Compositions and methods for treating CEP290 associated disease
11566263 · 2023-01-31
Assignee
Inventors
- Morgan Lee Maeder (Jamaican Plain, MA, US)
- Rina J. Mepani (Belmont, CA)
- Michael Stefanidakis (Brookline, MA)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N2320/32
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12N2330/50
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/90
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
A61K9/00
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
Abstract
Nucleic acids and viral vectors, particularly adeno-associated virus (AAV) vectors are provided that encode Cas9 and paired guide RNAs. The nucleic acids and vectors, and compositions that comprise them, can be used in methods to treat subjects, to alter cells in subjects who may suffer from an inherited retinal dystrophy such as CEP290 associated disease or who may be in need of alteration of a cell or a cellular nucleic acid sequence associated with an inherited retinal dystrophy such as the CEP290 gene, and/or to treat inherited retinal dystrophies including CEP290 associated disease.
Claims
1. A method of treating a subject, comprising: contacting a retina of the subject with one or more recombinant viral vectors comprising one or more nucleic acids encoding a Cas9, a first guide RNA (gRNA) and a second gRNA, wherein (a) the first and second gRNAs are adapted to form first and second ribonucleoprotein complexes with the Cas9, and (b) the first and second ribonucleoprotein complexes are adapted to cleave first and second cellular nucleic acid sequences on first and second sides of a CEP290 target position, thereby altering a nucleotide sequence of the CEP290 target position, wherein the first cellular nucleic acid sequence is different from the second cellular nucleic acid sequence, wherein the one or more recombinant viral vectors contact the retina at a dose of 1×10.sup.11 viral genomes (vg)/mL to 9×10.sup.13 vg/mL.
2. The method of claim 1, wherein the dose is selected from the group consisting of 1×10.sup.11 vg/mL, 2×10.sup.11 vg/mL, 3×10.sup.11 vg/mL, 4×10.sup.11 vg/mL, 5×10.sup.11 vg/mL, 6×10.sup.11 vg/mL, 7×10.sup.11 vg/mL, 8×10.sup.11 vg/mL, 9×10.sup.11 vg/mL, 1×10.sup.12 vg/mL, 2×10.sup.12 vg/mL, 3×10.sup.12 vg/mL, 4×10.sup.12 vg/mL, 5×10.sup.12 vg/mL, 6×10.sup.12 vg/mL, 7×10.sup.12 vg/mL, 8×10.sup.12 vg/mL, 9×10.sup.12 vg/mL, 1×10.sup.13 vg/mL, 2×10.sup.13 vg/mL, 3×10.sup.13 vg/mL, 4×10.sup.13 vg/mL, 5×10.sup.13 vg/mL, 6×10.sup.13 vg/mL, 7×10.sup.13 vg/mL, 8×10.sup.13 vg/mL, and 9×10.sup.13 vg/mL.
3. The method of claim 1, wherein the subject has Leber Congenital Amaurosis-10 (LCA-10).
4. The method of claim 1, wherein the one or more recombinant viral vectors are AAV vectors.
5. The method of claim 4, wherein the AAV vectors are AAV5 vectors.
6. The method of claim 1, wherein the first gRNA comprises a targeting domain of SEQ ID NO:1 and the second gRNA comprises a targeting domain of SEQ ID NO:4; the first gRNA comprises a targeting domain of SEQ ID NO:2 and the second gRNA comprises a targeting domain of SEQ ID NO:5; or the first gRNA comprises a targeting domain of SEQ ID NO:3 and the second gRNA comprises a targeting domain of SEQ ID NO:6.
7. The method of claim 6, wherein the first gRNA comprises a targeting domain of SEQ ID NO:1 and the second gRNA comprises a targeting domain of SEQ ID NO:4.
8. The method of claim 6, wherein the first gRNA comprises a targeting domain of SEQ ID NO:2 and the second gRNA comprises a targeting domain of SEQ ID NO:5.
9. The method of claim 6, wherein the first gRNA comprises a targeting domain of SEQ ID NO:3 and the second gRNA comprises a targeting domain of SEQ ID NO:6.
10. A method of altering a retinal cell, comprising: contacting a retina of a subject with one or more recombinant viral vectors comprising one or nucleic acid encoding a Cas9, a first gRNA and a second gRNA, wherein the first gRNA comprises a targeting domain selected from the group consisting of SEQ ID NOS: 1-3 and the second gRNA comprises a targeting domain selected from the group consisting of SEQ ID NOS: 4-6, wherein the one or more recombinant viral vectors contact the retina at a dose of 1×10.sup.11 vg/mL to 9×10.sup.13 vg/mL.
11. The method of claim 10, wherein the dose is selected from the group consisting of 1×10.sup.11 vg/mL, 2×10.sup.11 vg/mL, 3×10.sup.11 vg/mL, 4×10.sup.11 vg/mL, 5×10.sup.11 vg/mL, 6×10.sup.11 vg/mL, 7×10.sup.11 vg/mL, 8×10.sup.11 vg/mL, 9×10.sup.11 vg/mL, 1×10.sup.12 vg/mL, 2×10.sup.12 vg/mL, 3×10.sup.12 vg/mL, 4×10.sup.12 vg/mL, 5×10.sup.12 vg/mL, 6×10.sup.12 vg/mL, 7×10.sup.12 vg/mL, 8×10.sup.12 vg/mL, 9×10.sup.12 vg/mL, 1×10.sup.13 vg/mL, 2×10.sup.13 vg/mL, 3×10.sup.13 vg/mL, 4×10.sup.13 vg/mL, 5×10.sup.13 vg/mL, 6×10.sup.13 vg/mL, 7×10.sup.13 vg/mL, 8×10.sup.13 vg/mL, and 9×10.sup.13 vg/mL.
12. The method of claim 10, wherein the one or more recombinant viral vectors are administered to a subretinal space of the retina.
13. The method of claim 10, wherein the subject has Leber Congenital Amaurosis-10 (LCA-10).
14. The method of claim 10, wherein the one or more recombinant viral vectors are AAV vectors.
15. The method of claim 14, wherein the AAV vectors are AAV5 vectors.
16. The method of claim 10, wherein the first gRNA comprises a targeting domain of SEQ ID NO:1 and the second gRNA comprises a targeting domain of SEQ ID NO:4.
17. The method of claim 10, wherein the first gRNA comprises a targeting domain of SEQ ID NO:2 and the second gRNA comprises a targeting domain of SEQ ID NO:5.
18. The method of claim 10, wherein the first gRNA comprises a targeting domain of SEQ ID NO:3 and the second gRNA comprises a targeting domain of SEQ ID NO:6.
19. A method of treating a subject having an inherited retinal dystrophy, comprising: administering to a retina of the subject with one or more recombinant viral vectors comprising one or more nucleic acids encoding a Cas9 and a first gRNA comprising a sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOS: 7 and 8; wherein (a) the first gRNA is adapted to form a first ribonucleoprotein complex with the Cas9, and (b) the first ribonucleoprotein complex is adapted to cleave a first cellular nucleic acid sequence associated with the inherited retinal dystrophy, thereby altering the first cellular nucleic acid sequence, wherein the one or more recombinant viral vectors are administered to the retina at a dose of 1×10.sup.11 vg/mL to 9×10.sup.13 vg)/mL.
20. The method of claim 19, wherein the dose is selected from the group consisting of 1×10.sup.11 vg/mL, 2×10.sup.11 vg/mL, 3×10.sup.11 vg/mL, 4×10.sup.11 vg/mL, 5×10.sup.11 vg/mL, 6×10.sup.11 vg/mL, 7×10.sup.11 vg/mL, 8×10.sup.11 vg/mL, 9×10.sup.11 vg/mL, 1×10.sup.12 vg/mL, 2×10.sup.12 vg/mL, 3×10.sup.12 vg/mL, 4×10.sup.12 vg/mL, 5×10.sup.12 vg/mL, 6×10.sup.12 vg/mL, 7×10.sup.12 vg/mL, 8×10.sup.12 vg/mL, 9×10.sup.12 vg/mL, 1×10.sup.13 vg/mL, 2×10.sup.13 vg/mL, 3×10.sup.13 vg/mL, 4×10.sup.13 vg/mL, 5×10.sup.13 vg/mL, 6×10.sup.13 vg/mL, 7×10.sup.13 vg/mL, 8×10.sup.13 vg/mL, and 9×10.sup.13 vg/mL.
21. The method of claim 20, further comprising (a) a second gRNA adapted to form a second ribonucleoprotein complex with the Cas9, and (b) the second ribonucleoprotein complex adapted to cleave a second cellular nucleic acid sequence associated with the inherited retinal dystrophy, thereby altering the second cellular nucleic acid sequence.
22. The method of claim 21, wherein the first gRNA comprises a targeting domain selected from the group consisting of SEQ ID NOS: 1-3 and the second gRNA comprises a targeting domain selected from the group consisting of SEQ ID NOS: 4-6.
23. The method of claim 22, wherein the first gRNA comprises a targeting domain of SEQ ID NO:1 and the second gRNA comprises a targeting domain of SEQ ID NO:4.
24. The method of claim 22, wherein the first gRNA comprises a targeting domain of SEQ ID NO:2 and the second gRNA comprises a targeting domain of SEQ ID NO:5.
25. The method of claim 22, wherein the first gRNA comprises a targeting domain of SEQ ID NO:3 and the second gRNA comprises a targeting domain of SEQ ID NO:6.
26. The method of claim 19, wherein the inherited retinal dystrophy is Leber Congenital Amaurosis-10 (LCA-10).
27. The method of claim 19, wherein the one or more recombinant viral vectors are AAV vectors.
28. The method of claim 27, wherein the AAV vectors are AAV5 vectors.
Description
DESCRIPTION OF THE DRAWINGS
(1) The accompanying drawings exemplify certain aspects and embodiments of the present disclosure. The depictions in the drawings are intended to provide illustrative, and schematic rather than comprehensive, examples of certain aspects and embodiments of the present disclosure. The drawings are not intended to be limiting or binding to any particular theory or model, and are not necessarily to scale. Without limiting the foregoing, nucleic acids and polypeptides may be depicted as linear sequences, or as schematic, two- or three-dimensional structures; these depictions are intended to be illustrative, rather than limiting or binding to any particular model or theory regarding their structure.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
DETAILED DESCRIPTION
Definitions and Abbreviations
(12) Unless otherwise specified, each of the following terms has the meaning set forth in this section.
(13) The indefinite articles “a” and “an” denote at least one of the associated noun, and are used interchangeably with the terms “at least one” and “one or more.” For example, the phrase “a module” means at least one module, or one or more modules.
(14) The conjunctions “or” and “and/or” are used interchangeably.
(15) “Domain” is used to describe a segment of a protein or nucleic acid. Unless otherwise indicated, a domain is not required to have any specific functional property.
(16) An “indel” is an insertion and/or deletion in a nucleic acid sequence. An indel may be the product of the repair of a DNA double strand break, such as a double strand break formed by a genome editing system of the present disclosure. An indel is most commonly formed when a break is repaired by an “error prone” repair pathway such as the NHEJ pathway described below. Indels are typically assessed by sequencing (most commonly by “next-gen” or “sequencing-by-synthesis” methods, though Sanger sequencing may still be used) and are quantified by the relative frequency of numerical changes (e.g., ±1, ±2 or more bases) at a site of interest among all sequencing reads. DNA samples for sequencing can be prepared by a variety of methods known in the art, and may involve the amplification of sites of interest by polymerase chain reaction (PCR) or the capture of DNA ends generated by double strand breaks, as in the GUIDEseq process described in Tsai 2016 (incorporated by reference herein). Other sample preparation methods are known in the art. Indels may also be assessed by other methods, including in situ hybridization methods such as the FiberComb™ system commercialized by Genomic Vision (Bagneux, France), and other methods known in the art.
(17) “CEP290 target position” and “CEP290 target site” are used interchangeably herein to refer to a nucleotide or nucleotides in or near the CEP290 gene that are targeted for alteration using the methods described herein. In certain embodiments, a mutation at one or more of these nucleotides is associated with a CEP290 associated disease. The terms “CEP290 target position” and “CEP290 target site” are also used herein to refer to these mutations. For example, the IVS26 mutation is one non-limiting embodiment of a CEP290 target position/target site.
(18) “Non-homologous end joining” or “NHEJ” as used herein refers to ligation mediated repair and/or non-template mediated repair including canonical NHEJ (cNHEJ), alternative NHEJ (altNHEJ), microhomology-mediated end joining (MMEJ) and synthesis-dependent microhomology-mediated end joining (SD-MMEJ).
(19) “Replacement” or “replaced” as used herein with reference to a modification of a molecule does not require a process limitation but merely indicates that the replacement entity is present.
(20) “Subject” means a human, mouse, or non-human primate. A human subject can be any age (e.g., an infant, child, young adult, or adult), and may suffer from a disease, or may be in need of alteration of a gene.
(21) “Treat,” “treating,” and “treatment” as used herein mean the treatment of a disease in a subject (e.g., a human subject), including one or more of inhibiting the disease, i.e., arresting or preventing its development or progression; relieving the disease, i.e., causing regression of the disease state; relieving one or more symptoms of the disease; and curing the disease.
(22) “Prevent,” “preventing,” and “prevention” as used herein means the prevention of a disease in a subject, e.g., in a human, including (a) avoiding or precluding the disease; (b) affecting the predisposition toward the disease; (c) preventing or delaying the onset of at least one symptom of the disease.
(23) The terms “polynucleotide”, “nucleotide sequence”, “nucleic acid”, “nucleic acid molecule”, “nucleic acid sequence”, and “oligonucleotide” refer to a series of nucleotide bases (also called “nucleotides”) in DNA and RNA, and mean any chain of two or more nucleotides. The polynucleotides can be chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded. The oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, its hybridization parameters, etc. A nucleotide sequence typically carries genetic information, including the information used by cellular machinery to make proteins and enzymes. These terms include double- or single-stranded genomic DNA, RNA, any synthetic and genetically manipulated polynucleotide, and both sense and antisense polynucleotides. This also includes nucleic acids containing modified bases.
(24) Conventional IUPAC notation is used in nucleotide sequences presented herein, as shown in Table 1, below (see also Cornish-Bowden 1985, incorporated by reference herein). It should be noted, however, that “T” denotes “Thymine or Uracil” insofar as a given sequence (such as a gRNA sequence) may be encoded by either DNA or RNA.
(25) TABLE-US-00001 TABLE 1 IUPAC nucleic acid notation Character Base A Adenine T Thymine G Guanine C Cytosine U Uracil K G or T/U M A or C R A or G Y C or T/U S C or G W A or T/U B C, G, or T/U V A, C, or G H A, C, or T/U D A, G, or T/U N A, C, G, or T/U
(26) The terms “protein,” “peptide” and “polypeptide” are used interchangeably to refer to a sequential chain of amino acids linked together via peptide bonds. The terms include individual proteins, groups or complexes of proteins that associate together, as well as fragments, variants, derivatives and analogs of such proteins. Peptide sequences are presented using conventional notation, beginning with the amino or N-terminus on the left, and proceeding to the carboxyl or C-terminus on the right. Standard one-letter or three-letter abbreviations may be used.
(27) Overview
(28) In certain aspects, the present disclosure focuses on AAV vectors encoding CRISPR/Cas9 genome editing systems, and on the use of such vectors to treat CEP290 associated disease. Exemplary AAV vector genomes are schematized in
(29) Turning first to the gRNA pairs utilized in the nucleic acids or AAV vectors of the present disclosure, one of three “left” or “upstream” guides may be used to cut upstream (between exon 26 and the IVS26 mutation), and one of three “right” or “downstream” guides is used to cut downstream (between the IVS26 mutation and exon 27). Targeting domain sequences of these guides are presented in Table 2, below:
(30) TABLE-US-00002 TABLE 2 Upstream (left) and Downstream (right) gRNA Targeting Domain Sequences Upstream (left) guides Targeting domain DNA RNA CEP290- GTTCTGTCCTCAGTAAAAGGTA GUUCUGUCCUCAGUAAAAGGUA 323 (SEQ ID NO: 1) (SEQ ID NO: 26) CEP290- GAATAGTTTGTTCTGGGTAC GAAUAGUUUGUUCUGGGUAC 490 (SEQ ID NO: 2) (SEQ ID NO: 27) CEP290- GAGAAAGGGATGGGCACTTA GAGAAAGGGAUGGGCACUUA 492 (SEQ ID NO: 3) (SEQ ID NO: 28) Downstream (right) guides Targeting domain DNA RNA CEP290- GTCAAAAGCTACCGGTTACCTG GUCAAAAGCUACCGGUUACCUG 64 (SEQ ID NO: 4) (SEQ ID NO: 29) CEP290- GATGCAGAACTAGTGTAGAC GAUGCAGAACUAGUGUAGAC 496 (SEQ ID NO: 5) (SEQ ID NO: 30) CEP290- GAGTATCTCCTGTTTGGCA GAGUAUCUCCUGUUUGGCA 504 (SEQ ID NO: 6) (SEQ ID NO: 31)
(31) The left and right guides can be used in any combination, though certain combinations may be more suitable for certain applications. Table 3 sets forth several upstream+downstream guide pairs used in the embodiments of this disclosure. It should be noted, notwithstanding the use of “left” and “right” as nomenclature for gRNAs, that any guide in a pair, upstream or downstream, may be placed in either one of the gRNA coding sequence positions illustrated in
(32) TABLE-US-00003 TABLE 3 Upstream (Left) + Downstream (Right) Guide Pairs Downstream 4 5 6 Upstream 1 1 + 4 1 + 5 1 + 6 2 2 + 4 2 + 5 2 + 6 3 3 + 4 3 + 5 3 + 6
(33) In some embodiments, the gRNAs used in the present disclosure are derived from S. aureus gRNAs and can be unimolecular or modular, as described below. An exemplary unimolecular S. aureus gRNA is shown in
(34) TABLE-US-00004 DNA: (SEQ ID NO: 7) [N].sub.16-24GTTTTAGTACTCTGGAAACAGAATCTACTAAAACAAGGCAAA ATGCCGTGTTTATCTCGTCAACTTGTTGGCGAGATTTTTT and RNA: (SEQ ID NO: 32) [N].sub.16-24GUUUUAGUACUCUGGAAACAGAAUCUACUAAAACAAGGCAAA AUGCCGUGUUUAUCUCGUCAACUUGUUGGCGAGAUUUUUU. DNA: (SEQ ID NO: 8) [N].sub.16-24GTTATAGTACTCTGGAAACAGAATCTACTATAACAAGGCAAA ATGCCGTGTTTATCTCGTCAACTTGTTGGCGAGATTTTTT and RNA: (SEQ ID NO: 33) [N].sub.16-24GUUAUAGUACUCUGGAAACAGAAUCUACUAUAACAAGGCAAA AUGCCGUGUUUAUCUCGUCAACUUGUUGGCGAGAUUUUUU.
It should be noted that, while the figure depicts a targeting domain of 20 nucleotides, the targeting domain can have any suitable length. gRNAs used in the various embodiments of this disclosure preferably include targeting domains of between 16 and 24 (inclusive) bases in length at their 5′ ends, and optionally include a 3′ U6 termination sequence as illustrated.
(35) The gRNA in
(36) Either one of the gRNAs presented above can be used with any of targeting sequences 1-6, and two gRNAs in a pair do not necessarily include the same backbone sequence. Additionally, skilled artisans will appreciate that the exemplary gRNA designs set forth herein can be modified in a variety of ways, which are described below or are known in the art; the incorporation of such modifications is within the scope of this disclosure.
(37) Expression of each of the gRNAs in the AAV vector is driven by a pair of U6 promoters, such as a human U6 promoter. An exemplary U6 promoter sequence, as set forth in Maeder, is presented below:
(38) TABLE-US-00005 (SEQ ID NO: 9) AAGGTCGGGCAGGAAGAGGGCCTATTTCCCATGATTCCTTCATATTTGCA TATACGATACAAGGCTGTTAGAGAGATAATTAGAATTAATTTGACTGTAA ACACAAAGATATTAGTACAAAATACGTGACGTAGAAAGTAATAATTTCTT GGGTAGTTTGCAGTTTTAAAATTATGTTTTAAAATGGACTATCATATGCT TACCGTAACTTGAAAGTATTTCGATTTCTTGGCTTTATATATCTTGTGGA AAGGACGAAACACC.
(39) Turning next to Cas9, in some embodiments the Cas9 protein is S. aureus Cas9. In further embodiments of this disclosure an S. aureus Cas9 sequence is modified to include two nuclear localization sequences (NLSs) at the C- and N-termini of the Cas9 protein, and a mini-polyadenylation signal (or Poly-A sequence). Exemplary S. aureus Cas9 sequences (both nucleotide and peptide) are shown below:
(40) TABLE-US-00006 TABLE 4 saCas9 Sequences Codon- ATGAAAAGGAACTACATTCTGGGGCTGGACATCGGGATTACAAGCGTGGGG optimized TATGGGATTATTGACTATGAAACAAGGGACGTGATCGACGCAGGCGTCAGA S. aureus CTGTTCAAGGAGGCCAACGTGGAAAACAATGAGGGACGGAGAAGCAAGAG Cas9 GGGAGCCAGGCGCCTGAAACGACGGAGAAGGCACAGAATCCAGAGGGTGA nucleotide AGAAACTGCTGTTCGATTACAACCTGCTGACCGACCATTCTGAGCTGAGTGG (SEQ ID AATTAATCCTTATGAAGCCAGGGTGAAAGGCCTGAGTCAGAAGCTGTCAGA NO: 10) GGAAGAGTTTTCCGCAGCTCTGCTGCACCTGGCTAAGCGCCGAGGAGTGCAT AACGTCAATGAGGTGGAAGAGGACACCGGCAACGAGCTGTCTACAAAGGAA CAGATCTCACGCAATAGCAAAGCTCTGGAAGAGAAGTATGTCGCAGAGCTG CAGCTGGAACGGCTGAAGAAAGATGGCGAGGTGAGAGGGTCAATTAATAGG TTCAAGACAAGCGACTACGTCAAAGAAGCCAAGCAGCTGCTGAAAGTGCAG AAGGCTTACCACCAGCTGGATCAGAGCTTCATCGATACTTATATCGACCTGC TGGAGACTCGGAGAACCTACTATGAGGGACCAGGAGAAGGGAGCCCCTTCG GATGGAAAGACATCAAGGAATGGTACGAGATGCTGATGGGACATTGCACCT ATTTTCCAGAAGAGCTGAGAAGCGTCAAGTACGCTTATAACGCAGATCTGTA CAACGCCCTGAATGACCTGAACAACCTGGTCATCACCAGGGATGAAAACGA GAAACTGGAATACTATGAGAAGTTCCAGATCATCGAAAACGTGTTTAAGCAG AAGAAAAAGCCTACACTGAAACAGATTGCTAAGGAGATCCTGGTCAACGAA GAGGACATCAAGGGCTACCGGGTGACAAGCACTGGAAAACCAGAGTTCACC AATCTGAAAGTGTATCACGATATTAAGGACATCACAGCACGGAAAGAAATC ATTGAGAACGCCGAACTGCTGGATCAGATTGCTAAGATCCTGACTATCTACC AGAGCTCCGAGGACATCCAGGAAGAGCTGACTAACCTGAACAGCGAGCTGA CCCAGGAAGAGATCGAACAGATTAGTAATCTGAAGGGGTACACCGGAACAC ACAACCTGTCCCTGAAAGCTATCAATCTGATTCTGGATGAGCTGTGGCATAC AAACGACAATCAGATTGCAATCTTTAACCGGCTGAAGCTGGTCCCAAAAAAG GTGGACCTGAGTCAGCAGAAAGAGATCCCAACCACACTGGTGGACGATTTC ATTCTGTCACCCGTGGTCAAGCGGAGCTTCATCCAGAGCATCAAAGTGATCA ACGCCATCATCAAGAAGTACGGCCTGCCCAATGATATCATTATCGAGCTGGC TAGGGAGAAGAACAGCAAGGACGCACAGAAGATGATCAATGAGATGCAGA AACGAAACCGGCAGACCAATGAACGCATTGAAGAGATTATCCGAACTACCG GGAAAGAGAACGCAAAGTACCTGATTGAAAAAATCAAGCTGCACGATATGC AGGAGGGAAAGTGTCTGTATTCTCTGGAGGCCATCCCCCTGGAGGACCTGCT GAACAATCCATTCAACTACGAGGTCGATCATATTATCCCCAGAAGCGTGTCC TTCGACAATTCCTTTAACAACAAGGTGCTGGTCAAGCAGGAAGAGAACTCTA AAAAGGGCAATAGGACTCCTTTCCAGTACCTGTCTAGTTCAGATTCCAAGAT CTCTTACGAAACCTTTAAAAAGCACATTCTGAATCTGGCCAAAGGAAAGGGC CGCATCAGCAAGACCAAAAAGGAGTACCTGCTGGAAGAGCGGGACATCAAC AGATTCTCCGTCCAGAAGGATTTTATTAACCGGAATCTGGTGGACACAAGAT ACGCTACTCGCGGCCTGATGAATCTGCTGCGATCCTATTTCCGGGTGAACAA TCTGGATGTGAAAGTCAAGTCCATCAACGGCGGGTTCACATCTTTTCTGAGG CGCAAATGGAAGTTTAAAAAGGAGCGCAACAAAGGGTACAAGCACCATGCC GAAGATGCTCTGATTATCGCAAATGCCGACTTCATCTTTAAGGAGTGGAAAA AGCTGGACAAAGCCAAGAAAGTGATGGAGAACCAGATGTTCGAAGAGAAGC AGGCCGAATCTATGCCCGAAATCGAGACAGAACAGGAGTACAAGGAGATTT TCATCACTCCTCACCAGATCAAGCATATCAAGGATTTCAAGGACTACAAGTA CTCTCACCGGGTGGATAAAAAGCCCAACAGAGACiCTGATCAATGACACCCT GTATAGTACAAGAAAAGACGATAAGGGGAATACCCTGATTGTGAACAATCT GAACGGACTGTACGACAAAGATAATGACAAGCTGAAAAAGCTGATCAACAA AAGTCCCGAGAAGCTGCTGATGTACCACCATGATCCTCAGACATATCAGAAA CTGAAGCTGATTATGGAGCAGTACGGCGACGAGAAGAACCCACTGTATAAG TACTATGAAGAGACTGGGAACTACCTGACCAAGTATAGCAAAAAGGATAAT GGCCCCGTGATCAAGAAGATCAAGTACTATGGGAACAAGCTGAATGCCCAT CTGGACATCACAGACGATTACCCTAACAGTCGCAACAAGGTGGTCAAGCTGT CACTGAAGCCATACAGATTCGATGTCTATCTGGACAACGGCGTGTATAAATT TGTGACTGTCAAGAATCTGGATGTCATCAAAAAGGAGAACTACTATGAAGTG AATAGCAAGTGCTACGAAGAGGCTAAAAAGCTGAAAAAGATTAGCAACCAG GCAGAGTTCATCGCCTCCTTTTACAACAACGACCTGATTAAGATCAATGGCG AACTGTATAGGGTCATCGGGGTGAACAATGATCTGCTGAACCGCATTGAAGT GAATATGATTGACATCACTTACCGAGAGTATCTGGAAAACATGAATGATAAG CGCCCCCCTCGAATTATCAAAACAATTGCCTCTAAGACTCAGAGTATCAAAA AGTACTCAACCGACATTCTGGGAAACCTGTATGAGGTGAAGAGCAAAAAGC ACCCTCAGATTATCAAAAAGGGC S. aureus MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARR Cas9 LKRRRRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALL protein HLAKRRGVHNVNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGE (SEQ ID VRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGE NO: 11) GSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRD ENEKLEYYEKFQIIENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNL KVYHDIKDITARKEIIENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISN LKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTL VDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEMQKR NRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLEDLLNNPFNY EVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKISYETFKKHIL NLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLLRSY FRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKE WKKLDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKY SHRVDKKPNRELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPE KLLMYHHDPQTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIK KIKYYGNKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNL DVIKKENYYEVNSKCYEEAKKLKKISNQAEFIASFYNNDLIKINGELYRVIGVNN DLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKKYSTDILGNLYEVKS KKHPQIIKKG
These sequences are exemplary in nature, and are not intended to be limiting. The skilled artisan will appreciate that modifications of these sequences may be possible or desirable in certain applications; such modifications are described below, or are known in the art, and are within the scope of this disclosure.
(41) Skilled artisans will also appreciate that polyadenylation signals are widely used and known in the art, and that any suitable polyadenylation signal can be used in the embodiments of this disclosure. One exemplary polyadenylation signal is set forth below:
(42) TABLE-US-00007 (SEQ ID NO: 12) TAGCAATAAAGGATCGTTTATTTTCATTGGAAGCGTGTGTTGGTTTTTTG ATCAGGCGCG.
(43) Cas9 expression is driven, in certain vectors of this disclosure, by one of three promoters: cytomegalovirus (CMV), elongation factor-1 (EFS), or human g-protein receptor coupled kinase-1 (hGRK1), which is specifically expressed in retinal photoreceptor cells. Nucleotide sequences for each of these promoters are provided in Table 5. Modifications of these sequences may be possible or desirable in certain applications, and such modifications are within the scope of this disclosure.
(44) TABLE-US-00008 TABLE 5 Cas9 Promoter Sequences CMV CATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAG (SEQ ID NO: 13) TTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGG CCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAAT GACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAA TGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGT ATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGC CCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTG GCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTT TGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTT CCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAA ATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGC AAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTG GTTTAGTGAACCGTCAGATCCGCTAGAGATCCGC EFS TCGAGTGGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACA (SEQ ID NO: 14) GTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAG AGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTC CGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTC GCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTGT CGTGACCGCGG hGRK1 GGGCCCCAGAAGCCTGGTGGTTGTTTGTCCTTCTCAGGGGAAAAGTGA (SEQ ID NO: 15) GGCGGCCCCTTGGAGGAAGGGGCCGGGCAGAATGATCTAATCGGATTC CAAGCAGCTCAGGGGATTGTCTTTTTCTAGCACCTTCTTGCCACTCCTA AGCGTCCTCCGTGACCCCGGCTGGGATTTCGCCTGGTGCTGTGTCAGCC CCGGTCTCCCAGGGGCTTCCCAGTGGTCCCCAGGAACCCTCGACAGGG CCCGGTCTCTCTCGTCCAGCAAGGGCAGGGACGGGCCACAGGCCAAGG GC
(45) AAV genomes according to the present disclosure generally incorporate inverted terminal repeats (ITRs) derived from the AAV2 serotype. Exemplary left and right ITRs are presented in Table 6. It should be noted, however, that numerous modified versions of the AAV2 ITRs are used in the field, and the ITR sequences shown below are exemplary and are not intended to be limiting. Modifications of these sequences are known in the art, or will be evident to skilled artisans, and are thus included in the scope of this disclosure.
(46) TABLE-US-00009 TABLE 6 AAV2 ITR Sequences AAV2 TTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGG Left CCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCC ITR GGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGA (SEQ ID GTGGCCAACTCCATCACTAGGGGTTCCT NO: 16) AAV2 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCG Right CGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGG ITR GCGTCGGGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGA (SEQ ID GCGAGCGCGCAGAGAGGGAGTGGCCAA NO: 17)
(47) As
(48) In various embodiments, the nucleic acid or AAV vector encodes the following: left and right AAV2 ITR sequences, a first U6 promoter to drive expression of a first guide RNA having a sequence selected from SEQ ID NOS: 7 and 8 (corresponding RNA sequences in SEQ ID NOs: 32, and 33, respectively) and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 1-3 (corresponding RNA sequences in SEQ ID NOs: 26-28, respectively), a second U6 promoter to drive expression of a second guide RNA comprising a sequence selected from SEQ ID NOS: 7 and 8 and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 4-6 (corresponding RNA sequences in SEQ ID NOs: 29-31, respectively), and a CMV promoter to drive expression of an S. aureus Cas9 encoded by SEQ ID NO: 10; or left and right AAV2 ITR sequences, a first U6 promoter to drive expression of a first guide RNA having a sequence selected from SEQ ID NOS: 7 and 8 and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 1-3, a second U6 promoter to drive expression of a second guide RNA comprising a sequence selected from SEQ ID NOS: 7 and 8 and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 4-6, and an hGRK promoter to drive expression of an S. aureus Cas9 encoded by SEQ ID NO: 10; or left and right AAV2 ITR sequences, a first U6 promoter to drive expression of a first guide RNA having a sequence selected from SEQ ID NOS: 7 and 8 and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 1-3, a second U6 promoter to drive expression of a second guide RNA comprising a sequence selected from SEQ ID NOS: 7 and 8 and/or comprising a targeting domain sequence according to one of SEQ ID NOS: 4-6, and an EFS promoter to drive expression of an S. aureus Cas9 encoded by SEQ ID NO: 10.
(49) In some embodiments, the nucleic acid or AAV vector shares at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater sequence identity with one of the nucleic acids or AAV vectors recited above.
(50) It should be noted that these sequences described above are exemplary, and can be modified in ways that do not disrupt the operating principles of elements they encode. Such modifications, some of which are discussed below, are within the scope of this disclosure. Without limiting the foregoing, skilled artisans will appreciate that the DNA, RNA or protein sequences of the elements of this disclosure may be varied in ways that do not interrupt their function, and that a variety of similar sequences that are substantially similar (e.g., greater than 90%, 95%, 96%, 97%, 98% or 99% sequence similarity, or in the case of short sequences such as gRNA targeting domains, sequences that differ by no more than 1, 2 or 3 nucleotides) can be utilized in the various systems, methods and AAV vectors described herein. Such modified sequences are within the scope of this disclosure.
(51) The AAV genomes described above can be packaged into AAV capsids (for example, AAV5 capsids), which capsids can be included in compositions (such as pharmaceutical compositions) and/or administered to subjects. An exemplary pharmaceutical composition comprising an AAV capsid according to this disclosure can include a pharmaceutically acceptable carrier such as balanced saline solution (BSS) and one or more surfactants (e.g., Tween 20) and/or a thermosensitive or reverse-thermosensitive polymer (e.g., pluronic). Other pharmaceutical formulation elements known in the art may also be suitable for use in the compositions described here.
(52) Compositions comprising AAV vectors according to this disclosure can be administered to subjects by any suitable means, including without limitation injection, for example, subretinal injection. The concentration of AAV vector within the composition is selected to ensure, among other things, that a sufficient AAV dose is administered to the retina of the subject, taking account of dead volume within the injection apparatus and the relatively limited volume that can be safely administered to the retina. Suitable doses may include, for example, 1×10.sup.11 viral genomes (vg)/mL, 2×10.sup.11 viral genomes (vg)/mL, 3×10.sup.11 viral genomes (vg)/mL, 4×10.sup.11 viral genomes (vg)/mL, 5×10.sup.11 viral genomes (vg)/mL, 6×10.sup.11 viral genomes (vg)/mL, 7×10.sup.11 viral genomes (vg)/mL, 8×10.sup.11 viral genomes (vg)/mL, 9×10.sup.11 viral genomes (vg)/mL, 1×10.sup.12 vg/mL, 2×10.sup.12 viral genomes (vg)/mL, 3×10.sup.12 viral genomes (vg)/mL, 4×10.sup.12 viral genomes (vg)/mL, 5×10.sup.12 viral genomes (vg)/mL, 6×10.sup.12 viral genomes (vg)/mL, 7×10.sup.12 viral genomes (vg)/mL, 8×10.sup.12 viral genomes (vg)/mL, 9×10.sup.12 viral genomes (vg)/mL, 1×10.sup.13 vg/mL, 2×10.sup.13 viral genomes (vg)/mL, 3×10.sup.13 viral genomes (vg)/mL, 4×10.sup.13 viral genomes (vg)/mL, 5×10.sup.13 viral genomes (vg)/mL, 6×10.sup.13 viral genomes (vg)/mL, 7×10.sup.13 viral genomes (vg)/mL, 8×10.sup.13 viral genomes (vg)/mL, or 9×10.sup.13 viral genomes (vg)/mL. Any suitable volume of the composition may be delivered to the subretinal space. In some instances, the volume is selected to form a bleb in the subretinal space, for example 1 microliter, 10 microliters, 50 microliters, 100 microliters, 150 microliters, 200 microliters, 250 microliters, 300 microliters, etc.
(53) Any region of the retina may be targeted, though the fovea (which extends approximately 1 degree out from the center of the eye) may be preferred in certain instances due to its role in central visual acuity and the relatively high concentration of cone photoreceptors there relative to peripheral regions of the retina. Alternatively or additionally, injections may be targeted to parafoveal regions (extending between approximately 2 and 10 degrees off center), which are characterized by the presence of all three types of retinal photoreceptor cells. In addition, injections into the parafoveal region may be made at comparatively acute angles using needle paths that cross the midline of the retina. For instance, injection paths may extend from the nasal aspect of the sclera near the limbus through the vitreal chamber and into the parafoveal retina on the temporal side, from the temporal aspect of the sclera to the parafoveal retina on the nasal side, from a portion of the sclera located superior to the cornea to an inferior parafoveal position, and/or from an inferior portion of the sclera to a superior parafoveal position. The use of relatively small angles of injection relative to the retinal surface may advantageously reduce or limit the potential for spillover of vector from the bleb into the vitreous body and, consequently, reduce the loss of the vector during delivery. In other cases, the macula (inclusive of the fovea) can be targeted, and in other cases, additional retinal regions can be targeted, or can receive spillover doses.
(54) For pre-clinical development purposes, systems, compositions, nucleotides and vectors according to this disclosure can be evaluated ex vivo using a retinal explant system, or in vivo using an animal model such as a mouse, rabbit, pig, nonhuman primate, etc. Retinal explants are optionally maintained on a support matrix, and AAV vectors can be delivered by injection into the space between the photoreceptor layer and the support matrix, to mimic subretinal injection. Tissue for retinal explantation can be obtained from human or animal subjects, for example mouse.
(55) Explants are particularly useful for studying the expression of gRNAs and/or Cas9 following viral transduction, and for studying genome editing over comparatively short intervals. These models also permit higher throughput than may be possible in animal models, and can be predictive of expression and genome editing in animal models and subjects. Small (mouse, rat) and large animal models (such as rabbit, pig, nonhuman primate) can be used for pharmacological and/or toxicological studies and for testing the systems, nucleotides, vectors and compositions of this disclosure under conditions and at volumes that approximate those that will be used in clinic. Because model systems are selected to recapitulate relevant aspects of human anatomy and/or physiology, the data obtained in these systems will generally (though not necessarily) be predictive of the behavior of AAV vectors and compositions according to this disclosure in human and animal subjects.
(56) While the foregoing exemplary embodiments have focused on guide RNAs, nucleic acids and AAV vectors targeted to the CEP290 gene, it will be appreciated by those of skill in the art that the nucleic acids and vectors of this disclosure may be used in the editing of other gene targets and the treatment of other diseases such as hereditary retinopathies that may be treated by editing of genes other than CEP290.
(57) Genome Editing Systems
(58) The term “genome editing system” refers to any system having RNA-guided DNA editing activity. Genome editing systems of the present disclosure include at least two components adapted from naturally occurring CRISPR systems: a gRNA and an RNA-guided nuclease. These two components form a complex that is capable of associating with a specific nucleic acid sequence in a cell and editing the DNA in or around that nucleic acid sequence, for example by making one or more of a single-strand break (an SSB or nick), a double-strand break (a DSB) and/or a base substitution.
(59) Naturally occurring CRISPR systems are organized evolutionarily into two classes and five types (Makarova 2011, incorporated by reference herein), and while genome editing systems of the present disclosure may adapt components of any type or class of naturally occurring CRISPR system, the embodiments presented herein are generally adapted from Class 2, and type II or V CRISPR systems. Class 2 systems, which encompass types II and V, are characterized by relatively large, multidomain RNA-guided nuclease proteins (e.g., Cas9 or Cpf1) that form ribonucleoprotein (RNP) complexes with gRNAs. gRNAs, which are discussed in greater detail below, can include single crRNAs in the case of Cpf1 or duplexed crRNAs and tracrRNAs in the case of Cas9. RNP complexes, in turn, associate with (i.e., target) and cleave specific loci complementary to a targeting (or spacer) sequence of the crRNA. Genome editing systems according to the present disclosure similarly target and edit cellular DNA sequences. but differ significantly from CRISPR systems occurring in nature. For example, the unimolecular gRNAs described herein do not occur in nature, and both gRNAs and RNA-guided nucleases according to this disclosure can incorporate any number of non-naturally occurring modifications.
(60) Genome editing systems can be implemented in a variety of ways, and different implementations may be suitable for any particular application. For example, a genome editing system is implemented, in certain embodiments, as a protein/RNA complex (a ribonucleoprotein, or RNP), which can be included in a pharmaceutical composition that optionally includes a pharmaceutically acceptable carrier and/or an encapsulating agent, such as a lipid or polymer micro- or nano-particle, micelle, liposome, etc. In other embodiments, a genome editing system is implemented as one or more nucleic acids encoding the RNA-guided nuclease and gRNA components described above (optionally with one or more additional components); in still other embodiments, the genome editing system is implemented as one or more vectors comprising such nucleic acids, for example a viral vector such as an AAV; and in still other embodiments, the genome editing system is implemented as a combination of any of the foregoing. Additional or modified implementations that operate according to the principles set forth herein will be apparent to the skilled artisan and are within the scope of this disclosure.
(61) It should be noted that the genome editing systems of the present invention can be targeted to a single specific nucleotide sequence, or can be targeted to—and capable of editing in parallel—two or more specific nucleotide sequences through the use of two or more gRNAs. The use of two or more gRNAs targeted to different sites is referred to as “multiplexing” throughout this disclosure, and can be employed to target multiple, unrelated target sequences of interest, or to form multiple SSBs and/or DSBs within a single target domain and, in some cases, to generate specific edits within such target domain. For example, this disclosure and Maeder both describe a genome editing system for correcting a point mutation (C.2991+1655A to G) in the human CEP290 gene that results in the creation of a cryptic splice site, which in turn reduces or eliminates the function of the gene. The genome editing system of Maeder utilizes two gRNAs targeted to sequences on either side of (i.e., flanking) the point mutation, and forms DSBs that flank the mutation. This, in turn, promotes deletion of the intervening sequence, including the mutation, thereby eliminating the cryptic splice site and restoring normal gene function.
(62) As another example, International Patent Publication No. WO2016/073990 by Cotta-Ramusino et al. (“Cotta-Ramusino”), incorporated by reference herein, describes a genome editing system that utilizes two gRNAs in combination with a Cas9 nickase (a Cas9 that makes a single strand nick such as S. pyogenes D10A), an arrangement termed a “dual-nickase system.” The dual-nickase system of Cotta-Ramusino is configured to make two nicks on opposite strands of a sequence of interest that are offset by one or more nucleotides, which nicks combine to create a double strand break having an overhang (5′ in the case of Cotta-Ramusino, though 3′ overhangs are also possible). The overhang, in turn, can facilitate homology directed repair events in some circumstances. And, as another example, International Patent Publication No. WO2015/070083 by Zhang et al., incorporated by reference herein, describes a gRNA targeted to a nucleotide sequence encoding Cas9 (referred to as a “governing” gRNA), which can be included in a genome editing system comprising one or more additional gRNAs to permit transient expression of a Cas9 that might otherwise be constitutively expressed, for example in some virally transduced cells. These multiplexing applications are intended to be exemplary, rather than limiting, and the skilled artisan will appreciate that other applications of multiplexing are generally compatible with the genome editing systems described here.
(63) Genome editing systems can, in some instances, form double strand breaks that are repaired by cellular DNA double-strand break mechanisms such as non-homologous end joining (NHEJ), or homology directed repair (HDR). These mechanisms are described throughout the literature (see, e.g., Davis 2014 (describing Alt-HDR), Frit 2014 (describing Alt-NHEJ), and Iyama 2013 (describing canonical HDR and NHEJ pathways generally), all of which are incorporated by reference herein).
(64) Where genome editing systems operate by forming DSBs, such systems optionally include one or more components that promote or facilitate a particular mode of double-strand break repair or a particular repair outcome. For example, Cotta-Ramusino also describes genome editing systems in which a single stranded oligonucleotide “donor template” is added; the donor template is incorporated into a target region of cellular DNA that is cleaved by the genome editing system, and can result in a change in the target sequence.
(65) In other cases, genome editing systems modify a target sequence, or modify expression of a gene in or near the target sequence, without causing single- or double-strand breaks. For example, a genome editing system can include an RNA-guided nuclease/cytidine deaminase fusion protein, and can operate by generating targeted C-to-A substitutions. Suitable nuclease/deaminase fusions are described in Komor 2016, which is incorporated by reference. Alternatively, a genome editing system can utilize a cleavage-inactivated (i.e., a “dead”) nuclease, such as a dead Cas9, and can operate by forming stable complexes on one or more targeted regions of cellular DNA, thereby interfering with functions involving the targeted region(s) such as mRNA transcription and chromatin remodeling.
(66) Guide RNA (gRNA)
(67) The terms guide RNA and gRNA refer to any nucleic acid that promotes the specific association (or “targeting”) of an RNA-guided nuclease such as a Cas9 or a Cpf1 to a target sequence such as a genomic or episomal sequence in a cell. gRNAs can be unimolecular (comprising a single RNA molecule, and referred to alternatively as chimeric), or modular (comprising more than one, and typically two, separate RNA molecules, such as a crRNA and a tracrRNA, which are usually associated with one another, for example by duplexing). gRNAs and their component parts are described throughout the literature (see, e.g., Briner 2014, which is incorporated by reference; see also Cotta-Ramusino).
(68) In bacteria and archea, type II CRISPR systems generally comprise an RNA-guided nuclease protein such as Cas9, a CRISPR RNA (crRNA) that includes a 5′ region that is complementary to a foreign sequence, and a trans-activating crRNA (tracrRNA) that includes a 5′ region that is complementary to, and forms a duplex with, a 3′ region of the crRNA. While not intending to be bound by any theory, it is thought that this duplex facilitates the formation of—and is necessary for the activity of—the Cas9/gRNA complex. As type II CRISPR systems were adapted for use in gene editing, it was discovered that the crRNA and tracrRNA could be joined into a single unimolecular or chimeric gRNA, for example by means of a four nucleotide (e.g., GAAA) “tetraloop” or “linker” sequence bridging complementary regions of the crRNA (at its 3′ end) and the tracrRNA (at its 5′ end) (Mali 2013; Jiang 2013; Jinek 2012; all incorporated by reference herein).
(69) gRNAs, whether unimolecular or modular, include a targeting domain that is fully or partially complementary to a target domain within a target sequence, such as a DNA sequence in the genome of a cell where editing is desired. In certain embodiments, this target sequence encompasses or is proximal to a CEP290 target position. Targeting domains are referred to by various names in the literature, including without limitation “guide sequences” (Hsu 2013, incorporated by reference herein), “complementarity regions” (Cotta-Ramusino), “spacers” (Briner 2014), and generically as “crRNAs” (Jiang 2013). Irrespective of the names they are given, targeting domains are typically 10-30 nucleotides in length, preferably 16-24 nucleotides in length (for example, 16, 17, 18, 19, 20, 21, 22, 23 or 24 nucleotides in length), and are at or near the 5′ terminus of in the case of a Cas9 gRNA, and at or near the 3′ terminus in the case of a Cpf1 gRNA.
(70) In addition to the targeting domains, gRNAs typically (but not necessarily, as discussed below) include a plurality of domains that influence the formation or activity of gRNA/Cas9 complexes. For example, as mentioned above, the duplexed structure formed by first and secondary complementarity domains of a gRNA (also referred to as a repeat:anti-repeat duplex) interacts with the recognition (REC) lobe of Cas9 and may mediate the formation of Cas9/gRNA complexes (Nishimasu 2014; Nishimasu 2015; both incorporated by reference herein). It should be noted that the first and/or second complementarity domains can contain one or more poly-A tracts, which can be recognized by RNA polymerases as a termination signal. The sequence of the first and second complementarity domains are, therefore, optionally modified to eliminate these tracts and promote the complete in vitro transcription of gRNAs, for example through the use of A-G swaps as described in Briner 2014, or A-U swaps. These and other similar modifications to the first and second complementarity domains are within the scope of the present disclosure.
(71) Along with the first and second complementarity domains, Cas9 gRNAs typically include two or more additional duplexed regions that are necessary for nuclease activity in vivo but not necessarily in vitro (Nishimasu 2015). A first stem-loop near the 3′ portion of the second complementarity domain is referred to variously as the “proximal domain,” (Cotta-Ramusino) “stem loop 1” (Nishimasu 2014; Nishimasu 2015) and the “nexus” (Briner 2014). One or more additional stem loop structures are generally present near the 3′ end of the gRNA, with the number varying by species: S. pyogenes gRNAs typically include two 3′ stem loops (for a total of four stem loop structures including the repeat:anti-repeat duplex), while s. aureus and other species have only one (for a total of three). A description of conserved stem loop structures (and gRNA structures more generally) organized by species is provided in Briner 2014.
(72) Skilled artisans will appreciate that gRNAs can be modified in a number of ways, some of which are described below, and these modifications are within the scope of disclosure. For economy of presentation in this disclosure, gRNAs may be presented by reference solely to their targeting domain sequences.
(73) gRNA Modifications
(74) The activity, stability, or other characteristics of gRNAs can be altered through the incorporation of chemical and/or sequential modifications. As one example, transiently expressed or delivered nucleic acids can be prone to degradation by, e.g., cellular nucleases. Accordingly, the gRNAs described herein can contain one or more modified nucleosides or nucleotides which introduce stability toward nucleases. While not wishing to be bound by theory it is also believed that certain modified gRNAs described herein can exhibit a reduced innate immune response when introduced into a population of cells, particularly the cells of the present invention. As noted above, the term “innate immune response” includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, generally of viral or bacterial origin, which involves the induction of cytokine expression and release, particularly the interferons, and cell death.
(75) One common 3′ end modification is the addition of a poly A tract comprising one or more (and typically 5-200) adenine (A) residues. The poly A tract can be contained in the nucleic acid sequence encoding the gRNA, or can be added to the gRNA during chemical synthesis, or following in vitro transcription using a polyadenosine polymerase (e.g., E. coli Poly(A)Polymerase). In vivo, poly-A tracts can be added to sequences transcribed from DNA vectors through the use of polyadenylation signals. Examples of such signals are provided in Maeder.
(76) RNA-Guided Nucleases
(77) RNA-guided nucleases according to the present disclosure include, without limitation, naturally-occurring Class 2 CRISPR nucleases such as Cas9, and Cpf1, as well as other nucleases derived or obtained therefrom. In functional terms, RNA-guided nucleases are defined as those nucleases that: (a) interact with (e.g., complex with) a gRNA; and (b) together with the gRNA, associate with, and optionally cleave or modify, a target region of a DNA that includes (i) a sequence complementary to the targeting domain of the gRNA and, optionally, (ii) an additional sequence referred to as a “protospacer adjacent motif,” or “PAM,” which is described in greater detail below. As the following examples will illustrate, RNA-guided nucleases can be defined, in broad terms, by their PAM specificity and cleavage activity, even though variations may exist between individual RNA-guided nucleases that share the same PAM specificity or cleavage activity. Skilled artisans will appreciate that some aspects of the present disclosure relate to systems, methods and compositions that can be implemented using any suitable RNA-guided nuclease having a certain PAM specificity and/or cleavage activity. For this reason, unless otherwise specified, the term RNA-guided nuclease should be understood as a generic term, and not limited to any particular type (e.g., Cas9 vs. Cpf1), species (e.g., S. pyogenes vs. S. aureus) or variation (e.g., full-length vs. truncated or split; naturally-occurring PAM specificity vs. engineered PAM specificity).
(78) Turning to the PAM sequence, this structure takes its name from its sequential relationship to the “protospacer” sequence that is complementary to gRNA targeting domains (or “spacers”). Together with protospacer sequences, PAM sequences define target regions or sequences for specific RNA-guided nuclease/gRNA combinations.
(79) Various RNA-guided nucleases may require different sequential relationships between PAMs and protospacers. In general, Cas9s recognize PAM sequences that are 5′ of the protospacer as visualized relative to the top or complementary strand.
(80) In addition to recognizing specific sequential orientations of PAMs and protospacers, RNA-guided nucleases generally recognize specific PAM sequences. S. aureus Cas9, for example, recognizes a PAM sequence of NNGRRT, wherein the N sequences are immediately 3′ of the region recognized by the gRNA targeting domain. S. pyogenes Cas9 recognizes NGG PAM sequences. It should also be noted that engineered RNA-guided nucleases can have PAM specificities that differ from the PAM specificities of similar nucleases (such as the naturally occurring variant from which an RNA-guided nuclease is derived, or the naturally occurring variant having the greatest amino acid sequence homology to an engineered RNA-guided nuclease). Modified Cas9s that recognize alternate PAM sequences are described below.
(81) RNA-guided nucleases are also characterized by their DNA cleavage activity: naturally-occurring RNA-guided nucleases typically form DSBs in target nucleic acids, but engineered variants have been produced that generate only SSBs (discussed above; see also Ran 2013, incorporated by reference herein), or that do not cut at all.
(82) Cas9
(83) Crystal structures have been determined for S. pyogenes Cas9 (Jinek 2014), and for S. aureus Cas9 in complex with a unimolecular gRNA and a target DNA (Nishimasu 2014; Anders 2014; and Nishimasu 2015).
(84) A naturally occurring Cas9 protein comprises two lobes: a recognition (REC) lobe and a nuclease (NUC) lobe; each of which comprise particular structural and/or functional domains. The REC lobe comprises an arginine-rich bridge helix (BH) domain, and at least one REC domain (e.g., a REC1 domain and, optionally, a REC2 domain). The REC lobe does not share structural similarity with other known proteins, indicating that it is a unique functional domain. While not wishing to be bound by any theory, mutational analyses suggest specific functional roles for the BH and REC domains: the BH domain appears to play a role in gRNA:DNA recognition, while the REC domain is thought to interact with the repeat:anti-repeat duplex of the gRNA and to mediate the formation of the Cas9/gRNA complex.
(85) The NUC lobe comprises a RuvC domain, an HNH domain, and a PAM-interacting (PI) domain. The RuvC domain shares structural similarity to retroviral integrase superfamily members and cleaves the non-complementary (i.e., bottom) strand of the target nucleic acid. It may be formed from two or more split RuvC motifs (such as RuvC I, RuvCII, and RuvCIII in s. pyogenes and s. aureus). The HNH domain, meanwhile, is structurally similar to HNH endonuclease motifs, and cleaves the complementary (i.e., top) strand of the target nucleic acid. The PI domain contributes to PAM specificity.
(86) Modifications of RNA-Guided Nucleases
(87) The RNA-guided nucleases described above have activities and properties that are useful in a variety of applications, but the skilled artisan will appreciate that RNA-guided nucleases may also be modified in certain instances, to alter cleavage activity, PAM specificity, or other structural or functional features.
(88) Turning first to modifications that alter cleavage activity, mutations that reduce or eliminate the activity of domains within the NUC lobe have been described above. Exemplary mutations that may be made in the RuvC domains, in the Cas9 HNH domain, or in the Cpf1 Nuc domain are described in Ran and Yamano, as well as in Cotta-Ramusino. In general, mutations that reduce or eliminate activity in one of the two nuclease domains result in RNA-guided nucleases with nickase activity, but it should be noted that the type of nickase activity varies depending on which domain is inactivated. As one example, inactivation of a RuvC domain of a Cas9 will result in a nickase that cleaves the complementary strand, while inactivation of a Cas9 HNH domain results in a nickase that cleaves the non-complementary strand.
(89) Modifications of PAM specificity relative to naturally occurring Cas9 reference molecules has been described for both S. pyogenes (Kleinstiver 2015a) and S. aureus (Kleinstiver 2015b). Modifications that improve the targeting fidelity of Cas9 have also been described (Kleinstiver 2016). Each of these references is incorporated by reference herein.
(90) RNA-guided nucleases have been split into two or more parts (see, e.g., Zetsche 2015; Fine 2015; both incorporated by reference).
(91) RNA-guided nucleases are, in some cases, size-optimized or truncated, for example via one or more deletions that reduce the size of the nuclease while still retaining gRNA association, target and PAM recognition, and cleavage activities. In certain embodiments, RNA guided nucleases are bound, covalently or non-covalently, to another polypeptide, nucleotide, or other structure, optionally by means of a linker. RNA-guided nucleases also optionally include a tag, such as a nuclear localization signal to facilitate movement of RNA-guided nuclease protein into the nucleus.
(92) The foregoing list of modifications is intended to be exemplary in nature, and the skilled artisan will appreciate that other modifications may be possible or desirable in certain applications. For brevity, therefore, certain systems, methods and compositions of the present disclosure are exemplified by reference to particular RNA-guided nucleases, but it should be understood that the RNA-guided nucleases used may be modified in ways that do not alter the exemplified operating principles. Such modifications are within the scope of the present disclosure.
EXAMPLES
(93) The following Examples are illustrative and are not intended to limit the scope or content of the invention in any way.
Example 1: AAV Transduction of Genome Editing Systems in Mouse Retinal Explants
(94) To assess the ability of the AAV vectors described above to transduce CRISPR/Cas9 genome editing systems into retinal cells in situ, an ex vivo explant system was developed.
(95) mRNA samples taken from retinal explants further demonstrate that genome editing systems according to the present disclosure are effectively transduced by these AAV vectors:
(96) DNA samples from retinal explants treated with AAV vectors were sequenced, and indel species were identified. The AAV vectors used in the mouse explant system included guides with targeting domains specific to the mouse CEP290 gene but targeted to the same region of intron 26 as the human guides presented above; aside from the specific guide sequences used, the AAV vectors used were the same as those described above. Table 7 shows a wild type (WT) mouse sequence, with left and right guide sequences italicized, and three representative indels of +1, −4 and −246 aligned with the WT sequence. In the table, three periods ( . . . ) represent an abbreviation of the sequence read for ease of presentation, while dashes (-) represent alignment gaps and underlined nucleotides represent insertions. Insofar as DNA sequencing of explants treated with AAV vectors utilizing the photoreceptor specific hGRK1 promoter revealed indel formation, these data demonstrate genome editing of a CEP290 target site in retinal photoreceptors.
(97) TABLE-US-00010 TABLE 7 Representative Indels in Mouse Retinal Explants WT CCCTCAAACACATGTCTCACGCAGCTTAGACATTCT . . . CAGAACTCGGTCAG- CATGCTACAGATAGCTTATCT (SEQ ID NO: 18) (SEQ ID NO: 19) +1 CCCTCAAACACATGTCTCACGCAGCTTAGACATTCT . . . CAGAACTCGGTCAGGCATGCTACAGATAGCTTATC T (SEQ ID NO: 18) (SEQ ID NO: 34) −4 CCCTCAAACACATGTCTCACGCAGCTTAGACATTCT . . . CAGAACTCGG----- CATGCTACAGATAGCTTATCT (SEQ ID NO: 18) (SEQ ID NO: 35) −246 CCCTCAAAG--------------------------- . . . --------------- CATGCTACAGATAGCTTATCT (SEQ ID NO: 36) (SEQ ID NO: 37)
(98)
(99) Taken together, these results demonstrate the transduction of CRISPR/Cas9 genome editing systems into cells, including photoreceptor cells, in the intact mouse retina and the editing (including deletion) of a CEP290 target site in retinal photoreceptors in situ.
Example 2: AAV Transduction of Genome Editing Systems in Primate Retina In Vivo
(100) To assess the ability of the AAV vectors described above to transduce CRISPR/Cas9 genome editing systems into retinal cells in vivo, a primate subretinal injection procedure was developed. Cynomolgus macaques received a bilateral subretinal injections of an AAV5 vector encoding S. aureus Cas9 operably linked to an EFS, CMV or hGRK promoter sequence, and gRNAs C1 and C2, targeted to an intronic region of the cynomolgus CEP290 gene and comprising targeting sequences as set forth in Table 8. AAV injections were given at dosages of 4×10.sup.10 (low) or 4×10.sup.11 (high) viral genomes (vg). Experimental conditions are summarized in Table 9.
(101) TABLE-US-00011 TABLE 8 Cynomolgus gRNA Targeting Domain Sequences Targeting Domain Targeting Domain gRNA Sequence (DNA) Sequence (RNA) C1 GGCCGGCTAATTTAGTAGAGA GGCCGGCUAAUUUAGUAGAGA (SEQ ID NO: 20) (SEQ ID NO: 38) C2 GTTATGAAGAATAATACAAA GUUAUGAAGAAUAAUACAAA (SEQ ID NO: 21) (SEQ ID NO: 39)
(102) TABLE-US-00012 TABLE 9 Cynomolgus Treatment Conditions Group Vector Dose (vg/eye) CMV-low CEPgRNAs-dCMV-Cas9 4 × 10.sup.10 CMV-high CEPgRNAs-dCMV-Cas9 4 × 10.sup.11 EFS-low CEPgRNAs-EFS-Cas9 4 × 10.sup.10 EFS-high CEPgRNAs-EFS-Cas9 4 × 10.sup.11 GRK-low CEPgRNAs-GRK1-Cas9 4 × 10.sup.10 GRK-high CEPgRNAs-GRK1-Cas9 4 × 10.sup.11 Vehicle GRK1-GFP/Vehicle 4 × 10.sup.11
(103) 6 or 8 mm retinal tissue punches were obtained from AAV-treated and Vehicle-treated retinas at 6 and 13 weeks post injection, and genomic DNA was harvested. Sequencing was performed by using a proprietary methodology (Uni-Directional Targeted Sequencing, or UDiTaS) described in commonly assigned, U.S. Provisional Patent Application No. 62/443,212, which is incorporated by reference herein in its entirety. Data from two UDiTaS sequencing reactions with individual upstream or downstream primers was combined by assuming complete overlap of indels at the two different gRNA cut sites and by averaging the rates of inversions and deletions observed in the two sequencing reactions.
(104) Histological analysis demonstrated successful transduction of primate photoreceptor cells using genome editing systems as disclosed herein.
(105)
(106) TABLE-US-00013 TABLE 10 Editing Frequencies Observed in Cynomolgus Treatment Conditions at 6 and 13 Weeks Total editing Inversions Deletions Insertions Indels EFS- 6 week 2.4% 0.6% 0.4% 0.3% 1.1% low 13 week 3.8% 1.2% 0.6% 0.0% 2.0% EFS- 6 week 10.2% 1.4% 1.3% 2.3% 5.3% high 13 week — — — — — CMV- 6 week 1.1% 0.5% 0.0% 0.1% 0.5% low 13 week 13.4% 3.7% 2.1% 0.9% 6.6% CMV- 6 week 8.0% 0.7% 0.7% 2.1% 4.4% high 13 week 44.5% 5.1% 3.7% 11.2% 24.5% GRK- 6 week 5.0% 0.9% 0.7% 0.7% 2.7% low 13 week 1.6% 0.0% 0.0% 0.3% 1.3% GRK- 6 week 16.6% 2.5% 2.5% 3.5% 8.1% high 13 week 38.0% 7.0% 8.5% 5.9% 16.7%
(107) It should be noted that the hGRK1 promoter is photoreceptor specific, and that the genome editing system encoded by the AAV5 vector would only be functional in photoreceptor cells. It is reasonable to conclude, therefore, that the percentages of reads obtained from tissue punches, which include other retinal cell types, are lower than the percentages that would be observed in photoreceptor cells alone. Together, these data demonstrate transduction of a CRISPR/Cas9 system into a primate retina by subretinal injection of AAV, in vivo, and the generation of targeted alterations in a CEP290 gene sequence in primate photoreceptor cells in vivo.
Example 3: Correction of IVS26 Splicing Defect by Inversions and Deletions
(108) To verify that deletions and inversions of the intronic region including the IVS26 mutation correct the splicing defect observed in CEP290 associated disease, a reporter assay was developed utilizing four reporter constructs having the general design depicted in
Example 4: AAV5 Transduction of Genome Editing Systems in Human Retinal Explants
(109) To further establish that the genome editing systems of the present disclosure supported targeted gene editing in human retinal cells, e.g., fully mature human photoreceptors in situ, an ex vivo human retina explant system was developed. Purified AAV5 vectors were selected that encoded S. aureus Cas9 operably linked to an hGRK1 or CMV promoter sequence and first and second gRNAs comprising targeting sequences according to SEQ ID NOS: 1 and 4, respectively, and backbone sequences according to SEQ ID NO: 8. As discussed above, these guides are targeted to the intronic region of the CEP290 gene on opposite sides of the IVS26 A>G mutation (Table 2). Human cadaver donor eyes were obtained within approximately 5 hours post-mortem and 3 mm punches were immobilized on a culture substrate as described above. Retinal explants were treated with AAV vectors at either a low dose of 1×10.sup.11 vg or a high dose of 5×10.sup.11 vg. Experimental conditions are summarized in Table 11.
(110) TABLE-US-00014 TABLE 11 Human Treatment Conditions Group Vector Dose (vg/punch) CMV-low CEPgRNAs-dCMV-Cas9 1 × 10.sup.11 CMV-high CEPgRNAs-dCMV-Cas9 5 × 10.sup.11 GRK-low CEPgRNAs-GRK1-Cas9 1 × 10.sup.11 GRK-high CEPgRNAs-GRK1-Cas9 5 × 10.sup.11 Vehicle GRK1-GFP/Vehicle 5 × 10.sup.11
(111) DNA samples from human retinal explants treated with AAV vectors were sequenced at either 14 or 28 days post-transduction, and inversions and deletions were identified.
Example 5: AAV5 Transduction of Genome Editing Systems in Live Transgenic IVS26 Knock-in Mice
(112) To further establish that the genome editing systems of the present disclosure supported targeted gene editing of the human CEP290 target position in mature photoreceptors in vivo, an IVS26 12 KI mouse model was employed. In this model, the human CEP290 exon 26, intron 26 with the IVS26 mutation (13 c.2991+1655A>G) and exon 27 have been inserted into the murine CEP290 gene via homologous recombination. AAV5 vectors encoding (i) S. aureus Cas9 operably linked to the photoreceptor-specific hGRK1 promoter sequence, and (ii) first and second gRNAs comprising targeting sequences according to SEQ ID NOS: 1 and 4, respectively, and having gRNA backbone sequences according to SEQ ID NO: 8 were used as described in Example 4. The vectors were administered subretinally (toward the temporal side of the retina near the optic nerve) in both eyes of each animal at doses of 1×10.sup.11 vg/mL, 1×10.sup.12 vg/mL or 1×10.sup.13 vg/mL; a vehicle group (containing BSS with 0.014% Tween20) was also used in the study as a control. Subretinal injections were conducted in anesthetized mice in accordance with NIH animal care guidelines. For each injection, a blunt-ended needle (33-gauge, 0.5 in; Hamilton company) on a 5 ml Hamilton syringe was inserted through the scleral incision, posterior to the lens, and was advanced centrally toward the temporal retina until resistance was felt. Care was taken to avoid the damaging the lens as the cannula was advanced. A volume of 1 microliter of AAV formulation or vehicle control containing 0.2 mg/mL of fluorescein was injected into the subretinal space, forming a bleb; fluorescein was used to visualize the bleb and to confirm successful injection. Animals were euthanized at 6- and 12-week timepoints, and retinal genomic DNA and RNA were isolated for determining the gene editing efficiency (by UDiTaS) and Cas9/gRNA levels (by RT_PCR), respectively.
(113) Experimental conditions are summarized in Table 12, along with rates of insertion and deletion from individual retinas as measured by UDiTaS.
(114) TABLE-US-00015 TABLE 12 Inversion and deletion rates in IVS26 KI mouse retinas Dose 1 × 10.sup.12 vg 1 × 10.sup.13 vg Timepoint 6 weeks 12 weeks 6 weeks 12 weeks Inversions 4.68% 3.91% 2.06% 1.88% Deletions 6.29% 5.27% 7.79% 4.13%
(115) These data provide further demonstrate the successful transduction of retinal photoreceptor cells and alteration of the LCA10 target position using the vectors and genome editing systems of the present disclosure.
INCORPORATION BY REFERENCE
(116) All references mentioned herein are hereby incorporated by reference in their entirety as if each individual reference was specifically and individually indicated to be incorporated by reference.
EQUIVALENTS
(117) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
REFERENCES
(118) Anders et al. Nature 513(7519):569-573 (2014) Briner et al. Mol Cell 56(2):333-339 (2014) Cornish-Bowden Nucleic Acids Res 13(9):3021-3030 (1985) Davis & Maizels Proc Natl Acad Sci USA 111(10):E924-E932 (2014) Fine et al. Sci Rep 5:10777 (2015) Frit et al. DNA Repair (Amst.) 17:81-97 (2014) Hsu et al. Nat Biotechnol 31(9):827-832 (2013) Iyama & Wilson DNA Repair (Amst.) 12(8):620-636 (2013) Jiang et al. Nat Biotechnol 31(3):233-239 (2013) Jinek et al. Science 337(6096):816-821 (2012) Jinek et al. Science 343(6176):1247997 (2014) Kleinstiver et al. Nature 523(7561):481-485 (2015a) Kleinstiver et al. Nat Biotechnol 33(12):1293-1298 (2015b) Kleinstiver et al. Nature 529(7587):490-495 (2016) Komor et al. Nature 533(7603):420-424 (2016) Makarova et al. Nat Rev Microbiol 9(6):467-477 (2011) Mali et al. Science 339(6121):823-826 (2013) Nishimasu et al. Cell 156(5):935-949 (2014) Nishimasu et al. Cell 162(5):1113-1126 (2015) Ran et al. Cell 154(6):1380-1389 (2013) Tsai et al. Nat Biotechnol 34(5):483 (2016) Zetsche et al. Nat Biotechnol 33(2):139-142 (2015)