HIGH-PURITY STEVIOL GLYCOSIDES
20200157594 · 2020-05-21
Inventors
- Avetik Markosyan (Yerevan, AM)
- Siddhartha Purkayastha (Chicago, IL)
- Christopher BAYER (München, DE)
- Andreas Vogel (Leipzig, DE)
- Sabrina KÖPKE (Leipzig, DE)
- Sebastian BARTSCH (Leipzig, DE)
- Birgit BRUCHER (Leipzig, DE)
- Claudia Feller (Leipzig, DE)
- Stefan SCHÖNERT (Leipzig, DE)
- Mathias Salomo (Leipzig, DE)
- Thomas Schultchen (Leipzig, DE)
Cpc classification
C12P19/56
CHEMISTRY; METALLURGY
C07H1/00
CHEMISTRY; METALLURGY
A23V2002/00
HUMAN NECESSITIES
International classification
C12P19/56
CHEMISTRY; METALLURGY
Abstract
Methods of preparing highly purified steviol glycosides, particularly rebaudiosides M, D, E and I are described. The methods include utilizing enzyme preparations and recombinant microorganisms for converting various staring compositions to target steviol glycosides. The highly purified rebaudiosides are useful as non-caloric sweetener in edible and chewable compositions such as any beverages, confectioneries, bakery products, cookies, and chewing gums.
Claims
1. A method for producing highly purified target steviol glycosides, comprising the steps of: a. providing a starting composition comprising an organic compound with at least one carbon atom; b. providing an enzyme preparation or microorganism containing at least one enzyme selected from steviol biosynthesis enzymes, UDP-glycosyltransferases, and optionally UDP-glucose recycling enzymes; c. contacting the enzyme preparation or microorganism with a medium containing the starting composition to produce a medium comprising at least one target steviol glycoside.
2. A method for producing highly purified target steviol glycosides, comprising the steps of: a. providing a starting composition comprising an organic compound with at least one carbon atom; b. providing a biocatalyst comprising at least one enzyme selected from steviol biosynthesis enzymes, UDP-glycosyltransferases, and optionally UDP-glucose recycling enzymes; c. contacting the biocatalyst with a medium containing the starting composition to produce a medium comprising at least one target steviol glycoside.
3. The method of claim 1 further comprising the step of: d. separating the target steviol glycoside from the medium to provide a highly purified target steviol glycoside composition.
4. The method of claim 1, wherein the starting composition is selected from the group consisting steviol, steviol glycosides, polyols, carbohydrates, and combinations thereof.
5. The method of claim 1, wherein the microorganism is selected from the group consisting of E. coli, Saccharomyces sp., Aspergillus sp., Pichia sp., Bacillus sp., and Yarrowia sp.
6. The method of claim 2, wherein the biocatalyst is an enzyme, or a cell comprising one or more enzyme, capable of converting the starting composition to target steviol glycoside.
7. The method of claim 1, wherein the target steviol glycoside is selected from the group consisting of reb M, reb D, reb I and/or reb E and mixtures thereof.
8. The method of claim 1, wherein the enzyme is selected from the group consisting of a mevalonate (MVA) pathway enzyme, a 2-C-methyl-D-erythritol-4-phosphate pathway (MEP/DOXP) enzyme, geranylgeranyl diphosphate synthase, copalyl diphosphate synthase, kaurene synthase, kaurene oxidase, kaurenoic acid 13-hydroxylase (KAH), steviol synthetase, deoxyxylulose 5-phosphate synthase (DXS), D-1-deoxyxylulose 5-phosphate reductoisomerase (DXR), 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase (CMS), 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK), 4-diphosphocytidyl-2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MCS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate synthase (HDS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate reductase (HDR), acetoacetyl-CoA thiolase, truncated HMG-CoA reductase, mevalonate kinase, phosphomevalonate kinase, mevalonate pyrophosphate decarboxylase, cytochrome P450 reductase, UGT74G1, UGT85C2, UGT91D2, EUGT11, UGTSL2, UGT76G1, or mutant variant thereof having >85% amino-acid sequence identity, >86% amino-acid sequence identity, >87% amino-acid sequence identity, >88% amino-acid sequence identity, >89% amino-acid sequence identity, >90% amino-acid sequence identity, >91% amino-acid sequence identity, >92% amino-acid sequence identity, >93% amino-acid sequence identity, >94% amino-acid sequence identity, >95% amino-acid sequence identity, >96% amino-acid sequence identity, >97% amino-acid sequence identity, >98% amino-acid sequence identity, >99% amino-acid sequence identity.
9. The method of claim 3, wherein the target steviol glycoside content is greater than about 95% by weight on a dry basis.
10. A consumable product comprising a highly purified target glycoside composition produced by the method of claim 3, wherein the product is selected from the group consisting of a food, a beverage, a pharmaceutical composition, a tobacco product, a nutraceutical composition, an oral hygiene composition, and a cosmetic composition.
11. A consumable product comprising the highly purified target steviol glycoside composition produced by the method of claim 3, wherein the product is selected from the group consisting of a food, a beverage, a pharmaceutical composition, a tobacco product, a nutraceutical composition, an oral hygiene composition, and a cosmetic composition, and wherein the target steviol glycoside is reb D.
12. A consumable product comprising the highly purified target steviol glycoside composition produced by the method of claim 3, wherein the product is selected from the group consisting of a food, a beverage, a pharmaceutical composition, a tobacco product, a nutraceutical composition, an oral hygiene composition, and a cosmetic composition, and wherein the target steviol glycoside is reb M.
13. A consumable product comprising the highly purified target steviol glycoside composition produced by the method of claim 3, wherein the product is selected from the group consisting of a food, a beverage, a pharmaceutical composition, a tobacco product, a nutraceutical composition, an oral hygiene composition, and a cosmetic composition, and wherein the target steviol glycoside is reb E.
14. A consumable product comprising the highly purified target steviol glycoside composition produced by the method of claim 3, wherein the product is selected from the group consisting of a food, a beverage, a pharmaceutical composition, a tobacco product, a nutraceutical composition, an oral hygiene composition, and a cosmetic composition, and wherein the target steviol glycoside is reb I.
15. The consumable product of claim 10, wherein the composition is selected from the group consisting of beverages; natural juices; refreshing drinks; carbonated soft drinks; diet drinks; zero calorie drinks; reduced calorie drinks and foods; yogurt drinks; instant juices; instant coffee; powdered types of instant beverages; canned products; syrups; fermented soybean paste; soy sauce; vinegar; dressings; mayonnaise; ketchups; curry; soup; instant bouillon; powdered soy sauce; powdered vinegar; types of biscuits; rice biscuit; crackers; bread; chocolates; caramel; candy; chewing gum; jelly; pudding; preserved fruits and vegetables; fresh cream; jam; marmalade; flower paste; powdered milk; ice cream; sorbet; vegetables and fruits packed in bottles; canned and boiled beans; meat and foods boiled in sweetened sauce; agricultural vegetable food products; seafood; ham; sausage; fish ham; fish sausage; fish paste; deep fried fish products; dried seafood products; frozen food products; preserved seaweed; preserved meat; tobacco and medicinal products.
16. The consumable product of claim 10, further comprising at least one additive selected from the group consisting of carbohydrates, polyols, amino acids and their corresponding salts, poly-amino acids and their corresponding salts, sugar acids and their corresponding salts, nucleotides, organic acids, inorganic acids, organic salts including organic acid salts and organic base salts, inorganic salts, bitter compounds, caffeine, flavorants and flavoring ingredients, astringent compounds, proteins or protein hydrolysates, surfactants, emulsifiers, flavonoids, alcohols, polymers and combinations thereof.
17. The consumable product of claim 10, further comprising at least one functional ingredient selected from the group consisting of saponins, antioxidants, dietary fiber sources, fatty acids, vitamins, glucosamine, minerals, preservatives, hydration agents, probiotics, prebiotics, weight management agents, osteoporosis management agents, phytoestrogens, long chain primary aliphatic saturated alcohols, phytosterols and combinations thereof.
18. The consumable product of claim 10, further comprising a compound selected from the group consisting of reb A, reb B, reb O, NSF-02, Mogroside V, Luo Han Guo, allulose, allose, D-tagatose, erythritol and combinations thereof.
19. A method for enhancing the sweetness of a beverage comprising a sweetener comprising: a.) providing a beverage comprising a sweetener; and b.) adding a sweetness enhancer selected from highly purified target glycoside composition produced by the method of claim 3, wherein highly purified target glycoside composition produced by the method of claim 3 is present in a concentration at or below the sweetness recognition threshold.
20. A method for producing rebaudioside M, comprising the steps of: (a) providing stevia leaves; (b) extracting rebaudioside A from the stevia leaves; (c) reacting the rebaudioside A with an enzyme capable of converting rebaudioside A to rebaudioside M; (d) separating the rebaudioside M.
21. The method of claim 20, wherein the enzyme is selected from the group consisting of: SuSy_At of SEQ ID 1, UGTSl of SEQ ID 2, and UGTSr of SEQ ID 3, or mutant variant thereof having >85% amino-acid sequence identity, >86% amino-acid sequence identity, >87% amino-acid sequence identity, >88% amino-acid sequence identity, >89% amino-acid sequence identity, >90% amino-acid sequence identity, >91% amino-acid sequence identity, >92% amino-acid sequence identity, >93% amino-acid sequence identity, >94% amino-acid sequence identity, >95% amino-acid sequence identity, >96% amino-acid sequence identity, >97% amino-acid sequence identity, >98% amino-acid sequence identity, >99% amino-acid sequence identity.
22. A method of producing target steviol glycosides composition, comprising the steps of: (a) providing starting steviol glycosides; (b) providing a first polypeptide; wherein the first polypeptide comprises a polypeptide having >85% amino-acid sequence identity, >86% amino-acid sequence identity, >87% amino-acid sequence identity, >88% amino-acid sequence identity, >89% amino-acid sequence identity, >90% amino-acid sequence identity, >91% amino-acid sequence identity, >92% amino-acid sequence identity, >93% amino-acid sequence identity, >94% amino-acid sequence identity, >95% amino-acid sequence identity, >96% amino-acid sequence identity, >97% amino-acid sequence identity, >98% amino-acid sequence identity, >99% amino-acid sequence identity to the amino acid sequence set forth in SEQ ID 1. (c) providing a second polypeptide capable of beta 1,2 glycosylation of the C2 of the 13-O-glucose, 19-O-glucose, or both 13-O-glucose and 19-O-glucose of a steviol glycoside; wherein the second polypeptide comprises a polypeptide having >85% amino-acid sequence identity, >86% amino-acid sequence identity, >87% amino-acid sequence identity, >88% amino-acid sequence identity, >89% amino-acid sequence identity, >90% amino-acid sequence identity, >91% amino-acid sequence identity, >92% amino-acid sequence identity, >93% amino-acid sequence identity, >94% amino-acid sequence identity, >95% amino-acid sequence identity, >96% amino-acid sequence identity, >97% amino-acid sequence identity, >98% amino-acid sequence identity, >99% amino-acid sequence identity to the amino acid sequence set forth in SEQ ID 2; (d) providing a third polypeptide capable of beta 1,3 glycosylation of the C3 of the 13-O-glucose, 19-O-glucose, or both 13-O-glucose and 19-O-glucose of the steviol glycoside; wherein the third polypeptide comprises a polypeptide having >85% amino-acid sequence identity, >86% amino-acid sequence identity, >87% amino-acid sequence identity, >88% amino-acid sequence identity, >89% amino-acid sequence identity, >90% amino-acid sequence identity, >91% amino-acid sequence identity, >92% amino-acid sequence identity, >93% amino-acid sequence identity, >94% amino-acid sequence identity, >95% amino-acid sequence identity, >96% amino-acid sequence identity, >97% amino-acid sequence identity, >98% amino-acid sequence identity, >99% amino-acid sequence identity to the amino acid sequence set forth in SEQ ID 3; (e) obtaining target steviol glycosides composition, wherein the target steviol glycosides composition comprises steviol-13-O-glucoside, steviol-19-O-glucoside, rubusoside, stevioside, 1,2-bioside, Rebaudioside A, Rebaudioside B, Rebaudioside D, Rebaudioside I or Rebaudioside E.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0037]
DETAILED DESCRIPTION
[0038] The present invention provides a process for preparing a composition comprising a target steviol glycoside by contacting a starting composition comprising an organic substrate with a microbial cell and/or enzyme preparation, thereby producing a composition comprising a target steviol glycoside.
[0039] One object of the invention is to provide an efficient biocatalytic method for preparing steviol glycosides, particularly stevioside, reb E, reb A, reb D, and reb M from various starting compositions. One particular object of the invention is to provide a manufacturing process for producing a blend of steviol glycosides having greater than about 30% reb M, hereinafter referred to as steviol glycosides with a high reb M content.
[0040] As used herein, biocatalysis or biocatalytic refers to the use of natural or genetically engineered biocatalysts, such as enzymes, or cells comprising one or more enzyme, capable of single or multiple step chemical transformations on organic compounds. Biocatalysis processes include fermentation, biosynthesis, bioconversion and biotransformation processes. Both isolated enzyme, and whole-cell biocatalysis methods are known in the art. Biocatalyst protein enzymes can be naturally occurring or recombinant proteins.
[0041] As used herein, the term steviol glycoside(s) refers to a glycoside of steviol, including, but not limited to, naturally occurring steviol glycosides, e.g. steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside rebaudioside M2, rebaudioside D, rebaudioside D2, rebaudioside N, rebaudioside O, synthetic steviol glycosides, e.g. enzymatically glucosylated steviol glycosides and combinations thereof.
Starting Composition
[0042] As used herein, starting composition refers to any composition (generally an aqueous solution) containing one or more organic compound comprising at least one carbon atom.
[0043] In one embodiment, the starting composition is selected from the group consisting of steviol glycosides, polyols and various carbohydrates.
[0044] The starting composition steviol glycoside is selected from the group consisting of steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside M, rebaudioside M2, rebaudioside D, rebaudioside D2, rebaudioside N or rebaudioside O, or other glycoside of steviol occurring in Stevia rebaudiana plant and/or combinations thereof.
[0045] In one embodiment, the starting composition steviol glycoside is stevioside.
[0046] In another embodiment, the starting composition steviol glycoside is rebaudioside A. In a particular embodiment, rebaudioside A is extracted from the leaves of Stevia rebaudiana plants, such as Stevia rebaudiana Bertoni plants, and purified to greater than 95% rebaudioside A.
[0047] In still another embodiment, the starting composition steviol glycoside is rebaudioside E.
[0048] In another embodiment, the starting composition steviol glycoside is rebaudioside I.
[0049] In yet another embodiment, the starting composition steviol glycoside is rebaudioside D.
[0050] The term polyol refers to a molecule that contains more than one hydroxyl group. A polyol may be a diol, triol, or a tetraol which contain 2, 3, and 4 hydroxyl groups, respectively. A polyol also may contain more than four hydroxyl groups, such as a pentaol, hexaol, heptaol, or the like, which contain 5, 6, or 7 hydroxyl groups, respectively. Additionally, a polyol also may be a sugar alcohol, polyhydric alcohol, or polyalcohol which is a reduced form of carbohydrate, wherein the carbonyl group (aldehyde or ketone, reducing sugar) has been reduced to a primary or secondary hydroxyl group. Examples of polyols include, but are not limited to, erythritol, maltitol, mannitol, sorbitol, lactitol, xylitol, inositol, isomalt, propylene glycol, glycerol, threitol, galactitol, hydrogenated isomaltulose, reduced isomalto-oligosaccharides, reduced xylo-oligosaccharides, reduced gentio-oligosaccharides, reduced maltose syrup, reduced glucose syrup, hydrogenated starch hydrolyzates, polyglycitols and sugar alcohols or any other carbohydrates capable of being reduced.
[0051] The term carbohydrate refers to aldehyde or ketone compounds substituted with multiple hydroxyl groups, of the general formula (CH.sub.2O).sub.n, wherein n is 3-30, as well as their oligomers and polymers. The carbohydrates of the present invention can, in addition, be substituted or deoxygenated at one or more positions. Carbohydrates, as used herein, encompass unmodified carbohydrates, carbohydrate derivatives, substituted carbohydrates, and modified carbohydrates. As used herein, the phrases carbohydrate derivatives, substituted carbohydrate, and modified carbohydrates are synonymous. Modified carbohydrate means any carbohydrate wherein at least one atom has been added, removed, or substituted, or combinations thereof. Thus, carbohydrate derivatives or substituted carbohydrates include substituted and unsubstituted monosaccharides, disaccharides, oligosaccharides, and polysaccharides. The carbohydrate derivatives or substituted carbohydrates optionally can be deoxygenated at any corresponding C-position, and/or substituted with one or more moieties such as hydrogen, halogen, haloalkyl, carboxyl, acyl, acyloxy, amino, amido, carboxyl derivatives, alkylamino, dialkylamino, arylamino, alkoxy, aryloxy, nitro, cyano, sulfo, mercapto, imino, sulfonyl, sulfenyl, sulfinyl, sulfamoyl, carboalkoxy, carboxamido, phosphonyl, phosphinyl, phosphoryl, phosphino, thioester, thioether, oximino, hydrazino, carbamyl, phospho, phosphonato, or any other viable functional group provided the carbohydrate derivative or substituted carbohydrate functions to improve the sweet taste of the sweetener composition.
[0052] Examples of carbohydrates which may be used in accordance with this invention include, but are not limited to, tagatose, trehalose, galactose, rhamnose, various cyclodextrins, cyclic oligosaccharides, various types of maltodextrins, dextran, sucrose, glucose, ribulose, fructose, threose, arabinose, xylose, lyxose, allose, altrose, mannose, idose, lactose, maltose, invert sugar, isotrehalose, neotrehalose, isomaltulose, erythrose, deoxyribose, gulose, idose, talose, erythrulose, xylulose, psicose, turanose, cellobiose, amylopectin, glucosamine, mannosamine, fucose, glucuronic acid, gluconic acid, glucono-lactone, abequose, galactosamine, beet oligosaccharides, isomalto-oligosaccharides (isomaltose, isomaltotriose, panose and the like), xylo-oligosaccharides (xylotriose, xylobiose and the like), xylo-terminated oligosaccharides, gentio-oligosaccharides (gentiobiose, gentiotriose, gentiotetraose and the like), sorbose, nigero-oligosaccharides, palatinose oligosaccharides, fructooligosaccharides (kestose, nystose and the like), maltotetraol, maltotriol, malto-oligosaccharides (maltotriose, maltotetraose, maltopentaose, maltohexaose, maltoheptaose and the like), starch, inulin, inulo-oligosaccharides, lactulose, melibiose, raffinose, ribose, isomerized liquid sugars such as high fructose corn syrups, coupling sugars, and soybean oligosaccharides. Additionally, the carbohydrates as used herein may be in either the D- or L-configuration.
[0053] The starting composition may be synthetic or purified (partially or entirely), commercially available or prepared.
[0054] In one embodiment, the starting composition is glycerol.
[0055] In another embodiment, the starting composition is glucose.
[0056] In still another embodiment, the starting composition is sucrose.
[0057] In yet another embodiment, the starting composition is starch.
[0058] In another embodiment, the starting composition is maltodextrin.
[0059] The organic compound(s) of starting composition serve as a substrate(s) for the production of the target steviol glycoside(s), as described herein.
Target Steviol Glycoside
[0060] The target steviol glycoside of the present method can be any steviol glycoside that can be prepared by the process disclosed herein. In one embodiment, the target steviol glycoside is selected from the group consisting of steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside M, rebaudioside M2, rebaudioside D, rebaudioside D2, rebaudioside N or rebaudioside O, or other glycoside of steviol.
[0061] In one embodiment, the target steviol glycoside is stevioside. In another embodiment, the target steviol glycoside is rebaudioside A (reb A). In still another embodiment, the target steviol glycoside is rebaudioside E (reb E). In yet another embodiment, the target steviol glycoside is rebaudioside I (reb I). In yet another embodiment, the target steviol glycoside is rebaudioside D (reb D). In a further embodiment, the target steviol glycoside is rebaudioside M(reb M).
[0062] The target steviol glycoside can be in any polymorphic or amorphous form, including hydrates, solvates, anhydrous or combinations thereof.
[0063] In one embodiment, the present invention is a biocatalytic process for the production of reb D.
[0064] In yet another embodiment, the present invention is a biocatalytic process for the production of reb E.
[0065] In still another embodiment, the present invention is a biocatalytic process for the production of reb I.
[0066] In a further embodiment, the present invention is a biocatalytic process for the production of reb M.
[0067] Optionally, the method of the present invention further comprises separating the target steviol glycoside from the medium to provide a highly purified target steviol glycoside composition. The target steviol glycoside can be separated by any suitable method, such as, for example, crystallization, separation by membranes, centrifugation, extraction, chromatographic separation or a combination of such methods.
[0068] In particular embodiments, the process described herein results in a highly purified target steviol glycoside composition. The term highly purified, as used herein, refers to a composition having greater than about 80% by weight of the target steviol glycoside on an anhydrous (dried) basis. In one embodiment, the highly purified target steviol glycoside composition contains greater than about 90% by weight of the target steviol glycoside on an anhydrous (dried) basis, such as, for example, greater than about 91%, greater than about 92%, greater than about 93%, greater than about 94%, greater than about 95%, greater than about 96%, greater than about 97%, greater than about 98% or greater than about 99% target steviol glycoside content on a dried basis.
[0069] In one embodiment, when the target steviol glycoside is reb M, the process described herein provides a composition having greater than about 90% reb M content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is reb M, the process described herein provides a composition comprising greater than about 95% reb M content by weight on a dried basis.
[0070] In another embodiment, when the target steviol glycoside is reb I, the process described herein provides a composition having greater than about 90% reb I content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is reb I, the process described herein provides a composition comprising greater than about 95% reb I content by weight on a dried basis.
[0071] In yet another embodiment, when the target steviol glycoside is reb D, the process described herein provides a composition greater than about 90% reb D content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is reb D, the process described herein provides a composition comprising greater than about 95% reb D content by weight on a dried basis.
[0072] In still another embodiment, when the target steviol glycoside is reb E, the process described herein provides a composition greater than about 90% reb E content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is reb E, the process described herein provides a composition comprising greater than about 95% reb E content by weight on a dried basis.
[0073] In a further embodiment, when the target steviol glycoside is reb A, the process described herein provides a composition comprising greater than about 90% reb A content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is reb A, the process described herein provides a composition comprising greater than about 95% reb A content by weight on a dried basis.
[0074] In yet a further embodiment, when the target steviol glycoside is stevioside, the process described herein provides a composition comprising greater than about 90% stevioside content by weight on a dried basis. In another particular embodiment, when the target steviol glycoside is stevioside, the process described herein provides a composition comprising greater than about 95% stevioside content by weight on a dried basis.
[0075] Microorganisms and Enzyme Preparations
[0076] In one embodiment of present invention, a microorganism (microbial cell) and/or enzyme preparation is contacted with a medium containing the starting composition to produce target steviol glycosides.
[0077] The enzyme can be provided in the form of a whole cell suspension, a crude lysate, a purified enzyme or a combination thereof. In one embodiment, the biocatalyst is a purified enzyme capable of converting the starting composition to the target steviol glycoside. In another embodiment, the biocatalyst is a crude lysate comprising at least one enzyme capable of converting the starting composition to the target steviol glycoside. In still another embodiment, the biocatalyst is a whole cell suspension comprising at least one enzyme capable of converting the starting composition to the target steviol glycoside.
[0078] In another embodiment, the biocatalyst is one or more microbial cells comprising enzyme(s) capable of converting the starting composition to the target steviol glycoside. The enzyme can be located on the surface of the cell, inside the cell or located both on the surface of the cell and inside the cell.
[0079] Suitable enzymes for converting the starting composition to target steviol glycosides include, but are not limited to, the steviol biosynthesis enzymes and UDP-glycosyltransferases (UGTs). Optionally it may include UDP recycling enzyme(s).
[0080] In one embodiment, the steviol biosynthesis enzymes include mevalonate (MVA) pathway enzymes.
[0081] In another embodiment, the steviol biosynthesis enzymes include non-mevalonate 2-C-methyl-D-erythritol-4-phosphate pathway (MEP/DOXP) enzymes.
[0082] In one embodiment, the steviol biosynthesis enzymes are selected from the group including geranylgeranyl diphosphate synthase, copalyl diphosphate synthase, kaurene synthase, kaurene oxidase, kaurenoic acid 13-hydroxylase (KAH), steviol synthetase, deoxyxylulose 5-phosphate synthase (DXS), D-1-deoxyxylulose 5-phosphate reductoisomerase (DXR), 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase (CMS), 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK), 4-diphosphocytidyl-2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MCS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate synthase (HDS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate reductase (HDR), acetoacetyl-CoA thiolase, truncated HMG-CoA reductase, mevalonate kinase, phosphomevalonate kinase, mevalonate pyrophosphate decarboxylase, cytochrome P450 reductase etc.
[0083] The UDP-glucosyltransferase can be any UDP-glucosyltransferase capable of adding at least one glucose unit to the steviol and or steviol glycoside substrate to provide the target steviol glycoside.
[0084] In one embodiment, steviol biosynthesis enzymes and UDP-glucosyltransferases are produced in a microbial cell. The microbial cell may be, for example, E. coli, Saccharomyces sp., Aspergillus sp., Pichia sp., Bacillus sp., Yarrowia sp. etc. For example, in one embodiment, the enzymes are produced by microbial fermentation of the E. coli production strain LE1B109 carrying the expression vector for the corresponding enzyme gene.
[0085] In another embodiment, the UDP-glucosyltransferases are synthesized.
[0086] In one embodiment, the UDP-glucosyltransferase is selected from group including UGT74G1, UGT85C2, UGT76G1, UGT91D2 and UGTs having substantial (>85%) amino-acid sequence identity to these polypeptides as well as isolated nucleic acid molecules that code for these UGTs.
[0087] In one embodiment, steviol biosynthesis enzymes, UGTs and UDP-glucose recycling system are present in one microorganism (microbial cell). The microorganism may be for example, E. coli, Saccharomyces sp., Aspergillus sp., Pichia sp., Bacillus sp., Yarrowia sp.
[0088] In one embodiment, the UDP-glucosyltransferase is any UDP-glucosyltransferase capable of adding at least one glucose unit to rubusoside to form stevioside. In a particular embodiment, the UDP-glucosyltransferase is UGT91D2 or a UGT having >85% amino-acid sequence identity with UGT91D2.
[0089] In one embodiment, the UDP-glucosyltransferase is any UDP-glucosyltransferase capable of adding at least one glucose unit to stevioside to form rebaudioside A. In a particular embodiment, the UDP-glucosyltransferase is UGT76G1 or a UGT having >85% amino-acid sequence identity with UGT76G1 (SEQ ID 3).
[0090] In another embodiment, the UDP-glucosyltransferase is any UDP-glucosyltransferase capable of adding at least one glucose unit to rebaudioside A to form rebaudioside D. In a particular embodiment, the UDP-glucosyltransferase is UGT91D2 or a UGT having >85% amino-acid sequence identity with UGT91D2. In yet another embodiment the UDP-glucosyltransferase is UGTSL or a UGT having >85% amino-acid sequence identity with UGTSL. In another embodiment, the UDP-glucosyltransferase is EUGT11 or a UGT having >85% amino-acid sequence identity with EUGT11. In yet another embodiment the UDP-glucosyltransferase is UGTSL2 or a UGT having >85% amino-acid sequence identity with UGTSL2 (SEQ ID 2).
[0091] In yet another embodiment, the UDP-glucosyltransferase is any UDP-glucosyltransferase capable of adding at least one glucose unit to rebaudioside D to form rebaudioside M In a particular embodiment, the UDP-glucosyltransferase is UGT76G1 or a UGT having >85% amino-acid sequence identity with UGT76G1 (SEQ ID 3).
[0092] Optionally, the method of the present invention further comprises recycling UDP to provide UDP-glucose. In one embodiment, the method comprises recycling UDP by providing a recycling catalyst and a recycling substrate, such that the biotransformation of the steviol glycoside substrate to the target steviol glycoside is carried out using catalytic amounts of UDP-glucosyltransferase and UDP-glucose. The UDP recycling enzyme can be sucrose synthase and the recycling substrate can be sucrose. In one embodiment the sucrose synthase is SuSy_At or a sucrose synthase having >85% amino-acid sequence identity with SuSy_At (SEQ ID 1).
[0093] In another embodiment, the UDP-glucosyltransferase capable of adding at least one glucose unit to starting composition steviol glycoside has >85% amino-acid sequence identity with UGTs selected from the following listing of GenInfo identifier numbers, preferably from the group presented in Table 1, and more preferably the group presented in Table 2.
TABLE-US-00001 397567 30680413 115480946 147798902 218193594 225443294 454245 32816174 116310259 147811764 218193942 225444853 1359905 32816178 116310985 147827151 219885307 225449296 1685003 34393978 116788066 147836230 222615927 225449700 1685005 37993665 116788606 147839909 222619587 225454338 2191136 37993671 116789315 147846163 222623142 225454340 2501497 37993675 119394507 147855977 222625633 225454342 2911049 39104603 119640480 148905778 222625635 225454473 4218003 41469414 122209731 148905999 222636620 225454475 4314356 41469452 125526997 148906835 222636621 225458362 13492674 42566366 125534279 148907340 222636628 225461551 13492676 42570280 125534461 148908935 222636629 225461556 15217773 42572855 125540090 148909182 224053242 225461558 15217796 44890129 125541516 148909920 224053386 225469538 15223396 46806235 125545408 148910082 224055535 225469540 15223589 50284482 125547340 148910154 224056138 226316457 15227766 51090402 125547520 148910612 224056160 226492603 15230017 51090594 125554547 148910769 224067918 226494221 15231757 52839682 125557592 156138791 224072747 226495389 15234056 56550539 125557593 156138797 224080189 226495945 15234195 62734263 125557608 156138799 224091845 226502400 15234196 62857204 125559566 156138803 224094703 226507980 15238503 62857206 125563266 165972256 224100653 226531147 15239523 62857210 125571055 168016721 224100657 226532094 15239525 62857212 125579728 171674071 224101569 238477377 15239543 75265643 125588307 171906258 224103105 240254512 15239937 75285934 125589492 183013901 224103633 242032615 15240305 75288884 125599469 183013903 224103637 242032621 15240534 77550661 125601477 186478321 224109218 242038423 15982889 77556148 126635837 187373030 224114583 242043290 18086351 82791223 126635845 187373042 224116284 242044836 18418378 83778990 126635847 190692175 224120552 242051252 18418380 89953335 126635863 194701936 224121288 242056217 18418382 110741436 126635867 195620060 224121296 242056219 19743740 110743955 126635883 209954691 224121300 242056663 19911201 115438196 126635887 209954719 224130358 242059339 20149064 115438785 133874210 209954725 224140703 242059341 20260654 115441237 133874212 209954733 224143404 242060922 21435782 115454819 145358033 210063105 224143406 242067411 21553613 115456047 147772508 210063107 224144306 242067413 21593514 115457492 147776893 212275846 224285244 242076258 22759895 115459312 147776894 216296854 225431707 242076396 23955910 115464719 147776895 217074506 225435532 242084750 26452040 115471069 147786916 218185693 225436321 242091005 28393204 115471071 147798900 218187075 225440041 242095206 30679796 115474009 147798901 218189427 225441116 242345159 242345161 297724601 326492035 356523945 357140904 359486938 255536859 297725463 326493430 356523957 357165849 359487055 255538228 297728331 326500410 356523959 357165852 359488135 255541676 297738632 326506816 356523961 357168415 359488708 255547075 297745347 326507826 356523963 357437837 359493630 255552620 297745348 326508394 356524387 357442755 359493632 255552622 297795735 326509445 356524403 357442757 359493634 255555343 297796253 326511261 356527181 357445729 359493636 255555361 297796257 326511866 356533209 357445731 359493815 255555363 297796261 326512412 356533852 357445733 359495856 255555365 297797587 326517673 356534718 357446799 359495858 255555369 297798502 326518800 356535480 357446805 359495869 255555373 297799226 326521124 356542996 357452779 359495871 255555377 297805988 326525567 356543136 357452781 359497638 255556812 297807499 326525957 356543932 357452783 359807261 255556818 297809125 326526607 356549841 357452787 374256637 255563008 297809127 326527141 356549843 357452789 377655465 255564074 297811403 326530093 356554358 357452791 378405177 255564531 297820040 326534036 356554360 357452797 378829085 255572878 297821483 326534312 356558606 357452799 387135070 255577901 297825217 332071132 356560333 357470367 387135072 255583249 297832276 339715876 356560599 357472193 387135078 255583253 297832280 342306012 356560749 357472195 387135092 255583255 297832518 342306016 356566018 357474295 387135094 255585664 297832520 343457675 356566169 357474493 387135098 255585666 297840825 343457677 356566173 357474497 387135100 255634688 297840827 350534960 356567761 357474499 387135134 255644801 297847402 356498085 356574704 357490035 387135136 255645821 297849372 356499771 356576401 357493567 387135174 255647456 300078590 356499777 356577660 357497139 387135176 255648275 300669727 356499779 357114993 357497581 387135184 260279126 302142947 356501328 357115447 357497671 387135186 260279128 302142948 356502523 357115451 357500579 387135188 261343326 302142950 356503180 357115453 357504663 387135190 283132367 302142951 356503184 357116080 357504691 387135192 283362112 302765302 356503295 357116928 357504699 387135194 289188052 302796334 356504436 357117461 357504707 387135282 295841350 302811470 356504523 357117463 357505859 387135284 296088529 302821107 356504765 357117829 357510851 387135294 296090415 302821679 356511113 357117839 357516975 387135298 296090524 319759260 356515120 357125059 359477003 387135300 296090526 319759266 356517088 357126015 359477998 387135302 297599503 320148814 356520732 357134488 359478043 387135304 297601531 326489963 356522586 357135657 359478286 387135312 297611791 326490273 356522588 357138503 359484299 387135314 297722841 326491131 356522590 357139683 359486936 387135316 387135318 449440433 460376293 460413408 462423864 475546199 387135320 449445896 460378310 460416351 470101924 475556485 387135322 449446454 460380744 462394387 470102280 475559699 387135324 449447657 460381726 462394433 470102858 475578293 387135326 449449002 460382093 462394557 470104211 475591753 387135328 449449004 460382095 462395646 470104264 475593742 388493506 449449006 460382754 462395678 470104266 475612072 388495496 449451379 460384935 462396388 470106317 475622476 388498446 449451589 460384937 462396389 470106357 475622507 388499220 449451591 460385076 462396419 470115448 475623787 388502176 449451593 460385872 462396542 470130404 482550481 388517521 449453712 460386018 462397507 470131550 482550499 388519407 449453714 460389217 462399998 470136482 482550740 388521413 449453716 460394872 462400798 470136484 482550999 388827901 449453732 460396139 462401217 470136488 482552352 388827903 449457075 460397862 462402118 470136492 482554970 388827907 449467555 460397864 462402237 470137933 482555336 388827909 449468742 460398541 462402284 470137937 482555478 388827913 449495638 460403139 462402416 470140422 482556454 393887637 449495736 460403141 462404228 470140426 482557289 393887646 449499880 460403143 462406358 470140908 482558462 393887649 449502786 460403145 462408262 470141232 482558508 393990627 449503471 460405998 462409325 470142008 482558547 397746860 449503473 460407578 462409359 470142010 482561055 397789318 449515857 460407590 462409777 470142012 482561555 413924864 449518643 460409128 462411467 470143607 482562795 414590349 449519559 460409134 462414311 470143939 482562850 414590661 449522783 460409136 462414416 470145404 482565074 414591157 449524530 460409459 462414476 473923244 482566269 414879558 449524591 460409461 462415526 474114354 482566296 414879559 449528823 460409463 462415603 474143634 482566307 414879560 449528825 460409465 462415731 474202268 482568689 414888074 449534021 460409467 462416307 474299266 482570049 431812559 460365546 460410124 462416920 474363119 482570572 449432064 460366882 460410126 462416922 474366157 482575121 449432066 460369823 460410128 462416923 474429346 449433069 460369829 460410130 462416924 475432777 449436944 460369831 460410132 462417401 475473002 449438665 460369833 460410134 462419769 475489790 449438667 460370755 460410213 462420317 475511330 449440431 460374714 460411200 462423366 475516200
TABLE-US-00002 TABLE 1 GI number Accession Origin 190692175 ACE87855.1 Stevia rebaudiana 41469452 AAS07253.1 Oryza saliva 62857204 BAD95881.1 Ipomoea nil 62857206 BAD95882.1 Ipomoea purperea 56550539 BAD77944.1 Bellis perennis 115454819 NP_001051010.1 Oryza sativa Japonica Group 115459312 NP_001053256.1 Oryza sativa Japonica Group 115471069 NP_001059133.1 Oryza saliva Japonica Group 115471071 NP_001059134.1 Oryza saliva Japonica Group 116310985 CAH67920.1 Oryza sativa Indica Group 116788066 ABK24743.1 Picea sitchensis 122209731 Q2V6J9.1 Fragaria ananassa 125534461 EAY81009.1 Oryza sativa Indica Group 125559566 EAZ05102.1 Oryza sativa Indica Group 125588307 EAZ28971.1 Oryza sativa Japonica Group 148907340 ABR16806.1 Picea sitchensis 148910082 ABR18123.1 Picea sitchensis 148910612 ABR18376.1 Picea sitchensis 15234195 NP_194486.1 Arabidopsis thaliana 15239523 NP_200210.1 Arabidopsis thaliana 15239937 NP_196793.1 Arabidopsis thaliana 1685005 AAB36653.1 Nicotiana tabacum 183013903 ACC38471.1 Medicago truncatula 186478321 NP_172511.3 Arabidopsis thaliana 187373030 ACD03249.1 Avena strigosa 194701936 ACF85052.1 Zea mays 19743740 AAL92461.1 Solanum lycopersicum 212275846 NP_001131009.1 Zea mays 222619587 EEE55719.1 Oryza sativa Japonica Group 224055535 XP_002298527.1 Populus trichocarpa 224101569 XP_002334266.1 Populus trichocarpa 224120552 XP_002318358.1 Populus trichocarpa 224121288 XP_002330790.1 Populus trichocarpa 225444853 XP_002281094 Vitis vinifera 225454342 XP_002275850.1 Vitis vinifera 225454475 XP_002280923.1 Vitis vinifera 225461556 XP_002285222 Vitis vinifera 225469540 XP_002270294.1 Vitis vinifera 226495389 NP_001148083.1 Zea mays 226502400 NP_001147674.1 Zea mays 238477377 ACR43489.1 Triticum aestivum 240254512 NP_565540.4 Arabidopsis thaliana 2501497 Q43716.1 Petunia hybrida 255555369 XP_002518721.1 Ricinus communis 26452040 BAC43110.1 Arabidopsis thaliana 296088529 CBI37520.3 Vitis vinifera 297611791 NP_001067852.2 Oryza sativa Japonica Group 297795735 XP_002865752.1 Arabidopsis lyrata subsp. lyrata 297798502 XP_002867135.1 Arabidopsis lyrata subsp. lyrata 297820040 XP_002877903.1 Arabidopsis lyrata subsp. lyrata 297832276 XP_002884020.1 Arabidopsis lyrata subsp. lyrata 302821107 XP_002992218.1 Selaginella moellendorffii 30680413 NP_179446.2 Arabidopsis thaliana 319759266 ADV71369.1 Pueraria montana var. lobata 326507826 BAJ86656.1 Hordeum vulgare subsp. Vulgare 343457675 AEM37036.1 Brassica rapa subsp. oleifera 350534960 NP_001234680.1 Solanum lycopersicum 356501328 XP_003519477.1 Glycine max 356522586 XP_003529927.1 Glycine max 356535480 XP_003536273.1 Glycine max 357445733 XP_003593144.1 Medicago truncatula 357452783 XP_003596668.1 Medicago truncatula 357474493 XP_003607531.1 Medicago truncatula 357500579 XP_003620578.1 Medicago truncatula 357504691 XP_003622634.1 Medicago truncatula 359477998 XP_003632051.1 Vitis vinifera 359487055 XP_002271587 Vitis vinifera 359495869 XP_003635104.1 Vitis vinifera 387135134 AFJ52948.1 Linum usitatissimum 387135176 AFJ52969.1 Linum usitatissimum 387135192 AFJ52977.1 Linum usitatissimum 387135282 AFJ53022.1 Linum usitatissimum 387135302 AFJ53032.1 Linum usitatissimum 387135312 AFJ53037.1 Linum usitatissimum 388519407 AFK47765.1 Medicago truncatula 393887646 AFN26668.1 Barbarea vulgaris subsp. arcuata 414888074 DAA64088.1 Zea mays 42572855 NP_974524.1 Arabidopsis thaliana 449440433 XP_004137989.1 Cucumis sativus 449446454 XP_004140986.1 Cucumis sativus 449449004 XP_004142255.1 Cucumis sativus 449451593 XP_004143546.1 Cucumis sativus 449515857 XP_004164964.1 Cucumis sativus 460382095 XP_004236775.1 Solanum lycopersicum 460409128 XP_004249992.1 Solanum lycopersicum 460409461 XP_004250157.1 Solanum lycopersicum 460409465 XP_004250159.1 Solanum lycopersicum 462396388 EMJ02187.1 Prunus persica 462402118 EMJ07675.1 Prunus persica 462409359 EMJ14693.1 Prunus persica 462416923 EMJ21660.1 Prunus persica 46806235 BAD17459.1 Oryza saliva Japonica Group 470104266 XP_004288529.1 Fragaria vesca subsp. vesca 470142008 XP_004306714.1 Fragaria vesca subsp. vesca 475432777 EMT01232.1 Aegilops tauschii 51090402 BAD35324.1 Oryza sativa Japonica Group
TABLE-US-00003 TABLE 2 Internal GI number Accession Origin reference 460409128 XP.004249992.1 Solanum lycopersicum UGTSL 460386018 XP.004238697.1 Solanum lycopersicum 460409134 XP.004249995.1 Solanum lycopersicum 460410132 XP.004250485.1 Solanum lycopersicum UGTSL2 460410130 XP.004250484.1 Solanum lycopersicum 460410128 XP.004250483.1 Solanum lycopersicum 460378310 XP.004234916.1 Solanum lycopersicum 209954733 BAG80557.1 Lycium barbarum UGTLB 209954725 BAG80553.1 Lycium barbarum
[0094] One embodiment is a microbial cell comprising an enzyme of the present invention, i.e. an enzyme capable of converting the starting composition to the target steviol glycoside. Accordingly, some embodiments of the present method include contacting a microorganism with a medium containing the starting composition to provide a medium comprising at least one target steviol glycoside.
[0095] The microorganism can be any microorganism possessing the necessary enzyme(s) for converting the starting composition to target steviol glycoside(s). These enzymes are encoded within the microorganism's genome.
[0096] Suitable microorganisms include, but are not limited to, E. coli, Saccharomyces sp., Aspergillus sp., Pichia sp., Bacillus sp., Yarrowia sp. etc.
[0097] In one embodiment, the microorganism is free when contacted with the starting composition.
[0098] In another embodiment, the microorganism is immobilized when contacted with the starting composition. For example, the microorganism may be immobilized to a solid support made from inorganic or organic materials. Non-limiting examples of solid supports suitable to immobilize the microorganism include derivatized cellulose or glass, ceramics, metal oxides or membranes. The microorganism may be immobilized to the solid support, for example, by covalent attachment, adsorption, cross-linking, entrapment or encapsulation.
[0099] In still another embodiment, the enzyme capable of converting the starting composition to the target steviol glycoside is secreted out of the microorganism and into the reaction medium.
[0100] The target steviol glycoside is optionally purified. Purification of the target steviol glycoside from the reaction medium can be achieved by at least one suitable method to provide a highly purified target steviol glycoside composition. Suitable methods include crystallization, separation by membranes, centrifugation, extraction (liquid or solid phase), chromatographic separation, HPLC (preparative or analytical) or a combination of such methods.
[0101] Highly purified target glycoside(s) particularly, reb M, reb D, reb I and/or reb E obtained according to this invention can be used as-is or in combination with other sweeteners, flavors, food ingredients and combinations thereof.
[0102] Non-limiting examples of flavors include, but are not limited to, lime, lemon, orange, fruit, banana, grape, pear, pineapple, mango, berry, bitter almond, cola, cinnamon, sugar, cotton candy, vanilla and combinations thereof.
[0103] Non-limiting examples of other food ingredients include, but are not limited to, acidulants, organic and amino acids, coloring agents, bulking agents, modified starches, gums, texturizers, preservatives, caffeine, antioxidants, emulsifiers, stabilizers, thickeners, gelling agents and combinations thereof.
[0104] Highly purified target glycoside(s) particularly, reb M, reb D, reb I and/or reb E obtained according to this invention can be prepared in various polymorphic forms, including but not limited to hydrates, solvates, anhydrous, amorphous forms and combinations thereof.
[0105] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E obtained according to this invention may be incorporated as a high intensity natural sweetener in foodstuffs, beverages, pharmaceutical compositions, cosmetics, chewing gums, table top products, cereals, dairy products, toothpastes and other oral cavity compositions, etc.
[0106] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E as a sweetening compound may be employed as the sole sweetener, or it may be used together with at least one naturally occurring high intensity sweeteners such as stevioside, reb A, reb B, reb C, reb F, reb N, reb O, steviolbioside, dulcoside A, rubusoside, mogrosides, brazzein, neohesperidin dihydrochalcone, glycyrrhizic acid and its salts, thaumatin, perillartine, pernandulcin, mukuroziosides, baiyunoside, phlomisoside-1, dimethyl-hexahydrofluorene-dicarboxylic acid, abrusosides, periandrin, carnosiflosides, cyclocarioside, pterocaryosides, polypodoside A, brazilin, hernandulcin, phillodulcin, glycyphyllin, phlorizin, trilobatin, dihydroflavonol, dihydroquercetin-3-acetate, neoastilibin, trans-cinnamaldehyde, monatin and its salts, selligueain A, hematoxylin, monellin, osladin, pterocaryoside A, pterocaryoside B, mabinlin, pentadin, miraculin, curculin, neoculin, chlorogenic acid, cynarin, Luo Han Guo sweetener, mogroside V, siamenoside and combinations thereof.
[0107] In a particular embodiment, reb M, reb D, reb I and/or reb E can be used in a sweetener composition comprising a compound selected from the group consisting of reb A, reb B, reb O, NSF-02, Mogroside V, Luo Han Guo, allulose, allose, D-tagatose, erythritol and combinations thereof.
[0108] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E may also be used in combination with synthetic high intensity sweeteners such as sucralose, potassium acesulfame, aspartame, alitame, saccharin, neohesperidin dihydrochalcone, cyclamate, neotame, dulcin, suosan advantame, salts thereof, and combinations thereof.
[0109] Moreover, highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E can be used in combination with natural sweetener suppressors such as gymnemic acid, hodulcin, ziziphin, lactisole, and others. reb M, reb D, reb I and/or reb E may also be combined with various umami taste enhancers. reb M, reb D, reb I and/or reb E can be mixed with umami tasting and sweet amino acids such as glutamate, aspartic acid, glycine, alanine, threonine, proline, serine, glutamate, lysine, tryptophan and combinations thereof.
[0110] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E can be used in combination with one or more additive selected from the group consisting of carbohydrates, polyols, amino acids and their corresponding salts, poly-amino acids and their corresponding salts, sugar acids and their corresponding salts, nucleotides, organic acids, inorganic acids, organic salts including organic acid salts and organic base salts, inorganic salts, bitter compounds, flavorants and flavoring ingredients, astringent compounds, proteins or protein hydrolysates, surfactants, emulsifiers, flavonoids, alcohols, polymers and combinations thereof.
[0111] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E may be combined with polyols or sugar alcohols. The term polyol refers to a molecule that contains more than one hydroxyl group. A polyol may be a diol, triol, or a tetraol which contain 2, 3, and 4 hydroxyl groups, respectively. A polyol also may contain more than four hydroxyl groups, such as a pentaol, hexaol, heptaol, or the like, which contain 5, 6, or 7 hydroxyl groups, respectively. Additionally, a polyol also may be a sugar alcohol, polyhydric alcohol, or polyalcohol which is a reduced form of carbohydrate, wherein the carbonyl group (aldehyde or ketone, reducing sugar) has been reduced to a primary or secondary hydroxyl group. Examples of polyols include, but are not limited to, erythritol, maltitol, mannitol, sorbitol, lactitol, xylitol, inositol, isomalt, propylene glycol, glycerol, threitol, galactitol, hydrogenated isomaltulose, reduced isomalto-oligosaccharides, reduced xylo-oligosaccharides, reduced gentio-oligosaccharides, reduced maltose syrup, reduced glucose syrup, hydrogenated starch hydrolyzates, polyglycitols and sugar alcohols or any other carbohydrates capable of being reduced which do not adversely affect the taste of the sweetener composition.
[0112] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E may be combined with reduced calorie sweeteners such as, for example, D-tagatose, L-sugars, L-sorbose, L-arabinose and combinations thereof.
[0113] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E may also be combined with various carbohydrates. The term carbohydrate generally refers to aldehyde or ketone compounds substituted with multiple hydroxyl groups, of the general formula (CH.sub.2O).sub.n, wherein n is 3-30, as well as their oligomers and polymers. The carbohydrates of the present invention can, in addition, be substituted or deoxygenated at one or more positions. Carbohydrates, as used herein, encompass unmodified carbohydrates, carbohydrate derivatives, substituted carbohydrates, and modified carbohydrates. As used herein, the phrases carbohydrate derivatives, substituted carbohydrate, and modified carbohydrates are synonymous. Modified carbohydrate means any carbohydrate wherein at least one atom has been added, removed, or substituted, or combinations thereof. Thus, carbohydrate derivatives or substituted carbohydrates include substituted and unsubstituted monosaccharides, disaccharides, oligosaccharides, and polysaccharides. The carbohydrate derivatives or substituted carbohydrates optionally can be deoxygenated at any corresponding C-position, and/or substituted with one or more moieties such as hydrogen, halogen, haloalkyl, carboxyl, acyl, acyloxy, amino, amido, carboxyl derivatives, alkylamino, dialkylamino, arylamino, alkoxy, aryloxy, nitro, cyano, sulfo, mercapto, imino, sulfonyl, sulfenyl, sulfinyl, sulfamoyl, carboalkoxy, carboxamido, phosphonyl, phosphinyl, phosphoryl, phosphino, thioester, thioether, oximino, hydrazino, carbamyl, phospho, phosphonato, or any other viable functional group provided the carbohydrate derivative or substituted carbohydrate functions to improve the sweet taste of the sweetener composition.
[0114] Examples of carbohydrates which may be used in accordance with this invention include, but are not limited to, psicose, turanose, allose, tagatose, trehalose, galactose, rhamnose, various cyclodextrins, cyclic oligosaccharides, various types of maltodextrins, dextran, sucrose, glucose, ribulose, fructose, threose, arabinose, xylose, lyxose, allose, altrose, mannose, idose, lactose, maltose, invert sugar, isotrehalose, neotrehalose, isomaltulose, erythrose, deoxyribose, gulose, idose, talose, erythrulose, xylulose, psicose, turanose, cellobiose, amylopectin, glucosamine, mannosamine, fucose, glucuronic acid, gluconic acid, glucono-lactone, abequose, galactosamine, beet oligosaccharides, isomalto-oligosaccharides (isomaltose, isomaltotriose, panose and the like), xylo-oligosaccharides (xylotriose, xylobiose and the like), xylo-terminated oligosaccharides, gentio-oligosaccharides (gentiobiose, gentiotriose, gentiotetraose and the like), sorbose, nigero-oligosaccharides, palatinose oligosaccharides, fructooligosaccharides (kestose, nystose and the like), maltotetraol, maltotriol, malto-oligosaccharides (maltotriose, maltotetraose, maltopentaose, maltohexaose, maltoheptaose and the like), starch, inulin, inulo-oligosaccharides, lactulose, melibiose, raffinose, ribose, isomerized liquid sugars such as high fructose corn syrups, coupling sugars, and soybean oligosaccharides. Additionally, the carbohydrates as used herein may be in either the D- or L-configuration.
[0115] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E obtained according to this invention can be used in combination with various physiologically active substances or functional ingredients. Functional ingredients generally are classified into categories such as carotenoids, dietary fiber, fatty acids, saponins, antioxidants, nutraceuticals, flavonoids, isothiocyanates, phenols, plant sterols and stanols (phytosterols and phytostanols); polyols; prebiotics, probiotics; phytoestrogens; soy protein; sulfides/thiols; amino acids; proteins; vitamins; and minerals. Functional ingredients also may be classified based on their health benefits, such as cardiovascular, cholesterol-reducing, and anti-inflammatory. Exemplary functional ingredients are provided in WO2013/096420, the contents of which is hereby incorporated by reference.
[0116] Highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E obtained according to this invention may be applied as a high intensity sweetener to produce zero calorie, reduced calorie or diabetic beverages and food products with improved taste characteristics. It may also be used in drinks, foodstuffs, pharmaceuticals, and other products in which sugar cannot be used. In addition, highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E can be used as a sweetener not only for drinks, foodstuffs, and other products dedicated for human consumption, but also in animal feed and fodder with improved characteristics.
[0117] Examples of consumable products in which highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E may be used as a sweetening compound include, but are not limited to, alcoholic beverages such as vodka, wine, beer, liquor, and sake, etc.; natural juices; refreshing drinks; carbonated soft drinks; diet drinks; zero calorie drinks; reduced calorie drinks and foods; yogurt drinks; instant juices; instant coffee; powdered types of instant beverages; canned products; syrups; fermented soybean paste; soy sauce; vinegar; dressings; mayonnaise; ketchups; curry; soup; instant bouillon; powdered soy sauce; powdered vinegar; types of biscuits; rice biscuit; crackers; bread; chocolates; caramel; candy; chewing gum; jelly; pudding; preserved fruits and vegetables; fresh cream; jam; marmalade; flower paste; powdered milk; ice cream; sorbet; vegetables and fruits packed in bottles; canned and boiled beans; meat and foods boiled in sweetened sauce; agricultural vegetable food products; seafood; ham; sausage; fish ham; fish sausage; fish paste; deep fried fish products; dried seafood products; frozen food products; preserved seaweed; preserved meat; tobacco; medicinal products; and many others. In principle it can have unlimited applications.
[0118] During the manufacturing of products such as foodstuffs, drinks, pharmaceuticals, cosmetics, table top products, and chewing gum, the conventional methods such as mixing, kneading, dissolution, pickling, permeation, percolation, sprinkling, atomizing, infusing and other methods may be used.
[0119] Moreover, the highly purified target steviol glycoside(s), reb M, reb D, reb I and/or reb E obtained in this invention may be used in dry or liquid forms.
[0120] The highly purified target steviol glycoside can be added before or after heat treatment of food products. The amount of the highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E depends on the purpose of usage. As discussed above, it can be added alone or in combination with other compounds.
[0121] The present invention is also directed to sweetness enhancement in beverages using reb M, reb D, reb I and/or reb E. Accordingly, the present invention provides a beverage comprising a sweetener and reb M, reb D, reb I and/or reb E as a sweetness enhancer, wherein reb M, reb D, reb I and/or reb E is present in a concentration at or below their respective sweetness recognition thresholds.
[0122] As used herein, the term sweetness enhancer refers to a compound capable of enhancing or intensifying the perception of sweet taste in a composition, such as a beverage. The term sweetness enhancer is synonymous with the terms sweet taste potentiator, sweetness potentiator, sweetness amplifier, and sweetness intensifier.
[0123] The term sweetness recognition threshold concentration, as generally used herein, is the lowest known concentration of a sweet compound that is perceivable by the human sense of taste, typically around 1.0% sucrose equivalence (1.0% SE). Generally, the sweetness enhancers may enhance or potentiate the sweet taste of sweeteners without providing any noticeable sweet taste by themselves when present at or below the sweetness recognition threshold concentration of a given sweetness enhancer; however, the sweetness enhancers may themselves provide sweet taste at concentrations above their sweetness recognition threshold concentration. The sweetness recognition threshold concentration is specific for a particular enhancer and can vary based on the beverage matrix. The sweetness recognition threshold concentration can be easily determined by taste testing increasing concentrations of a given enhancer until greater than 1.0% sucrose equivalence in a given beverage matrix is detected. The concentration that provides about 1.0% sucrose equivalence is considered the sweetness recognition threshold.
[0124] In some embodiments, sweetener is present in the beverage in an amount from about 0.5% to about 12% by weight, such as, for example, about 1.0% by weight, about 1.5% by weight, about 2.0% by weight, about 2.5% by weight, about 3.0% by weight, about 3.5% by weight, about 4.0% by weight, about 4.5% by weight, about 5.0% by weight, about 5.5% by weight, about 6.0% by weight, about 6.5% by weight, about 7.0% by weight, about 7.5% by weight, about 8.0% by weight, about 8.5% by weight, about 9.0% by weight, about 9.5% by weight, about 10.0% by weight, about 10.5% by weight, about 11.0% by weight, about 11.5% by weight or about 12.0% by weight.
[0125] In a particular embodiment, the sweetener is present in the beverage in an amount from about 0.5% of about 10%, such as for example, from about 2% to about 8%, from about 3% to about 7% or from about 4% to about 6% by weight. In a particular embodiment, the sweetener is present in the beverage in an amount from about 0.5% to about 8% by weight. In another particular embodiment, the sweetener is present in the beverage in an amount from about 2% to about 8% by weight.
[0126] In one embodiment, the sweetener is a traditional caloric sweetener. Suitable sweeteners include, but are not limited to, sucrose, fructose, glucose, high fructose corn syrup and high fructose starch syrup.
[0127] In another embodiment, the sweetener is erythritol.
[0128] In still another embodiment, the sweetener is a rare sugar. Suitable rare sugars include, but are not limited to, D-allose, D-psicose, L-ribose, D-tagatose, L-glucose, L-fucose, L-arbinose, D-turanose, D-leucrose and combinations thereof.
[0129] It is contemplated that a sweetener can be used alone, or in combination with other sweeteners.
[0130] In one embodiment, the rare sugar is D-allose. In a more particular embodiment, D-allose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0131] In another embodiment, the rare sugar is D-psicose. In a more particular embodiment, D-psicose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0132] In still another embodiment, the rare sugar is D-ribose. In a more particular embodiment, D-ribose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0133] In yet another embodiment, the rare sugar is D-tagatose. In a more particular embodiment, D-tagatose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0134] In a further embodiment, the rare sugar is L-glucose. In a more particular embodiment, L-glucose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0135] In one embodiment, the rare sugar is L-fucose. In a more particular embodiment, L-fucose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0136] In another embodiment, the rare sugar is L-arabinose. In a more particular embodiment, L-arabinose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0137] In yet another embodiment, the rare sugar is D-turanose. In a more particular embodiment, D-turanose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0138] In yet another embodiment, the rare sugar is D-leucrose. In a more particular embodiment, D-leucrose is present in the beverage in an amount of about 0.5% to about 10% by weight, such as, for example, from about 2% to about 8%.
[0139] The addition of the sweetness enhancer at a concentration at or below its sweetness recognition threshold increases the detected sucrose equivalence of the beverage comprising the sweetener and the sweetness enhancer compared to a corresponding beverage in the absence of the sweetness enhancer. Moreover, sweetness can be increased by an amount more than the detectable sweetness of a solution containing the same concentration of the at least one sweetness enhancer in the absence of any sweetener.
[0140] Accordingly, the present invention also provides a method for enhancing the sweetness of a beverage comprising a sweetener comprising providing a beverage comprising a sweetener and adding a sweetness enhancer selected from reb M, reb D, reb and/or reb E or a combination thereof, wherein reb M, reb D, reb I and/or reb E are present in a concentration at or below their sweetness recognition thresholds.
[0141] Addition of reb M, reb D, reb I and/or reb E in a concentration at or below the sweetness recognition threshold to a beverage containing a sweetener may increase the detected sucrose equivalence from about 1.0% to about 5.0%, such as, for example, about 1.0%, about 1.5%, about 2.0%, about 2.5%, about 3.0%, about 3.5%, about 4.0%, about 4.5% or about 5.0%.
[0142] The following examples illustrate preferred embodiments of the invention for the preparation of highly purified target steviol glycoside(s), particularly, reb M, reb D, reb I and/or reb E. It will be understood that the invention is not limited to the materials, proportions, conditions and procedures set forth in the examples, which are only illustrative.
Example 1
Protein Sequences of Engineered Enzymes Used in the Biocatalytic Process
[0143]
TABLE-US-00004 SEQID1: >SuSy_At,variantPM1-54-2-E05(engineeredsucrose synthase;sourceofWTgene:Arabidopsisthaliana) MANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQII AEFEALPEQTRKKLEGGPFFDLLKSTQEAIVLPPWVALAVRPRPGVWEYL RVNLHALVVEELQPAEFLHFKEELVDGVKNGNFTLELDFEPFNASIPRPT LHKYIGNGVDFLNRHLSAKLFHDKESLLPLLDFLRLHSHQGKNLMLSEKI QNLNTLQHTLRKAEEYLAELKSETLYEEFEAKFEEIGLERGWGDNAERVL DMIRLLLDLLEAPDPSTLETFLGRVPMVFNVVILSPHGYFAQDNVLGYPD TGGQVVYILDQVRALEIEMLQRIKQQGLNIKPRILILTRLLPDAVGTTCG ERLERVYDSEYCDILRVPFRTEKGIVRKWISRFEVWPYLETYTEDAAVEL SKELNGKPDLIIGNYSDGNLVASLLAHKLGVTQCTIAHALEKTKYPDSDI YWKKLDDKYHFSCQFTADIFAMNHTDFIITSTFQEIAGSKETVGQYESHT AFTLPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYTEEKRRLTKFHSEI EELLYSDVENDEHLCVLKDKKKPILFTMARLDRVKNLSGLVEWYGKNTRL RELVNLVVVGGDRRKESKDNEEKAEMKKMYDLIEEYKLNGQFRWISSQMD RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPA EIIVHGKSGFHIDPYHGDQAADLLADFFTKCKEDPSHWDEISKGGLQRIE EKYTWQIYSQRLLTLTGVYGFWKHVSNLDRLEHRRYLEMFYALKYRPLAQ AVPLAQDD SEQID2: >UGTS1-0234(engineeredglycosyltransferase; UGTSL2;sourceofWTgene:Solanumlycopersicum) MATNLRVLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTRINLESIIKK IPEKYADSIHLIELQLPELPELPPHYHTTNGLPPHLNPTLHKALKMSKPN FSRILQNLKPDLLIYDVLQPWAEHVANEQGIPAGKLLVSCAAVFSYFFSF RKNPGVEFPFPAIHLPEVEKVKIREILAKEPEEGGRLDEGNKQMMLMCTS RTIEAKYIDYCTELCNWKVVPVGPPFQDLITNDADNKELIDWLGTKPENS TVFVSFGSEYFLSKEDMEEIAFALEASNVNFIWVVRFPKGEERNLEDALP EGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESIDFGVP IIAMPIHNDQPINAKLMVELGVAVEIVRDDDGKIHRGEIAEALKSVVTGE TGEILRAKVREISKNLKSIRDEEMDAVAEELIQLCRNSNKSK SEQID3: >UGTSr-0042(engineeredglycosyltransferase; UGT76G1;sourceofWTgene:Steviarebaudiana) MENKTETTVRRRRRIILFPVPFQGHINPILQLANVLYSKGFAITILHTNF NKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLAGMRIPIINEHGADE LRRELELLMLASEEDEEVSCLITDALWYFAQDVADSLNLRRLVLMTSSLE NFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLKVKDIKSAYSNWQIG KEILGKMIKQTKASSGVIWNSFKELEESELETVIREIPAPSFLIPLPKHL TASSSSLLDHDRTVFEWLDQQAPSSVLYVSFGSTSEVDEKDFLEIARGLV DSGQSFLWVVRPGFVKGSTWVEPLPDGFLGERGKIVKWVPQQEVLAHPAI GAFWTHSGWNSTLESVCEGVPMIFSSFGGDQPLNARYMSDVLRVGVYLEN GWERGEVVNAIRRVMVDEEGEYIRQNARVLKQKADVSLMKGGSSYESLES LVSYISSL
Example 2
Expression and Formulation of SuSy_At Variant of SEQ ID 1
[0144] The gene coding for the SuSy_At variant of SEQ ID 1 (EXAMPLE 1) was cloned into the expression vector pLE1A17 (derivative of pRSF-1b, Novagen). The resulting plasmid was used for transformation of E. coli BL21(DE3) cells.
[0145] Cells were cultivated in ZYM505 medium (F. William Studier, Protein Expression and Purification 41 (2005) 207-234) supplemented with kanamycin (50 mg/I) at 37 C. Expression of the genes was induced at logarithmic phase by IPTG (0.2 mM) and carried out at 30 C. and 200 rpm for 16-18 hours.
[0146] Cells were harvested by centrifugation (3220g, 20 min, 4 C.) and re-suspended to an optical density of 200 (measured at 600 nm (OD.sub.600)) with cell lysis buffer (100 mM Tris-HCl pH 7.0; 2 mM MgCl.sub.2, DNA nuclease 20 U/mL, lysozyme 0.5 mg/mL). Cells were then disrupted by sonication and crude extracts were separated from cell debris by centrifugation (18000g 40 min, 4 C.). The supernatant was sterilized by filtration through a 0.2 m filter and diluted 50:50 with distilled water, resulting in an enzymatic active preparation.
[0147] For enzymatic active preparations of SuSy_At, activity in Units is defined as follows: 1 mU of SuSy turns over 1 nmol of sucrose into fructose in 1 minute. Reaction conditions for the assay are 30 C., 50 mM potassium phosphate buffer pH 7.0, 400 mM sucrose at to, 3 mM MgCl.sub.2, and 15 mM uridin diphosphate (UDP).
Example 3
Expression and Formulation of UGTSl Variant of SEQ ID 2
[0148] The gene coding for the UGTSl variant of SEQ ID 2 (EXAMPLE 1) was cloned into the expression vector pLE1A17 (derivative of pRSF-1b, Novagen). The resulting plasmid was used for transformation of E. coli BL21(DE3) cells.
[0149] Cells were cultivated in ZYM505 medium (F. William Studier, Protein Expression and Purification 41 (2005) 207-234) supplemented with kanamycin (50 mg/1) at 37 C. Expression of the genes was induced at logarithmic phase by IPTG (0.1 mM) and carried out at 30 C. and 200 rpm for 16-18 hours.
[0150] Cells were harvested by centrifugation (3220g, 20 min, 4 C.) and re-suspended to an optical density of 200 (measured at 600 nm (OD.sub.600)) with cell lysis buffer (100 mM Tris-HCl pH 7.0; 2 mM MgCl.sub.2, DNA nuclease 20 U/mL, lysozyme 0.5 mg/mL). Cells were then disrupted by sonication and crude extracts were separated from cell debris by centrifugation (18000g 40 min, 4 C.). The supernatant was sterilized by filtration through a 0.2 m filter and diluted 50:50 with 1 M sucrose solution, resulting in an enzymatic active preparation.
[0151] For enzymatic active preparations of UGTSl, activity in Units is defined as follows: 1 mU of UGTSl turns over 1 nmol of rebaudioside A (RebA) into rebaudioside D (RebD) in 1 minute. Reaction conditions for the assay are 30 C., 50 mM potassium phosphate buffer pH 7.0, 10 mM RebA at t.sub.0, 500 mM sucrose, 3 mM MgCl.sub.2, 0.25 mM uridin diphosphate (UDP) and 3 U/mL of SuSy_At.
Example 4
Expression and Formulation of UGTSr Variant of SEQ ID 3
[0152] The gene coding for the UGTSr variant of SEQ ID 3 (EXAMPLE 1) was cloned into the expression vector pLE1A17 (derivative of pRSF-1b, Novagen). The resulting plasmid was used for transformation of E. coli BL21(DE3) cells.
[0153] Cells were cultivated in ZYM505 medium (F. William Studier, Protein Expression and Purification 41 (2005) 207-234) supplemented with kanamycin (50 mg/I) at 37 C. Expression of the genes was induced at logarithmic phase by IPTG (0.1 mM) and carried out at 30 C. and 200 rpm for 16-18 hours.
[0154] Cells were harvested by centrifugation (3220g, 20 min, 4 C.) and re-suspended to an optical density of 200 (measured at 600 nm (OD.sub.600)) with cell lysis buffer (100 mM Tris-HCl pH 7.0; 2 mM MgCl.sub.2, DNA nuclease 20 U/mL, lysozyme 0.5 mg/mL). Cells were then disrupted by sonication and crude extracts were separated from cell debris by centrifugation (18000g 40 min, 4 C.). The supernatant was sterilized by filtration through a 0.2 m filter and diluted 50:50 with 1 M sucrose solution, resulting in an enzymatic active preparation.
[0155] For enzymatic active preparations of UGTSr, activity in Units is defined as follows: 1 mU of UGTSr turns over 1 nmol of rebaudioside A (RebA) into rebaudioside I (RebI) in 1 minute. Reaction conditions for the assay are 30 C., 50 mM potassium phosphate buffer pH 7.0, 10 mM RebA at t.sub.0, 500 mM sucrose, 3 mM MgCl.sub.2, 0.25 mM uridin diphosphate (UDP) and 3 U/mL of SuSy_At.
Example 5
Synthesis of Rebaudioside M in a One-Pot Reaction, Adding UGTSl, SuSy_At and UGTSr at the Same Time
[0156] Rebaudioside M (RebM) was synthesized directly from rebaudioside A (RebA) in a one-pot reaction, utilizing the three enzymes (see EXAMPLES 1, 2, 3 and 4): UGTSl (variant of SEQ ID 2), SuSy_At-(variant of SEQ ID 1) and UGTSr (variant of SEQ ID 3). The final reaction solution contained 20 mU/mL UGTSl, 160 mU/mL SuSy_At, 10 mU/mL UGTSr, 25 mM rebaudioside A, 0.5 mM uridin diphosphate (UDP), 1 M sucrose, 4 mM MgCl.sub.2 and 50 mM potassium phosphate buffer (buffer stock prepared at pH 7.5), prepared in distilled water to a total volume of 1.6 mL. First, 186.6 L of distilled water were mixed with 6.4 L of 1M MgCl.sub.2, 800 l of 2 M sucrose, 16.1 L of 50 mM UDP, 80 L of 1 M potassium phosphate buffer (pH 7.5) and 400 L of 100 mM rebaudioside A. To start the biotransformation, 26.4 L of 1200 mU/mL UGTSl, 10.4 l of 24600 mU/mL SuSy_At and 74.1 L of 220 mU/mL UGTSr were added. The reaction was incubated at 30 C., shaking for 70 h. The content of RebM, RebA, as well as the content of rebaudiosides D (RebD) and rebaudiosides 1 and M2 (RebI/M2) at several time points was determined by HPLC.
[0157] For analysis, biotransformation samples were inactivated by mixing 100 L of reaction solution with 10 L 1M H.sub.2SO.sub.4, and adding 90 L of 60% MeOH (in H.sub.2O). Resulting samples were diluted a further 10-fold in 30% MeOH (in H.sub.2O), centrifuged at 18g for 10 min at 4 C., and supernatants were used as samples for HPLC injection. HPLC was carried out on a Shimadzu 20A series unit equipped with two pump units, an auto sampler, and a thermostat column compartment. Mobile phases A (10 mM NaH.sub.2PO.sub.4, pH 2.6) and B (Acetonitrile, HPLC grade) were mixed on-line in different ratios at different times. Separation started with 26% B, changed to 29% B at 7 min and returned to 26% at 12.5 min run time. Total run time were 17 min. The flow rate was 0.75 mL/min. The column used was a Phenomenex Kinetex 2.6 M C18 100 A, 1504.6 mm. The column temperature was maintained at 40 C. The injection volume was 5 l Rebaudioside species were detected by UV at 210 nm.
[0158] Table 3 shows for each time point the conversion of rebA into identified rebaudioside species (percentages calculated from molarities).
TABLE-US-00005 TABLE 3 Biotransformation of RebA to RebM, (addition of UGTSl, SuSy_At and UGTSr at reaction start) % conversion from RebA time/h RebA RebD RebM RebM2 RebI unknown 0 100.0 0.0 0.0 0.00 0.0 0.0 6 69.0 6.1 12.5 0.00 9.0 3.4 22 33.5 4.2 39.4 0.02 18.8 4.1 32 21.1 3.2 49.5 0.05 21.6 4.5 47 8.3 1.8 62.3 0.06 24.7 2.9 71 1.5 0.5 66.9 0.16 25.3 5.6
Example 6
[0159] Synthesis of Rebaudioside M in a One-Pot Reaction, Adding UGTSl, SuSy_At at Reaction Start, but UGTSr Only after 22 h
[0160] Rebaudioside M (RebM) was synthesized directly from rebaudioside A (RebA) in a one-pot reaction, utilizing the three enzymes (see EXAMPLES 1, 2, 3 and 4); UGTSl (variant of SEQ ID 2), SuSy_At (variant of SEQ ID 1) and UGTSr (variant of SEQ ID 3). The final reaction solution contained 20 mU/mL UGTSl, 160 mU/mL SuSy_At, 10 mU/mL UGTSr, 25 mM rebaudioside A, 0.5 mM uridin diphosphate (UDP), 1 M sucrose, 4 mM MgCl.sub.2 and 50 mM potassium phosphate buffer (buffer stock prepared at pH 7.5), prepared in distilled water to a total volume of 1.6 mL. First, 186.6 L of distilled water were mixed with 6.4 L of 1M MgCl.sub.2, 800 L of 2 M sucrose, 16.1 L of 50 mM UDP, 80 L of 1 M potassium phosphate buffer (pH 7.5) and 400 L of 100 mM rebaudioside A. To start the biotransformation, 26.4 L of 1200 mU/mL UGTSl and 10.4 L of 24600 mU/mL SuSy_At were added. The reaction was incubated at 30 C., shaking for 22 h. Then, 74.1 L of 220 mU/mL UGTSr was added to the reaction, and the reaction was incubated at 30 C., shaking for another 49 h. The content of RebM, RebA, as well as the content of rebaudiosides D (RebD) and rebaudioside I and M2 (RebI/M2) at several time points was determined by HPLC.
[0161] For analysis, biotransformation samples were inactivated by mixing 100 L of reaction solution with 10 L 1M H.sub.2SO.sub.4, and adding 90 L of 60% MeOH (in H.sub.2O). Resulting samples were diluted a further 10-fold in 30% MeOH (in H.sub.2O), centrifuged at 18g for 10 min at 4 C., and supernatants were used as samples for HPLC injection. HPLC was carried out on a Shimadzu 20A series unit equipped with two pump units, an auto sampler, and a thermostat column compartment. Mobile phases A (10 mM NaH.sub.2PO.sub.4, pH 2.6) and B (Acetonitrile, HPLC grade) were mixed on-line in different ratios at different times. Separation started with 26% B, changed to 29% B at 7 min and returned to 26% at 12.5 min run time. Total run time were 17 min. The flow rate was 0.75 mL/min. The column used was a Phenomenex Kinetex 2.6 nm C18 100 A, 1504.6 mm. The column temperature was maintained at 40 C. The injection volume was 5 l Rebaudioside species were detected by UV at 210 nm.
[0162] Table 4 shows for each time point the conversion of RebA into identified rebaudioside species (percentages calculated from molarities).
TABLE-US-00006 TABLE 4 Biotransformation of RebA to RebM, (addition of UGTSl and SuSy_At at reaction start, addition of UGTSr after 22 h) % conversion from RebA time/h RebA RebD RebM RebM2 RebI unknown 0 100.0 0.0 0.0 0.0 0.0 0.0 6 71.7 28.4 0.0 0.03 0.0 0.1 22 25.2 65.9 0.0 0.12 0.0 8.8 32 15.8 55.9 22.6 0.20 1.3 4.3 47 9.3 32.1 54.9 0.28 2.0 1.5 71 0.9 2.2 90.6 0.36 2.6 3.4
Example 7
Construction of the Enzyme Production Microorganisms
[0163] The production strain LE1B109 is a genetically modified derivative strain of the laboratory strain E. coli K-12 W3110. The parental strain E. coli K-12 W3110 has been modified by site-directed recombination at different chromosomal loci to suit production purposes in terms of genetic stability, especially plasmid stability, and efficiency of expression and biotransformation. The expression of a number of proteases has been eliminated by deletion of the corresponding genes. Antibiotic-free selection of target clones has been enabled through deletion of one gene. One further gene has been deleted to prevent unwanted recombination effects. The gene coding for the T7 RNA polymerase from E. coli T7 phage and another gene copy of lacI, a repressor naturally present in E. coli K-12 W3110, have been inserted into the genome of W3110 to achieve a strong and regulated enzyme expression. Furthermore, the strain might carry certain deletions of endogenous enzyme genes connected to the degradation of biotransformation reactants in order to avoid side reactions. Insertions and deletions of chromosomal DNA are in general performed by integration of plasmid-based fragments carrying antibiotic resistance genes. After selection of the correct chromosomal mutants, resistance genes are excised and all plasmids are removed. No residual vector sequences or antibiotic resistance genes are left in the final cell.
[0164] The final production strain used for manufacturing each enzyme is created from the LE1B109 recipient strain by introducing an expression vector carrying the specific gene for one of the enzymes listed in Table 5. The plasmids used to transform the E. coli recipient strain are based on the well-known vector pRSF-1b (Merck KGaA, Darmstadt, Germany). The plasmids have been fully sequenced and do not carry antibiotic resistance genes or any other sequences of concern. The production strain LE1B109 has been sequenced to confirm absence of antibiotic resistance genes or any other sequences of concern.
TABLE-US-00007 TABLE 5 Enzyme Function Source Organism Sucrose synthase Catalyzes the formation of Arabidopsis UDP-glucose thaliana UDP-glucosyltrans- Catalyzes the addition of Stevia ferase UGT-Sr glucose to steviol glycosides rebaudiana UDP-glucosyltrans- Catalyzes the addition of Solanum ferase UGT-Sl glucose to steviol glycosides lycopersicum
Example 8
Synthesis of Rebaudioside M in a One-Pot Reaction
[0165] One embodiment of the manufacturing process for steviol glycosides with a high reb M content produced by enzymatic conversion of reb A is shown in
[0166] In the embodiment shown in
[0167] In stage 2 of the manufacturing process shown in
TABLE-US-00008 TABLE 6 Raw Material Technological Function Regulatory Status Glucose Fermentation Nutrient Permitted for use in food as ingredient with no limitations apart from cGMP, 21 CFR 184.1857 Isopropyl -D-1- Inducer for enzyme thiogaloctopyranoside (IPTG) expression Defined mineral components Fermentation Nutrient Permitted for use in food as food additive, food substance, ingredient, flavor enhancer, flavoring agent, processing aid or nutrient supplement, with no limitations apart from cGMP, each being selected from 21 CFR Parts 184, 172, 573, 182, 582. Suitable antifoam agent Processing aid Listed in the FDA Sep. 11, 2003 letter to ETA as acceptable for use in enzyme manufacturing Nuclease (i.e., NuCLEANase, food- Processing aid grade)
[0168] The fermentation conditions are a pH of between 6 to 8 and a temperature of between 25 to 37 C. The fermentation process is continued until laboratory test data shows the desired enzyme production yield. Usually, after at least 15 hours, the fermentation is stopped. In a subsequent recovery process, the enzyme is isolated from the biomass. In a first solid/liquid separation, the biomass is separated from the culture broth by standard techniques (e.g., is centrifuged and/or filtered). The biomass is homogenized to disrupt the bacterial cells and treated with a nuclease (e.g., NuCLEANase, c-LEcta, Leipzig, Germany) to degrade the DNA/RNA nucleic acids released upon cell disruption. This is followed by solid/liquid separation steps to further remove cell debris and other insoluble matter. The cell-free supernatant is filtered to obtain the purified enzyme preparation. All raw materials used for fermentation and recovery are of food-grade quality or have been assessed to be fit for their intended use.
[0169] The obtained UGTSl, SuSy_At, and UGTSr enzyme preparation specifications are provided in Tables 7-9.
TABLE-US-00009 TABLE 7 UGTSl Manufacturing Lot Specification SK4- SK4- SK4- Parameter Specification 14-001 18-001 19-001 Activity 7 U/mL 9.6 12.0 9.2 Total viable count <50,000 CFU/g <100 <100 <100 Salmonella spp. Absent in 25 g Conforms Conforms Conforms E. coli Absent in 25 g Conforms Conforms Conforms Total conforms 30 CFU/g <10 <10 <10 Antimicrobial Negative Negative Negative Negative activity Lead 5 mg/kg 0.12 0.06 0.09 TOS (%) NS 10.47 13.47 11.41 CFU = colony-forming unit; NS = not specified; TOS = total organic solids; U = units [1 unit corresponds to the conversion of 1 mol reb A/minute at 30 C. and pH 7.0]
TABLE-US-00010 TABLE 8 SuSy_At Manufacturing Lot Specification PM2- PM- PM- Parameter Specification 34-001 39-001 40-001 Activity 400 U/mL 413 547 512 Total viable count <50,000 CFU/g <100 <100 <100 Salmonella spp. Absent in 25 g Conforms Conforms Conforms Escherichia coli Absent in 25 g Conforms Conforms Conforms Total coliforms 30 CFU/g <10 <10 <10 Antimicrobial Negative Negative Negative Negative activity Lead 5 mg/kg 0.11 0.14 0.11 TOS (%) NS 9.48 10.49 9.62 CFU = colony-forming unit; NS = not specified; TOS = total organic solids; U = units [1 unit corresponds to the conversion of 1 mol reb A/minute at 30 C. and pH 7.0]
TABLE-US-00011 TABLE 9 UGTSr Manufacturing Lot Specification FAH-a- FAH-a- FA113- Parameter Specification U3D1 U4D1 002 Activity 1 U/mL 1.22 1.66 2.00 Total viable count <50,000 CFU/g <100 <100 <100 Salmonella spp. Absent in 25 g Conforms Conforms Conforms Escherichia coli Absent in 25 g Conforms Conforms Conforms Total coliforms 30 CFU/g <10 <10 <10 Antimicrobial Negative Negative Negative Negative activity Lead 5 mg/kg 0.08 0.07 0.08 TOS (%) NS 10.53 13.61 14.17 CFU = colony-forming unit; NS = not specified; TOS = total organic solids; U = units [1 unit corresponds to the conversion of 1 mol reb A/minute at 30 C. and pH 7.0]
[0170] In stage 3, the products of stage 1 (reb A, >95%) and stage 2 (UGTSr, UGTSl, and SuSy_At enzymes) are mixed to initiate the enzymatic conversion process. First, the reb A (>95%) powder and sucrose are dissolved in reverse-osmosis water. Next, 5-UDP-Na2 and UGTSr, UGTSl, and SuSy_At enzymes are added to formulate the reaction mixture. The reaction mixture is incubated at 40 to 50 C. for 10 to 48 hours. The use of different reaction times yields steviol glycoside mixtures with different ratios of starting glycoside reb A, intermediate glycosides such as reb D, and the primary final glycoside product reb M. The resulting reaction mixture containing a mixture of steviol glycosides, including those listed in Table 2.2-1, is heated to 80 to 100 C. and for 10 minutes to inactivate the enzymes.
[0171] In the last stage of manufacturing, the reaction mixture is treated with a flocculant (calcium hydroxide) to remove the mechanical particles, proteins, polysaccharides, and other impurities. A plate-and-frame filter press is used to separate the resulting precipitate from the filtrate, and the filtrate is deionized by ion-exchange resins in (H+) and (OH) form. The deionized filtrate is fed to a column system packed with macroporous adsorption resin that retains the reb M and other steviol glycosides. The column is washed with deionized water to remove impurities that did not adsorb to the resin and then the glycosides are desorbed using aqueous ethanol. Next, the filtrate is maintained at low temperatures for several hours to allow reb M to crystallize. The reb M crystals containing >30% reb M are separated by conventional centrifugation and dried in a rotary drum vacuum at 110 C. and 10 mbar. The obtained powder is sifted through US 80 mesh stainless steel screens and passed through metal detectors to be packed in aluminum foil bags. The bags are placed in high-density polyethylene drums sealed with tamper evident seals.
Example 9
[0172] Product Specifications for Steviol Glycosides with a High Reb M Content Produced by Enzymatic Conversion of Reb A
[0173] The physical and chemical specifications for certain embodiments of steviol glycosides with a high reb M content produced by enzymatic conversion of reb A are based on those established by JECFA for steviol glycosides following their 82nd meeting (JECFA, 2016a). The physical and chemical specifications for steviol glycosides with a high reb M content produced by enzymatic conversion are presented in Table 10. All analytical methods used to measure each specification parameter are internationally-recognized methods (e.g., United States Pharmacopeia [USP], Association of Official Analytical Chemists [AOAC], or JECFA). Total steviol glycoside content is measured using the high-performance liquid chromatography (HPLC) method described in the most recent JECFA specification monograph for steviol glycosides from S. rebaudiana Bertoni (JECFA, 2016a).
TABLE-US-00012 TABLE 10 Current JECFA specifications for steviol Steviol glycosides with a glycosides Specification Parameter high reb M content (JECFA, 2016a) Method of analysis Appearance White to off-white powder White to light yellow Sensory Evaluation powder Total steviol glycosides 95% 95% total steviol HPLC (JECFA, 2016a) (anhydrous basis) glycosides.sup.a Loss on drying 6.0% 6% (105, 2 h) FAO/JECFA Vol 4.sup.b (p. 61) pH (1% solution) 4.5 to 7.0 4.5 to 7.0 FAO/JECFA Vol 4 (p. 36-38) Residual ethanol <0.30% 0.5% USP.sup.c Method 467 Residual methanol <0.02% <0.02% USP Method 467 Total ash <1.0% 1% AOAC.sup.d Method 945.46 Lead (as Pb) <1.0 ppm 1 ppm AOAC Method 993.14 Arsenic (as As) <1.0 ppm 1 ppm AOAC Method 993.14 Cadmium (as Cd) <1.0 ppm NS AOAC Method 993.14 Mercury (as Hg) <1.0 ppm NS AOAC Method 993.14 Residual protein Not detected NA SDS-PAGE Residual DNA Not detected NA PCR.sup.e FCC = Food Chemicals Codex; HPLC = high performance liquid chromatography; NA = not applicable; NS = not specified; PCR = polymerase chain reaction; SDS-PAGE = sodium dodecyl sulfate polyacrylamide gel electrophoresis; USP = United States Pharmacopeia .sup.aWhere steviol glycosides consists of a mixture of compounds containing a steviol backbone conjugated to any number or combination of the principal sugar moieties in any of the orientations occurring in the leaves of Stevia rebaudiana Bertoni including, glucose, rhamnose, xylose, fructose, deoxyglucose, galactose, and arabinose. (JECFA, 2016a, 2017). .sup.bFAO/JECFA (2006). Combined Compendium of Food Additive Specifications [Online Edition], General Specifications for Enzymes Analytical Methods, Volume 4: Analytical Methods, Test Procedures and Laboratory Solutions Used by and Referenced in the Food Specifications. 1st to 65th JECFA Meetings, 1956-2005. (FAO JECFA Monographs 1). Rome, Italy: Food and Agriculture Organization of the United Nations (FAO), Joint FAO/WHO Expert Committee on Food Additives (JECFA). Available at: ftp://ftp.fao.org/docrep/fao/009/a0675e/a0675e00.pdf [Last updated (Web version): August 2011]. .sup.cUSP (2012). United States Pharmacopeia, 35th edition & National Formulary, 30th edition [Online], Rockville (MD): U.S. Pharmacopeia (USP) Convention Inc. Available at: http://www.uspnf.com/[Subscription Only]. .sup.dAOAC (2005). Official Methods of Analysis of the Association of Official Analytical Chemists: Vols. 1&2, 18th edition (Current through Revision 1, 2006). Arlington (VA): Association of Official Analytical Chemists (AOAC). .sup.eMethod described in Section 3.5.4
[0174] The microbiological specification parameters listed in Table 11 have been established for steviol glycosides with a high reb M content produced by enzymatic conversion of reb A to ensure safe use in food and standard microbial tests appropriate for food ingredients are employed.
TABLE-US-00013 TABLE 11 Specification Parameter Specification Method of Analysis Total plate count <1,000 CFU/g AOAC.sup.a Method 966.23 Yeast and mold (CFU/g) Not detected Standards Australia.sup.b Method 1766.2.2 Total conforms (MPN/g) Not detected ISO 4831.sup.c Escherichia coli Not detected ISO 7251.sup.d count (MPN/g) Salmonella sp. Absent in 25 g ISO 6579.sup.e CFU = colony forming units; MPN = most probable number .sup.aAOAC (2005). Official Methods of Analysis of the Association of Official Analytical Chemists: Vols. 1&2, 18th edition (Current through Revision 1, 2006). Arlington (VA): Association of Official Analytical Chemists (AOAC). .sup.bStandards Australia (1997). Food microbiology. Method 2.2: Examination for specific organisms-Colony count of yeasts and moulds. (Australian/New Zealand Standard AS 1766.2.2). Sydney, Australia: Standards Association of Australia/SAI Global. .sup.cBSi (1991). Methods for Microbiological examination of food and animal feeding stuffs - Part 3: Enumeration of coliforms - Most probable number technique. (British Standard (BS)/International Organization for Standardization (ISO), BS 5763-3:1991 ISO 4831:1991). London, Engl.: British Standards Institution (BSi). .sup.dBSi (1993). Methods for Microbiological examination of food and animal feeding stuffs - Part 8: Enumeration of presumptive Escherichia coli. Most probable number technique. (British Standard (BS)/International Organization for Standardization (ISO), BS 5763-8:1994 ISO 7251:1993). London, Engl.: British Standards Institution (BSi). .sup.eBSi (2012). Microbiology of Food and Animal Feed. Horizontal Method for the Detection, Enumeration and Serotyping of Salmonella. Enumeration by a miniaturized most probable number technique. (PD CEN ISO/TS 6579-2:2012). London, Engl.: British Standards Institution (BSi). Information available at: http://shop.bsigroup.com/en/ProductDetail/?pid=000000000030255346.
Example 10
[0175] Product Analysis of Steviol Glycosides with a High Reb M Content Produced by Enzymatic Conversion of Reb A
[0176] Physical and chemical analyses of 3 non-consecutive lots of steviol glycosides with a high reb M content produced by enzymatic conversion of reb A demonstrate that the manufacturing process, as described in Section 3.4.1, produces a consistent product that conforms to the defined specification parameters. The results of the batch analyses for the 3 production lots are summarized in Table 12.
TABLE-US-00014 TABLE 12 Specification Manufacturing Lot Parameter Limit BM050517 SK-B-U2D1 SK-B-U3D1 Appearance White to off-white powder Conforms Conforms Conforms Total steviol glycosides 95% 98.88% 97.91% 97.20% (anhydrous basis) Loss on drying 6.0% 1.64% 1.64% 3.85% pH (1% solution) 4.5 to 7.0 6.32 5.99 5.89 Residual ethanol <0.30% 0.041% 0.134% 0.133% Residual methanol <0.02% ND 0.001% 0.001% Total ash <1.0% 0.05% <0.005% 0.02 Lead (as Pb) <1.0 ppm 0.021 ppm 0.035 ppm 0.038 ppm Arsenic (as As) <1.0 ppm <0.005 ppm <0.005 ppm <0.005 ppm Cadmium (as Cd) <1.0 ppm <0.005 ppm <0.005 ppm <0.005 ppm Mercury (as Hg) <1.0 ppm <0.005 ppm <0.005 ppm <0.005 ppm Residual protein Not detected ND ND ND Residual DNA Not detected ND ND ND ND = not detected; ppm = parts-per-million
[0177] Microbial analyses of 3 non-consecutive lots of steviol glycosides with a high reb M content produced by enzymatic conversion of reb A demonstrate that the microbiological specifications outlined in Example 9 are consistently met. A summary of the microbiological analyses is presented in Table 13.
TABLE-US-00015 TABLE 13 Specification Manufacturing Lot Parameter Limit BM050517 SK-B-U2D1 SK-B-U3D1 Total plate count <1,000 CFU/g ND ND ND Yeast and mold (CFU/g) Not detected ND ND ND Total coliforms (MPN/g) Not detected ND ND ND Escherichia coli count Not detected ND ND ND (MPN/g) Salmonella sp. Absent in 25 g Absent Absent Absent CFU = colony forming units; MPN = most probable number; ND = not detected
The distribution of steviol glycosides in the final product is dependent upon the length of reaction time of the enzymes with starting material reb A extracted from the leaves of S. rebaudiana. Example data from 2 production lots (SK BU2D1, SK-BU3D1) presented in Table 13 demonstrates that as the enzyme reaction time proceeds from 10 to 40 hours the steviol glycoside distribution changes, with increasing amounts of reb M being produced as the reaction proceeds. Example intermediate glycosides include rebaudiosides D and I, as reported in Table 14.
TABLE-US-00016 TABLE 14 Steviol Time (hours) Glycoside (%) 0 14 16 18 21 40 Lot SK-BU2D1 Rebaudioside A 100 30.4 25.6 NM 14.2 2.1 Rebaudioside D ND 69.2 74.1 NM 43.6 1.7 Rebaudioside I ND 0 0.1 NM 3.4 6.6 Rebaudioside M2 ND 0.38 0.12 NM 0.14 0.19 Rebaudioside M ND ND ND NM 38.6 89.4 Total Steviol 100 99.98 99.92 NA 99.94 99.99 Glycosides (%) Lot SK-BU3D1 Rebaudioside A 100 NM 28.6 21.1 9.4 1.2 Rebaudioside D ND NM 71.1 77.3 60.0 1.8 Rebaudioside I ND NM ND 0.3 3.1 4.2 Rebaudioside M2 ND NM 0.28 0.35 0.34 0.37 Rebaudioside M ND NM ND 0.9 27.1 92.5 Total Steviol 100 NA 99.98 99.95 99.94 100.1 Glycosides (%) NA = not applicable; ND = not detected; NM = not measured
[0178] Pursuant to the defined product specifications in Table 9 for steviol glycosides with a high reb M content produced by enzymatic conversion of reb A, the final product contains 95% steviol glycosides, comprised of >30% reb M and other steviol glycosides such as those listed in Table 15. The steviol glycoside distribution, measured by HPLC, is provided for 3 non-consecutive lots of final product manufactured with a 40-hour enzyme reaction time is shown in Table 16 and demonstrates that the manufacturing process produces a product with a consistent steviol glycoside distribution and that the total steviol glycosides measured is consistently 95%.
TABLE-US-00017 TABLE 15 Common name Trivial formula Mol. Wt. R.sub.1 R.sub.2 Rebaudioside A SvG4 967 Glc1- Glc(1-2)[Glc(1-3)]Glc1- Rebaudioside D SvG5 1,129 Glc(1-2)Glc1- Glc(1-2)[Glc(1-3)]Glc1- Rebaudioside I SvG5 1,129 Glc(1-3)Glc1- Glc(1-2)[Glc(1-3)]Glc1- Rebaudioside M SvG6 1,291 Glc(1-2)[Glc (1-3)]Glc1- Glc(1-2)[Glc(1-3)]Glc1- Rebaudioside M2 SvG6 1,291 Glc(1-2)[Glc (1-6)]Glc1- Glc(1-2)[Glc(1-3)]Glc1-
TABLE-US-00018 TABLE 16 Steviol Manufacturing Lot Glycoside (%) BM050517 SK-BU2D1 SK-BU3D1 Average Rebaudioside D 1.78.sup.a 0.23 0.41 0.81 Rebaudioside M 95.98 95.71 95.43 95.71 Rebaudioside I 0.91 1.54 0.93 1.13 Rebaudioside A 0.09 0.28 0.12 0.16 Total Steviol 98.76 97.76 96.89 97.80 Glycosides (%) .sup.aAverage of 3 duplicates is reported
[0179] To confirm the success of the purification techniques and confirm the absence of proteins in steviol glycosides with a high reb M content produced by enzymatic conversion of reb A, the final product is analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE). Samples of steviol glycosides with a high reb M content are dissolved to a concentration of 1,000 ppm, and about 10 L from each dissolved sample is stained with 3 protein loading dye and loaded onto a precast polyacrylamide gel (10% Mini-PROTEAN TGX Precast Protein Gels, BIORAD). Electrophoresis is conducted at 60 minutes at 130 V and the gel is stained with 0.1% Coomassie Blue R250 in 10% acetic acid, 50% methanol, and 40% water for 1 hour. Gels are destained by soaking for 4 hours in a mixture of 10% acetic acid, 50% methanol, and 40% water. If protein is present in the sample, it will be visually detected on the gel (limit of detection=0.1 g protein). No visible protein bands were detected in any batches of final product.
[0180] To confirm the absence of residual DNA in steviol glycosides with a high reb M content produced by enzymatic conversion of reb A, a polymerase chain reaction (PCR) method was developed and primers were designed to amplify the gene of interest. Genomic DNA is extracted using a DNA extraction kit according to manufacturer's protocol. The genomic DNA is quantified using a spectrophotometer and the extracted genomic DNA is evaluated for the presence of the gene of interest. The thermal profile used is 2 minutes at 95 C. followed by 40 cycles of 10 seconds at 95 C., 30 seconds at 57 C., and 30 seconds at 72 C. Results of the PCR analysis did not detect any PCR products in any of the batches of final product (limit of detection=0.00002 ng DNA).