaryotes, e.g., bacteria. The effective amount can also be expressed in the amount of bacteriocin sufficient to cause a detectable reduction in, or killing of, targeted unwanted prokaryotes (e.g., SRPs). In some embodiments, the effective amount/concentration of whole cells of ATCC Accession No. PTA-124262 in the indicated oil and gas environment fluid is a concentration at least comparable to the level of SRPs present in the indicated environment. In one embodiment, an effective amount is at least 110.sup.3, 110.sup.4, 110.sup.5, 110.sup.6, 110.sup.7, 110.sup.8, or 110.sup.9 colony forming units (cfu)/mL. In one embodiment, an effective amount is at least 110.sup.6 cfu/ml. Higher or lower concentrations can also be employed. Similar amounts of other whole cell bacteria demonstrating anti-SRP activity may be combined with similar or smaller amounts of ATCC Accession No. PTA-124262, in the event of synergistic anti-SRP effect.
[0025] In some embodiments, the effective amount of bacteriocin in the indicated oil and gas environment fluid is an amount at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 5, 10, 30, 50, 80, or 100 ppm. In one embodiment, the dose is about 1 ppm. In some embodiments, the effective amount of bacteriocin in the indicated oil and gas environment fluid is an amount at least 0.1, 1, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290 or about 300 mg/ml. Higher or lower concentrations can also be employed. Similar amounts of other bacteriocins demonstrating anti-SRP activity may be combined with similar or smaller amounts of ATCC Accession No. PTA-124262 bacteriocin, in the event of synergistic anti-SRP effect.
[0026] The phrase anti-SRP effect or anti-SRP activity means the ability to interfere with or reduce the propagation of functional SRPs. In another embodiment, anti-SRP activity means the ability to kill SRPs.
[0027] The words comprise, comprises, and comprising are to be interpreted inclusively rather than exclusively, i.e., to include other unspecified components or process steps. The words consist, consisting, and its variants, are to be interpreted exclusively, rather than inclusively, i.e., to exclude components or steps not specifically recited.
[0028] The terms a or an refers to one or more. For example, an expression cassette is understood to represent one or more such cassettes. As such, the terms a (or an), one or more, and at least one are used interchangeably herein.
[0029] As used herein, the term about means a variability of plus or minus 10% from the reference given, unless otherwise specified.
Compositions
[0030] In one embodiment, a newly discovered strain of Pseudomonas aeruginosa bacteria produces a bacteriocin in situ having broad killing range for SRPs. In one embodiment, the newly isolated P. aeruginosa was deposited on Jun. 28, 2017 under Accession No. PTA-124262 with the American Type Culture Collection, located at 10801 University Boulevard, Manassas, Va. 20110 USA. As described in the examples below, this novel Gram negative, Pseudomonas strain was isolated from an oil and gas environment, i.e., from oil and gas field wastewater. This strain has been shown to inhibit SRP growth in zone-of-inhibition assays on agar plates. The anti-SRP activity was found to be associated with an R-type pyocin (Pseudomonas bacteriocin with a bacteriophage tail structure).
[0031] In another embodiment, progeny of ATCC Accession No. PTA-124262 and/or derivatives thereof are provided and can be used in the compositions and methods described herein. By progeny is meant repeated generations of ATCC Accession No. PTA-124262 resulting from repeated culturing and including any mutations that occur naturally during culturing. By derivatives are meant progeny bacteria of the deposited microorganisms which carry mutations or deletions of amino acids or nucleotide bases which are created in the bacterial genome by genetic engineering or recombinant manipulation techniques.
[0032] In one embodiment, ATCC Accession No. PTA-124262 and progeny or derivatives carry naturally occurring or genetically manipulated proteins including tail fiber and tail tube proteins. The anti-SRP bacteriocin produced by ATCC Accession No. PTA-124262 is an R-type pyocin with the structure of a phage tail. The complex consists of about 130 copies of a FI tail sheath monomer SEQ ID NO: 3, with a length of 386 AA and a predicted weight of 41 kDa, and about 130 copies of a FII tail tube monomer SEQ ID NO: 4 with a length of 167 AA and a predicted weight of 18 kDa. The approximate predicted molecular weight of the entire pyocin is 7700 kDa. The anti-SRP activity of the bacteriocin is associated with the particular three dimensional structure/interaction of the associated tail fiber proteins. Altering these sequences is anticipated to alter or broaden the specificity of the bacteriocin. The tail fiber proteins SEQ ID NO: 1 and 2 are present at low copy number. The tail fiber proteins are involved in binding of the pyocin to a target cell, i.e. host range specificity. The major structural proteins aren't directly involved in host recognition.
[0033] Amino acid sequences for the two major structural proteins and two of the tail fiber proteins of the ATCC Accession No. PTA-124262 anti-SRP bacteriocin are:
TABLE-US-00001 contig00021_64327_64860Phagetailfibers~20kDa: SEQIDNO:1 MSSRLLPPNRSSLERSLGDVLPAELPVPLRELNDPARCEAALLPYLAWTR SVDRWDPDWSDEAKRNAVATSFVLHQRKGTLTALRQVVEPIGALSEVTEW WQRSPLGVPGTFEITVDVSDRGIDEGTVLELERLLDDVRPVSRHLTRLDL RITPVIRSRHGLAVTDGDTLEIFPWKQ contig00021_64862_66967Phagetailfiberprotein ~73kDa SEQIDNO:2 MTTNTPKYGGLLTDIGAAALAAASAAGKKWQPTHMLIGDAGGAPGDTPDP LPSAAQKSLINQRHRAQLNRLFVSDKNANTLVAEVVLPVEVGGFWIREIG LQDADGKFVAVSNCPPSYKAAMESGSARTQTIRVNIALSGLENVQLLIDN GIIYATQDWVKEKVAADFKGRKILAGNGLVGGGDLSADRSIGLAPSGVTA GSYRSVTVNANGVVTQGSNPTTLAGYAIGDAYTKADTDGKLAQKANKATT LAGYGITDALRVDGNAVSSSRLAAPRSLAASGDASWSVTFDGSANVSAPL SLSATGVAAGSYPKVTVDTKGRVTAGMALAATDIPGLDASKLVSGVLAEQ RLPVFARGLATAVSNSSDPNTATVPLMLTNHANGPVAGRYFYIQSMFYPD QNGNASQIATSYNATSEMYVRVSYAANPSIREWLPWQRCDIGGSFTKTTD GSIGNGVNINSFVNSGWWLQSTSEWAAGGANYPVGLAGLLIVYRAHADHI YQTYVTLNGSTYSRCCYAGSWRPWRQNWDDGNFDPASYLPKAGFTWAALP GKPATFPPSGHNHDTSQITSGILPLARGGLGANTAAGARNNIGAGVPATA SRALNGWWKDNDTGLIVQWMQVNVGDHPGGIIDRTLTFPIAFPSACLHVV PTVKEVGRPATSASTVTVADVSVSNTGCVIVSSEYYGLAQNYGIRVMAIG Y contig00021_67458_68618Phagetailsheathmonomer (FItailsheath)~41kDa(~130copiespertail) SEQIDNO:3 MSFFHGVTVTNVDIGARTIALPASSVIGLCDVFTPGAQASAKPNVPVLLT SKKDAAAAFGIGSSIYLACEAIYNRAQAVIVAVGVEAAETPEAQASAVIG GVSAAGERTGLQALLDGKSRFNAQPRLLVAPGHSAQQAVATAMDGLAEKL RAIAILDGPNSTDEAAVAYAKNFGSKRLFMVDPGVQVWDSATNAARNAPA SAYAAGLFAWTDAEYGFWSSPSNKEIKGVTGTSRPVEFLDGDETCRANLL NNANIATIIRDDGYRLWGNRTLSSDSKWAFVTRVRTMDLVMDAILAGHKW AVDRGITKTYVKDVTEGLRAFMRDLKNQGAVINFEVYADPDLNSASQLAQ GKVYWNIRFTDVPPAENPNFRVEVTDQWLTEVLDVA contig00021_68631_69134Phagemajortailtube protein(FIItailtube)~18kDa(~130copiesper tail) SEQIDNO:4 MIPQTLTNTNLFIDGVSFAGDVPSLTLPKLAVKTEQYRAGGMDAPVSIDM GLEAMEAKFSTNGARREALNFFGLADQSAFNGVFRGSFKGQKGASVPVVA TLRGLLKEVDPGDWKAGEKAEFKYAVAVSYYKLEVDGREVYEIDPVNGVR AINGVDQLAGMRNDLGL
[0034] Such proteins may be genetically manipulated or engineered to result in certain mutated proteins having desirable characteristics. Thus, proteins produced by the progeny and derivatives of ATCC Accession No. PTA-124262 include naturally occurring proteins, such as SEQ ID Nos 1-4, encoded by the genomic DNA or cDNA derived from the microorganism, as well as functional proteins (i.e., proteins that demonstrate the biological activity of the normally functioning protein SEQ ID Nos: 1, 2, 3 and/or 4, with mutations or modifications of its encoding DNA sequence or within its amino acid sequence. In another embodiment, such a functional protein can include mutations which cause the protein to perform its anti-SRP functions better than a native or endogenous sequence. In one embodiment, such a functional bacteriocin or one of its individual protein elements can be considered a normal or normally-functioning protein.
[0035] Also included in the use of the definitions of the bacteriocin protein and tail fiber proteins described herein include sequences which differ from the reference sequences SEQ ID NO: 1, 2, 3 and/or 4 by virtue of naturally occurring nucleic acid base or amino acid mutations or silent mutations that occur in, or among, a selected species, or amino acid sequences which differ by conservative amino acid replacements, or sequences having at least 90, at least 95 or at least 99 percent identity with the reference sequences SEQ ID NO: 1, 2, 3 and/or 4.
[0036] Thus, in one embodiment, the tail fiber or bacteriocin protein sequences of ATCC Accession No. PTA-124262 and progeny or derivatives include a variant which shares or comprises at least 70, at least 75%, at least 78% or at least 80% identity with SEQ ID NO: 1, 2, 3 or 4. In another embodiment, the tail fiber or bacteriocin protein sequences share at least 85% identity with a native protein produced by these bacteria. In another embodiment, the bacteriocin or tail fiber protein sequence shared at least 90% identity with a native bacteriocin or tail fiber protein sequence (i.e., SEQ ID NO: 1, 2, 3 or 4). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 91% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 92% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 93% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 94% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 95% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 96% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 97% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 98% identity with a native bacteriocin or tail fiber protein(s). In another embodiment, the bacteriocin or tail fiber protein(s) sequence shares at least 99% identity with a native bacteriocin or tail fiber protein(s) described herein. In a similar manner, the nucleotide sequences encoding the bacteriocin or tail fiber protein(s) of ATCC Accession No. PTA-124262 and its progeny or derivatives may share analogous percent identities over a stretch of contiguous nucleotide bases encoding the proteins.
[0037] The terms percent (%) identity, sequence identity, percent sequence identity, or percent identical in the context of amino acid sequences refers to the residues in the two sequences which are the same when aligned for correspondence. Percent identity may be readily determined for amino acid sequences over the full-length of a protein, polypeptide, about 10 amino acids to about 300 amino acids, or a peptide fragment thereof. Percent identity may be readily determined for nucleotide sequences over the full-length nucleic acid sequence coding sequences or partial coding sequences, or non-coding sequences.
[0038] Generally, when referring to identity, homology, or similarity between two different sequences, identity, homology or similarity is determined in reference to aligned sequences. Aligned sequences or alignments refer to multiple nucleic acid sequences or protein (amino acids) sequences, often containing corrections for missing or additional bases or amino acids as compared to a reference sequence. Alignments are performed using any of a variety of publicly or commercially available Multiple Sequence Alignment Programs. Sequence alignment programs are available for amino acid sequences, e.g., the Clustal X, MAP, PIMA, MSA, BLOCKMAKER, MEME, and Match-Box programs. Generally, any of these programs are used at default settings, although one of skill in the art can alter these settings as needed. Alternatively, one of skill in the art can utilize another method which provides at least the same level of identity or alignment as that provided by the referenced methods. See, e.g., J. D. Thomson et al, Nucl. Acids. Res., A comprehensive comparison of multiple sequence alignments, 27(13):2682-2690 (1999).
[0039] The bacteriocin or tail fiber protein(s) of the deposited microorganism or its progeny or derivatives may also be optimized or codon-optimized. The bacteriocin or tail fiber protein(s) can be encoded by a DNA sequence which differs from the native or naturally occurring sequence, such as that of SEQ ID NO: 1, 2, 3 or 4, by codon changes that make silent, conservative or non-conservative amino acid changes, or amino acid insertions or deletions in the protein(s). These changes may increase protein production and/or enhance protein conformation and stability. Synonymous codon changes or codon changes resulting in conservative amino acid changes, or insertions or deletions can increase protein production and/or enhance protein conformation and stability.
[0040] Creating bacteriocins or tail fiber proteins that differ from the native sequences can be accomplished by various different methods. Optimization may be performed using methods which are available on-line, published methods, or a company which provides codon optimizing services (see e.g., in International Patent Application Pub. No. WO 2015/012924, which is incorporated by reference herein). Briefly, the nucleic acid sequence encoding the desired protein is modified with synonymous codon sequences. Suitably, the entire length of the open reading frame (ORF) for the bacteriocin or tail fiber protein(s) is modified. However, in some embodiments, only a fragment of the ORF may be altered. By using one of these methods, one can produce a nucleic acid fragment of a codon-optimized coding region which encodes the bacteriocin or tail fiber protein. Such modifications or synthesis of bacteriocins and/or tail fiber proteins can be performed using standard and routine molecular biological manipulations well known to those of ordinary skill in the art. See, Green and Sambrook et al, Molecular Cloning. A Laboratory Manual, Fourth Edition, 2012 by Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., among other texts.
[0041] It is anticipated that several other gene products are required for full transcription, assembly, function and specificity of the anti-SRP bacteriocin.
[0042] Compositions described herein, in one embodiment, have broad range killing activity against SRPs and comprise, in one embodiment, whole cell Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof and a suitable carrier. In another embodiment, such a composition can also include at least one or more additional bacteria that is or are useful in reducing corrosion or souring. Among such bacteria include other strains of Pseudomonas aeruginosa. In another embodiment strains of Thauera aminoaromatica may be included in the composition. In still another embodiment, strains of the bacteria Ideonella may be employed. Still other bacteria known or found to produce anti-SRP bacteriocins or to compete with IRBs, APBs, and the like present in oil and gas field environments may be combined with ATCC Accession No. PTA-124262 in a suitable composition. Other known bacterial strains known by the art to be suitable for anti-souring and anti-corrosion effect may also be added to the compositions described herein.
[0043] In still another embodiment, the compositions containing ATCC Accession No. PTA-124262 may also contain additional suitable bacteriocin protein(s) rather than additional whole cell bacteria, for such use. See, e.g., the bacteriocin described in US published patent application No. 2014/0090833, incorporated by reference herein.
[0044] Compositions having broad range killing activity against SRPs comprise, in another embodiment, a bacteriocin produced from the bacterium ATCC Accession No. PTA-124262 and progeny or derivatives thereof as described above, and a suitable carrier. In another embodiment, such a composition can also include at least one or more additional bacteriocin(s) that is/are useful in reducing corrosion or souring. Among such bacteriocins are included those produced by other strains of Pseudomonas aeruginosa, such as pyocin R1, R2, R3, R4, S1, S2, S3, S4, S5, F1, F2, F3, AP41, and AR41, which may have anti-corrosion or anti-SRP activity. In another embodiment strains of Thauera aminoaromatica may be included in the composition. In still another embodiment, bacteriocin produced by strains of the bacteria Ideonella may be employed. Still other bacteriocins known to be toxic to IRBs, APBs, and the like present in oil and gas field environments may be combined with the bacteriocin produced by ATCC Accession No. PTA-124262 in a suitable composition. Other known bacteriocins known by the art to be suitable for anti-souring and anti-corrosion effect may also be added to the compositions described herein, such as those described in US published patent application No. 2014/0090833, incorporated by reference herein. Other bacteria or bacteriocins isolated therefrom having a corrosion protective potential may be employed in concert with whole cell bacterium ATCC Accession No. PTA-124262 and progeny or derivatives thereof, including without limitation, Bacillus thuringiensis-SN8 (Bano, Arjumand Shah, and Javed Iqbal Qazi. Soil buried Mild Steel Corrosion by Bacillus cereus-SNB4 and its Inhibition by Bacillus thuringiensis-SN8. Pakistan J. Zool 43.3 (2011): 555-562); Bacillus subtilis-LFE-1, Bacillus firmus-H2O-1 and Bacillus licheniformis-T6-5 (Korenblum, E., et al. Production of antimicrobial substances by Bacillus subtilis LFE-1, B. firmus H2O-1 and B. licheniformis T6-5 isolated from an oil reservoir in Brazil. Journal of Applied Microbiology 98.3 (2005): 667-675); Bacillus sp. H2O-1 (Korenblum, Elisa, et al. Purification and characterization of a surfactin-like molecule produced by Bacillus sp. H2O-1 and its antagonistic effect against sulfate reducing bacteria. BMC microbiology 12.1 (2012): 252).
[0045] In one embodiment, such whole cell ATCC Accession No. PTA-124262 only may be prepared for use in one or more of the carriers described and defined above for a variety of uses. In another embodiment, mixtures of ATCC Accession No. PTA-124262 with such other bacteria as mentioned above may be prepared for use in one or more of the carriers described and defined above for a variety of uses. In another embodiment, mixtures of ATCC Accession No. PTA-124262 cells with bacteriocin produced by the other above-mentioned bacteria may be prepared for use in one or more of the carriers described and defined above for a variety of uses. In still another embodiment bacteriocin and/or tail fiber protein (s) produced by and isolated from ATCC Accession No. PTA-124262, which may be mutated or modified as described above, may be prepared for use in one or more of the carriers described and defined above for a variety of uses. In another embodiment, mixtures of the bacteriocin of ATCC Accession No. PTA-124262 (naturally occurring and/or modified as described above) with other bacteriocins produced by other bacteria, may be prepared for use in one or more of the carriers described and defined above for a variety of uses. In still a further embodiment, mixtures of whole cell ATCC Accession No. PTA-124262 with its own or other bacteriocin compositions may be prepared for use in one or more of the carriers described and defined above for a variety of uses.
[0046] Such whole cell, bacteriocin or mixed whole cell and bacteriocin may be added to compositions for use or measured in situ in concentrations suitable to achieve their anti-SRP, anti-souring, anti-corrosion effect, as also defined herein.
Methods
[0047] The anti-SRP activity of P. aeruginosa ATCC Accession No. PTA-124262 is useful in diminishing the SRP population in mixed biofilms in which it is present. It is theorized that ATCC Accession No. PTA-124262 is an oilfield isolate that may have existed in close proximity to SRPs in the oilfield; and that bacteriocins are produced by bacteria to diminish other bacterial populations that exist in close proximity and that compete for the same/similar carbon sources (i.e. both can use lactate). Many bacteria in the environment exist within multi-species biofilm formations.
[0048] Treatment of pipelines and other oil and gas field environments, within oil drilling and natural gas fracking operations, with whole-cell ATCC Accession No. PTA-124262 co-colonizes new or pre-existing SRP-containing biofilms with an organism that has the effect of diminishing the SRP population within the biofilm. While complete biofilm dispersal may or may not occur during treatment, sulfide production is reduced, thereby reducing the risk of souring and MIC.
[0049] In one embodiment, the whole-cell P. aeruginosa ATCC Accession No. PTA-124262 compositions described herein having anti-SRP functionality, represent an inexpensive, differentiated technology that is not expected to encounter difficult regulatory hurdles.
[0050] Thus, in one embodiment, a method of controlling prokaryotes in an oil or gas field environment or treatment fluid, as defined above, comprises contacting the selected environment with an amount of Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof effective to produce bacteriocin in situ which is virulent for the unwanted prokaryotes. The contacting occurs for a time sufficient to permit the bacterium to produce bacteriocin virulent for the unwanted prokaryotes or for the bacteriocin to kill the unwanted prokaryotes. As described above, the unwanted prokaryotes are SRPs, including without limitation one or more of D. alaskensis, D. desulfuricans, D. longus, or D. vulgaris. The method further comprises optionally contacting the selected oil and gas field environment with whole cell bacteria of another strain of Pseudomonas aeruginosa, or Thauera aminoaromatica or Ideonella that are capable of killing SRP.
[0051] In another embodiment, a method of controlling unwanted prokaryotes in an oil or gas field environment or treatment fluid, as defined above, comprises contacting the selected environment with an amount of a bacteriocin produced by Pseudomonas aeruginosa bacterium, ATCC Accession No. PTA-124262 and progeny or derivatives thereof. The bacteriocin are provided in effective amounts to be virulent for, reduce the number of, or kill, the unwanted prokaryotes. The method permits the bacteriocin virulent for the unwanted prokaryotes or for the bacteriocin to kill or substantially reduce the growth of the unwanted prokaryotes. As described above, in certain embodiments, the unwanted prokaryotes are SRPs, such as one or more of D. alaskensis, D. desulfuricans, D. longus, or D. vulgaris. The method further comprises optionally contacting the selected oil and gas field environment with bacteriocin produced by bacteria of another strain of Pseudomonas aeruginosa, or Thauera aminoaromatica or Ideonella that are capable of killing SRP.
[0052] In still further embodiments, the methods of reducing or controlling unwanted bacteria in oil and gas field environments comprises adding an effective amount of such whole cell ATCC Accession No. PTA-124262 only, or mixtures of ATCC Accession No. PTA-124262 with other bacteria, or bacteriocin only produced by and isolated from ATCC Accession No. PTA-124262, or mixtures of the bacteriocin of ATCC Accession No. PTA-124262 with other bacteriocins produced by other bacteria, or mixtures of whole cell ATCC Accession No. PTA-124262 with its own or other bacteriocin compositions as described herein to any oil or gas field environment or fluid.
[0053] The embodiment of the methods described herein use whole cell ATCC Accession No. PTA-124262 as a self-propagating biopesticide. These methods do not require costly bacteriocin purification. The use of the whole cell ATCC Accession No. PTA-124262 specifically targets SRPs (souring and MIC), without the need for added chelating agents, surfactants, etc. The whole cell method described herein represents a natural alternative that provides targeted biocontrol of MIC. From a regulatory perspective, use of the whole cell culture as a biopesticide is likely to be considered safer than chemical biocides. In one embodiment, the whole-cell bacterial treatment takes the form of a native, environmental isolate that has not undergone any genetic engineering. In addition, the biopesticidal activity propagates within the pipeline as a result of the propagation of the producing organism ATCC Accession No. PTA-124262.
[0054] Without being bound by theory, these methods exploit the strong tendency of microorganisms to exist within mixed biofilms in the environment. It is hypothesized that, although Pseudomonas ATCC Accession No. PTA-124262 and SRPs are not very similar taxonomically, this isolate produces an anti-SRP bacteriocin because it co-existed with SRPs in the oilfield environment and evolved an anti-SRP bacteriocin as a self-defense mechanism. While the trigger for turning on the bacteriocin expression is unknown, it is hypothesized that co-colonization of a biofilm by ATCC Accession No. PTA-124262 and SRPs promotes production or over-production of the anti-SRP bacteriocin.
[0055] In addition to the method steps defined above, other methods used in oil and gas operations to remediate unwanted prokaryotes that cause fouling, corrosion and reservoir souring (H.sub.2S production) may also employ the compositions containing ATCC Accession No. PTA-124262 or its bacteriocin described herein. A variety of suitable methods are described in U.S. Pat. No. 8,168,419 issued May 1, 2012 and U.S. Pat. No. 8,252,576, issued Aug. 28, 2012, the disclosures of which are incorporated herein by reference.
[0056] The compositions containing ATCC Accession No. PTA-124262 or its bacteriocin may be added to bacteriophage as well as other biocides. Since the bacteria in oil and gas wells are diverse, the remediation of a dominant strain may allow a less dominant strain to become dominant. In such case the less dominant may not be killed by the initially applied biocide composition (cocktail) used so that the cocktail composition is changed to remediate the dynamic changing population of unwanted prokaryotes. The change is effected base on monitored analysis or timed sequence.
[0057] A method of accomplishing such dynamic behavior is described in U.S. published application 2014/0273159, published, Sep., 18, 2014, for staged bacteriophage. The same procedures and methods may be applied for the composition (whole cell or bacteriocin or mixed) described herein. The whole cell ATCC Accession No. PTA-124262 or its bacteriocin may be contained in cocktails with bacteriophage including those described in U.S. published application 2014/0273159, published Sep. 18, 2014, the disclosure of which is incorporated herein by reference.
[0058] In one embodiment, a process for control of a broad range of target bacteria comprises culturing a dominant group of bacteria in a mixed bacteria solution. A composition containing ATCC Accession No. PTA-124262 which produces its bacteriocin in situ, or a composition containing the bacteriocin isolated from ATCC Accession No. PTA-124262 as well as other additional whole cell bacterial strains (e.g., Pseudomonas aeruginosa, Thauera aminoaromatica and Ideonella) and/or bacteriocin isolated therefrom are added to remove the dominant bacteria from the mix. The next dominant strain is cultured from the solution. An effective amount of whole cell ATCC Accession No. PTA-124262 and its bacteriocin with or without other bacteria or isolated bacteriocins from other bacterial strains is thereafter added to remove the next dominant bacteria. This series of steps is repeated to provide a set of ATCC Accession No. PTA-124262 progeny or derivatives thereof, and/or isolated bacteriocin that will reduce the dominant and sub-dominant bacteria. An effective amount of the ATCC Accession No. PTA-124262 progeny or derivatives or bacteriocin produced thereby that is/are so isolated in each step is thereafter applied as either a mixture or in sequential application to oil and gas field environments or treatment fluids containing a mixture of target bacteria of those found in each step of the above sequence.
[0059] It is further anticipated that the novel ATCC Accession No. PTA-124262 or its bacteriocin may be used for microbial control in environments, fluids and industries other than oil and gas production, e.g., for wastewater treatment in other contexts or even as additives to other products requiring microbial control.
EXAMPLES
[0060] The following examples disclose specific embodiments of the methods and compositions and should be construed to encompass any and all variations that become evident as a result of the teaching provided herein.
Example 1: Screening for Strains Producing Antimicrobial Substances Against Oil Field SRP
[0061] Several thousand bacterial strains isolated from up to one hundred oil and gas samples were screened for their capabilities to produce substances that kill SRPs. The oil and gas samples include fracturing water, produced water, pit water, waste water collected mainly from North American production plants (oil and gas water systems). In detail, these samples were serial diluted and plated onto SRP selecting media plates. After incubation, the grown up individual colonies were picked and transferred onto a fresh plate. The colony leftovers on the original plate were killed by chloroform vapor.
[0062] The killed plates were overlaid with indicator bacterial lawns freshly made with different SRPs, including D. alaskensis, D. desulfuricans, D. longus, D. vulgaris and EBS.14 (a field isolate from Barnett Shale). After incubation, any zone of inhibition (ZOI) on the indicator SRP lawns was noted and the matching copy of the producing strain (transferred on a separate plate before killing) was purified and identified. ATCC Accession No. PTA-124262 was evaluated by 16S rDNA sequencing as Pseudomonas aeruginosa. The antimicrobial substance produced by this strain showed broad killing spectrum against 34 of 45 different SRP strains isolated from oil and gas fields.
Example 2: Preparation of Bacteriocin Extract from Pseudomonas aeruginosa EC42.15
[0063] A single colony of Pseudomonas aeruginosa EC42.15 ATCC Accession No. PTA-124262 was inoculated into 10 mL tryptic soy broth (TSB) and the culture was incubated overnight at 30 C. with shaking at 50 rpm. An aliquot of the overnight culture was transferred into a larger volume of TSB, using a 2% (v/v) inoculation level. The larger culture was incubated (30 C., 50-100 rpm) and the culture density was monitored until an OD.sub.600 of about 0.4 was reached. Mitomycin C was then added to the culture to a final level of 1 g/mL. Incubation (30 C., 50 rpm) was continued for an additional 18 hrs. Cells were collected by centrifugation at 11,000g. The clarified supernatant (bacteriocin extract) was sterile-filtered and refrigerated.
[0064] The anti-SRP activity of the bacteriocin extract was partially purified using an ultrafiltration unit. The bacteriocin extract was passed through a 300 kDa molecular weight cut-off membrane, while stirring under an external pressure of 10 psi nitrogen. Ultrafiltration continued until the retentate volume was 10% of the starting volume. The retentate, which contained the anti-SRP activity, was desalted by diluting to the original volume in 10 mM Tris-Cl, pH 7.5, and repeating the concentration step. The partially purified bacteriocin extract was stored refrigerated.
Example 3: Characterization and Production of the Antimicrobial Substances Produced by P. aeruginosa ATCC Accession No. PTA-124262
[0065] The genome of P. aeruginosa ATCC Accession No. PTA-124262 was sequenced. The complete bioinformatics analysis of the genome sequence identified DNA regions coding putative antimicrobial proteins, SEQ ID Nos: 1, 2, 3 and 4. These antimicrobial proteins were partially purified from the culture supernatant and the specific activity against SRPs was determined as described above. It is anticipated that further modification of these proteins will permit efficient production for application in controlling SRP of oil and gas industries. The antimicrobial proteins can be expressed in their native host, i.e., ATCC Accession No. PTA-124262, or expressed in a different bacterial host for maximum production rate. Multiple antimicrobial proteins with different SRP killing spectrums can be combined for broader SRP control in the oil and gas industry.
[0066] The bacteriocin of ATCC Accession No. PTA-124262 is an R-type pyocin with a phage tail structure. The complex consists of about 130 copies of a FI tail sheath monomer SEQ ID NO: 3, with a length of 386 AA and a predicted weight of 41 kDa, and about 130 copies of a FII tail tube monomer SEQ ID NO: 4 with a length of 167 AA and a predicted weight of 18 kDa. The approximate predicted molecular weight of the entire pyocin is 7700 kDa. The estimate of expression level of the R-type pyocin in induced culture was 10 mg/L. The bacteriocin produced by ATCC Accession No. PTA-124262 was effective in producing a zone of inhibition, showing bioefficacy against D. alaskensis in the sub-nanomolar range, i.e., on a plate at a level of 1 ppm.
Example 4: Analysis of the Effect of Whole Cell Pseudomonas aeruginosa EC42.15 ATCC Accession No. PTA-124262 on the Viability of Desulfovibrio alaskensis ATCC 14563
[0067] The viability of D. alaskensis ATCC 14563 was monitored in the presence of P. aeruginosa EC42.15 (ATCC Accession No. PTA-124262). As a control, the viability of D. alaskensis ATCC 14563 was also monitored in the presence of P. aeruginosa (ATCC Accession No. 15442), which is a P. aeruginosa strain that does not produce a bacteriocin that is active against D. alaskensis. All experiments were conducted in an anaerobic chamber, and all incubations were done at 30 C.
[0068] Stock cultures of P. aeruginosa ATCC Accession No. PTA-124262 and ATCC Accession No. 15442 were prepared in TSB amended with 1% (w/v) potassium nitrate (TSB-N). Stock cultures of D. alaskensis were prepared in ATCC Medium 1250: Modified Baar's Medium for Sulfate Reducers with NaCl (2.5% w/v) (MB-1250). The media used for testing the effect of the P. aeruginosa strains on the viability of D. alaskensis consisted of a 1:1 mixture of the two medias noted above. P. aeruginosa was enumerated by observing turbidity in 96-well plates containing TSB-N. This medium also allowed for selective enumeration of P. aeruginosa from mixtures of this strain with D. alaskensis. D. alaskensis was enumerated by observing iron sulfide precipitation in 96-well plates containing MB-1250 with iron indicator. This medium also allowed for selective enumeration of D. alaskensis from mixtures of this strain with P. aeruginosa.
[0069] Test samples were prepared by inoculating aliquots of the 1:1 media with 1% (v/v) P. aeruginosa alone, 1% (v/v) D. alaskensis alone or 1% (v/v) each of P. aeruginosa and D. alaskensis. All test samples were enumerated for both P. aeruginosa and D. alaskensis at selected time points. The data are summarized in Table I. The dose of the whole bacteriocin-producing cells is comparable to the level of sulfate-reducing bacteria present, or 110.sup.6 cfu/mL.
TABLE-US-00002 TABLE I Co-Cultures Single Cultures P. aeruginosa D. alaskensis + P. aeruginosa strains + D. P. aeruginosa strains alone D. alaskensis strains EC42.15 alaskensis EC42.15 EC42.15 ATCC alone ATCC ATCC Time PTA- ATCC ATCC PTA- ATCC PTA- ATCC (hrs) 124262 15422 14563 124262 15422 124262 15422 cfu/mL (Study #1) 0 6.4E+06 6.4E+05 5.6E+06 5.6E+05 4 2.4E+06 2.4E+06 5.2E+06 5.2E+06 24 7.7E+07 5.6E+06 7.7E+07 5.6E+03 48 7.7E+07 5.6E+06 7.7E+07 5.6E+05 cfu/mL (Study #2) 0 3.0E+05 4.3E+07 1.6E+05 4 3.2E+07 6.1E+07 1.4E+05 2.6E+07 6.1E+07 1.3E+05 2.4E+05 24 6.1E+07 6.1E+07 3.3E+06 6.1E+07 6.1E+07 5.2E+03 1.8E+04 48 6.1E+07 6.1E+07 1.6E+06 6.1E+07 6.1E+07 7.6E+02 4.3E+07 192 6.1E+07 3.3E+07 6.1E+07 6.1E+07 6.1E+07 1.3E+06 7.3E+06
[0070] These data demonstrate decreased viability of the D. alaskensis SRP strain when it is cultured in the presence of P. aeruginosa ATCC PTA-124262.
[0071] Each and every patent, patent application, and publication, including websites cited throughout specification are incorporated herein by reference. Similarly, the SEQ ID NOs which are referenced herein and which appear in the appended Sequence Listing are incorporated by reference. While the invention has been described with reference to particular embodiments, it will be appreciated that modifications can be made without departing from the spirit of the invention. Such modifications are intended to fall within the scope of the appended claims.