STING levels as a biomarker for cancer immunotherapy
11874276 · 2024-01-16
Assignee
- Dana-Farber Cancer Institute, Inc. (Boston, MA, US)
- The Brigham And Women's Hospital, Inc. (Boston, MA)
Inventors
- David Barbie (Andover, MA)
- Israel Cañadas (Brookline, MA, US)
- Shunsuke Kitajima (Allston, MA, US)
- Thanh Barbie (Andover, MA, US)
Cpc classification
G01N33/57484
PHYSICS
G01N2800/52
PHYSICS
International classification
A61P35/00
HUMAN NECESSITIES
Abstract
Provided herein are Stimulator of Interferon Genes (STING) and Stimulated 3 Prime Antisense Retroviral Coding Sequences (SPARCS) genes as biomarkers for determining an effective therapy for treating cancer. Further provided are methods for treating cancer using said biomarkers.
Claims
1. A method for treating cancer in a subject comprising: (i) obtaining a biological sample obtained from the subject having cancer, wherein the cancer is lung cancer; (ii) determining the level of Stimulator of IFN Genes (STING); and (iii) administering an effective amount of a therapy to the subject when the determined level of STING in the biological sample is below a reference value, thereby treating cancer in the subject, wherein the therapy is a DNA methyltransferase inhibitor and/or an EZH2 inhibitor, wherein the DNA methyltransferase inhibitor and/or EZH2 inhibitor is GSK126, azacitidine, or decitabine.
2. The method of claim 1, wherein the biological sample is a biopsy sample.
3. The method of claim 1, wherein the level of STING is the level of STING mRNA.
4. The method of claim 1, wherein the level of STING is the level of STING protein.
5. The method of claim 1, wherein the cancer is a non-small cell lung cancer (NSCLC).
6. The method of claim 1, wherein the reference value is the level of STING calculated from a control.
7. The method of claim 6, wherein the level of STING is 50% or more below the reference value of STING calculated from the control.
8. The method of claim 7, wherein the level of STING is determined in the same tissue type as a the biological sample from a normal subject.
9. The method of claim 6, wherein the level of STING is 5% or more below the reference value of STING calculated from the control.
10. A method for increasing STING expression in lung cancer cells in a subject comprising: (i) obtaining a biological sample obtained from the subject; (ii) determining the level of Stimulator of IFN Genes (STING); and (iii) administering an effective amount of a DNA methyltransferase inhibitor and/or an EZH2 inhibitor to the subject when the determined level of STING in the biological sample is below a reference value, thereby increasing STING expression in the lung cancer cells, wherein the DNA methyltransferase inhibitor and/or EZH2 inhibitor is GSK126, azacitidine, or decitabine.
11. The method of claim 10, wherein the biological sample is a biopsy sample.
12. The method of claim 10, wherein the level of STING is the level of STING mRNA.
13. The method of claim 10, wherein the level of STING is the level of STING protein.
14. The method of claim 10, wherein the cancer is a non-small cell lung cancer (NSCLC).
15. The method of claim 10, wherein the reference value is the level of STING calculated from a control.
16. The method of claim 15, wherein the level of STING is 50% or more below the reference value of STING calculated from the control.
17. The method of claim 15, wherein the level of STING is 5% or more below the reference value of STING calculated from the control.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1) The accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral. For purposes of clarity, not every component may be labeled in every drawing. In the drawings:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
DETAILED DESCRIPTION OF INVENTION
(25) The present disclosure is based on the surprising discovery that the level of STING and/or one or more SPARCS genes can be used as a biomarker to determine an effective cancer therapy. Certain cancer cells, e.g., certain tumor cells, possess high levels of STING and that said cancer cells are susceptible to treatment with STING agonists. STING (Stimulator of interferon genes), encoded by TMEM173, has emerged as a critical regulator of the innate immune response to cytoplasmic double stranded DNA (dsDNA), and has been recognized to play an increasingly important role in cancer pathogenesis and cancer immunotherapy. STING agonists, which, in some embodiments, are analogues of the specific cyclic dinucleotide (CDN) that directly activates STING in response to cytoplasmic dsDNA, have entered the clinic in phase 1 trials both alone and in combination with immune checkpoint blockade.
(26) Surprisingly, it has been demonstrated herein that STING levels are tightly regulated in cancer cells, and that specific cell states are associated with STING upregulation or lack thereof. Furthermore, it has been discovered that the genomic locus encoding STING (TMEM173) is epigenetically regulated, and that STING expression can be induced by DNMT and EZH2 inhibition. These findings suggest that STING agonists would be most effectively deployed in specific tumor contexts with high STING levels, and that treatment with specific epigenetic inhibitors are likely to induce STING and promote sensitivity in tumors with otherwise low STING levels. Moreover, it has been found that elevated levels of STING are associated with elevated levels of one or more SPARCS genes. Accordingly, presented herein are methods for treating cancer having elevated levels of one or more SPARCS genes with STING agonists.
(27) Elevated STING levels and/or elevated levels of one or more SPARCS genes have surprisingly been found to be associated with elevated levels of immune checkpoint proteins, e.g., PD-L1. Accordingly, presented herein are methods for treating cancer having elevated STING levels and/or elevated levels of one or more SPARCS genes with an Immune Checkpoint Blockade (ICB) agent.
(28) Elevated STING levels and/or elevated levels of one or more SPARCS genes have surprisingly been found to be associated with elevated levels of interferon gamma. Accordingly, presented herein are methods for treating cancer having elevated STING levels and/or elevated levels of one or more SPARCS genes with an interferon gamma signaling agonist.
(29) Moreover, it has been surprisingly found that expression of STING and/or expression of one or more SPARCS genes is inhibited by DNA methyltransferase and/or PRC2, e.g., EZH2. Accordingly, presented herein are methods for treating cancer cells having low levels of STING and/or low levels of one or more SPARCS genes with at least one of a DNA methyltransferase inhibitor and an EZH2 inhibitor and, optionally, one or more of (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and (iii) an interferon gamma signaling agonist.
(30) STING Biomarker
(31) Stimulator of interferon genes (STING) is a ubiquitously produced transmembrane protein encoded by the TMEM173 gene. The longest isoform of STING has 379 amino acids. STING plays a key role as a mediator of innate immune signaling. It induces the innate immune signaling in response to the detection of bacterial and viral DNA in the cytoplasm, and promotes the production of type I interferon (IFN-alpha and IFN-beta). Multiple studies have involved STING in the development of conditions including infectious diseases and certain cancers.
(32) The STING amino acid sequence is:
(33) TABLE-US-00001 (SEQIDNO:1) MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLH LASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLL LSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEK GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYI LLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLEN GQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSA VPSTSTMSQEPELLISGMEKPLPLRTDFS
The STING amino acid sequence has GenBank Accession Number NP_938023.1. The STING nucleotide sequence has GenBank Accession Number NM_198282.3.
(34) In some embodiments, STING is upregulated (or is elevated, as the terms are used interchangeably) in a biological sample relative to controls. As used herein, an upregulated or elevated level includes a level that is above a control level or reference value as defined herein. An upregulated or elevated level may be, for example, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more above a control level or reference value as defined herein.
(35) In some embodiments, a cancer, e.g., a tumor or cancer cell, with upregulated STING levels is susceptible to (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and/or (iii) an interferon gamma signaling agonist.
(36) In some embodiments, STING is downregulated in a biological sample (or is reduced, as the terms are used interchangeably) relative to controls. As used herein, an downregulated or reduced level includes a level that is below a control level or reference value as defined herein. An downregulated or reduced level may be, for example, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more below a control level or reference value as defined herein. In some embodiments, STING levels are unchanged relative to controls.
(37) In some embodiments, a cancer, e.g., a tumor or cancer cell, with downregulated or unchanged STING levels is susceptible to one or more of a DNA methyltransferase inhibitor and an EZH2 inhibitor, and optionally (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and/or (iii) an interferon gamma signaling agonist.
(38) In some embodiments, a level of mRNA is upregulated. In some embodiments, a protein level is upregulated.
(39) SPARCS Biomarkers
(40) As is described in Example 1, Stimulated 3 Prime Antisense Retroviral Coding Sequences (SPARCS) genes were identified as genes upregulated in cancer cells having undergone the epithelial-mesenchymal transition and having an endogenous retrovirus in the 3 UTR. These genes are interferon-inducible genes silenced by EZH2.
(41) In some embodiments, one or more SPARCS genes are selected from TRIM22, TRIM38, IL32, SPATS2L, EPHA3, HERC3, ADAM19, SERPINB9, IFI44L, F3, BEND6, AIG1, MSRB2, TNFRSF9, and ANTXR1. The GenBank Accession Nos. for the SPARCS genes are shown in Table 1 and Table 2.
(42) In some embodiments, one or more SPARCS genes are upregulated in a biological sample (or is elevated, as the terms are used interchangeably) relative to controls. As used herein, an upregulated or elevated level includes a level that is above a control level or reference value as defined herein. An upregulated or elevated level may be, for example, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more above a control level or reference value as defined herein.
(43) In some embodiments, the level of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 SPARCS genes is upregulated. In some embodiments, the level of all 15 SPARCS genes is upregulated.
(44) In some embodiments, a cancer, e.g., a tumor or cancer cell, with upregulated SPARCS gene levels is susceptible to (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and/or (iii) an interferon gamma signaling agonist.
(45) In some embodiments, one or more SPARCS genes are downregulated in a biological sample (or is reduced, as the terms are used interchangeably) relative to controls. As used herein, an downregulated or reduced level includes a level that is below a control level or reference value as defined herein. An downregulated or reduced level may be, for example, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 300%, 400%, 500% or more below a control level or reference value as defined herein.
(46) In some embodiments, the level of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 SPARCS genes is downregulated. In some embodiments, the level of all 15 SPARCS genes is downregulated.
(47) In some embodiments, one or more SPARCS genes are unchanged relative to controls.
(48) In some embodiments, a cancer, e.g., a tumor or cancer cell, with downregulated or unchanged SPARCS gene levels is susceptible to one or more of a DNA methyltransferase inhibitor and an EZH2 inhibitor, and optionally (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and/or (iii) an interferon gamma signaling agonist.
(49) In some embodiments, a level of mRNA is upregulated. In some embodiments, a protein level is upregulated.
(50) TABLE-US-00002 TABLE 1 GenBank Accession Numbers for Protein Sequences Biomarker GenBank Accession Number TRIM 22 NP_006065.2 TRIM38 NP_006346.1 IL32 NP_001295007.1 SPATS2L NP_001093892.1 EPHA3 NP_005224.2 HERC3 NP_055421.1 ADAM19 NP_150377.1 SERPINB9 NP_004146.1 IFI44L NP_006811.2 F3 NP_006811.2 BEND6 NP_689944.2 AIG1 NP_057192.2 MSRB2 NP_036360.3 TNFRSF9 NP_066961.2 ANTXR1 NP_115584.1
(51) TABLE-US-00003 TABLE 2 GenBank Accession Numbers for Nucleotide Sequences Biomarker GenBank Accession Number TRIM 22 NM_006074.4 TRIM38 NM_006355.4 IL32 NM_001308078.1 SPATS2L NM_001100422.1 EPHA3 NM_005233.5 HERC3 NM_014606.2 ADAM19 NM_033274.4 SERPINB9 NM_004155.5 IFI44L NM_006820.3 F3 NM_006820.3 BEND6 NM_152731.2 AIG1 NM_016108.3 MSRB2 NM_012228.3 TNFRSF9 NM_021138.3 ANTXR1 NM_032208.2
(52) Detection Methods
(53) The methods and devices of the invention may be protein or mRNA based. Examples of protein-based assays include immunoassays (also referred to herein as immune-based assays), immunohistochemistry, flow cytometry, mass spectrometry, Western blots, Western immunoblotting, multiplex bead-based assays, and assays involving aptamers (such as SOMAmer technology) and related affinity agents. Examples of mRNA-based assays include Northern analysis, quantitative RT-PCR, microarray hybridization, and multiplex bead-based assays. These assays generally and commonly detect and measure the level of the biomarker of interest. The level of the biomarker may then be compared to a control level. Control levels will be discussed in greater detail herein.
(54) mRNA Detection
(55) The art is familiar with various methods for analyzing mRNA levels. An exemplary quantitative RT-PCR assay may be carried out as follows: mRNA is extracted from cells in a biological sample (e.g., tumor cells) using the RNeasy kit (Qiagen). Total mRNA is used for subsequent reverse transcription using the SuperScript III First-Strand Synthesis SuperMix (Invitrogen) or the SuperScript VILO cDNA synthesis kit (Invitrogen). The RT reaction is used for quantitative PCR using SYBR Green PCR Master Mix and gene-specific primers, in triplicate, using an ABI 7300 Real Time PCR System.
(56) Expression profiles of cells in a biological sample (e.g., tumor cells) can be carried out using an oligonucleotide microarray analysis. It is to be understood that such arrays may however also comprise positive and/or negative control markers such as housekeeping genes that can be used to determine if the array has been degraded and/or if the sample has been contaminated. The art is familiar with the construction of oligonucleotide arrays. See for example GeneChip Human Genome U133 Plus 2.0 Affymetrix expression array (Affymetrix). Other mRNA detection methods include multiplex detection assays well known in the art, e.g., xMAP bead capture and detection (Luminex Corp., Austin, TX), and various oligonucleotide array assays (Illumina).
(57) Subject. Subject means a mammal, such as a human, a nonhuman primate, a dog, a cat, a sheep, a horse, a cow, a pig or a goat. In an important embodiment, the mammal is a human. The subject as used herein can be an adult subject or a pediatric subject. In some embodiments, the subject has or is suspected of having cancer, e.g., any of the cancers described herein. In some embodiments, the subject is at elevated risk of developing cancer, for example, due to the presence of carcinogenic genetic mutations or exposure to carcinogens or radiation.
(58) Biological sample. A biological sample from a subject can include any cellular, tissue, bone marrow, or blood sample from the subject. Any type of biological sample appropriate for conducting assays described herein can be compatible with aspects of the invention, as would be understood by one of ordinary skill in the art. In some embodiments, the biological sample is tumor tissue or a biopsy sample.
(59) mRNA Detection Binding Partners
(60) mRNA detection binding partners include oligonucleotide or modified oligonucleotide (e.g. locked nucleic acid) probes that hybridize to a target mRNA. Probes may be designed against one or more of STING, TRIM22, TRIM38, IL32, SPATS2L, EPHA3, HERC3, ADAM19, SERPINB9, IFI44L, F3, BEND6, AIG1, MSRB2, TNFRSF9, and ANTXR1 or using the GenBank Accession Nos. in Table 1. Methods for designing and producing oligonucleotide probes are well known in the art (see, e.g., U.S. Pat. No. 8,036,835; Rimour et al. GoArrays: highly dynamic and efficient microarray probe design. Bioinformatics (2005) 21 (7): 1094-1103; and Wernersson et al. Probe selection for DNA microarrays using OligoWiz. Nat Protoc. 2007; 2(11):2677-91).
(61) Protein Detection
(62) The art is familiar with various methods for analyzing protein levels. An exemplary immunoassay may be carried out as follows: A biological sample is applied to a substrate having bound to its surface biomarker-specific binding partners (i.e., immobilized biomarker-specific binding partners). The biomarker-specific binding partner (which may be referred to as a capture ligand because it functions to capture and immobilize the biomarker on the substrate) may be antibodies or antigen-binding antibody fragments such as Fab, F(ab)2, Fv, single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, scFv, and dAb fragments, although they are not so limited. Other binding partners are described herein. Biomarkers present in the biological sample bind to the capture ligands, and the substrate is washed to remove unbound material. The substrate is then exposed to soluble biomarker-specific binding partners (which may be identical to the binding partners used to immobilize the biomarker). The soluble biomarker-specific binding partners are allowed to bind to their respective biomarkers immobilized on the substrate, and then unbound material is washed away. The substrate is then exposed to a detectable binding partner of the soluble biomarker-specific binding partner. In one embodiment, the soluble biomarker-specific binding partner is an antibody having some or all of its Fc domain. Its detectable binding partner may be an anti-Fc domain antibody. As will be appreciated by those in the art, if more than one biomarker is being detected, the assay may be configured so that the soluble biomarker-specific binding partners are all antibodies of the same isotype. In this way, a single detectable binding partner, such as an antibody specific for the common isotype, may be used to bind to all of the soluble biomarker-specific binding partners bound to the substrate.
(63) It is to be understood that the substrate may comprise capture ligands for one or more biomarkers, including two or more, three or more, four or more, five or more, etc. of the biomarkers provided by the invention.
(64) In some instances, it may be preferable to measure biomarkers having the lowest detectable concentration. An example would be biomarkers having protein concentrations in the pg/ml range. In some instances, it may be preferable to measure, on a single substrate, biomarkers having protein concentrations that are in the same dynamic range (i.e., they are present in the biological sample in the same concentration range). Those of ordinary skill in the art will be able to devise multiplexing assays (i.e., assays that measure two or more markers) using the guidance provided herein and the knowledge in the art.
(65) In some embodiments, the invention contemplates a substrate having a pre-determined amount of capture ligands for each biomarker. The pre-determined amount of capture ligand is may be based in part on prior measurements of biomarker levels in subjects that are STING high and STING low. The pre-determined amount of capture ligand is may be based in part on prior measurements of biomarker levels in subjects that are high for one or more SPARCS genes and low for one or more SPARCS genes. The assays may be designed such that if the subject is STING or SPARCS-positive, then one or more detectable signals appear, optionally on a biomarker-by-biomarker basis.
(66) Other examples of protein detection methods include multiplexed immunoassays as described, e.g., in U.S. Pat. Nos. 6,939,720 and 8,148,171, and published US Patent Application No. 2008/0255766, and protein microarrays as described, e.g. in published US Patent Application No. 2009/0088329.
(67) Protein Detection Binding Partners
(68) Protein detection binding partners include biomarker-specific binding partners. In some embodiments, binding partners may be antibodies. As used herein, the term antibody refers to a protein that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term antibody encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, Fv fragments, scFv, and dAb fragments) as well as complete antibodies. Methods for making antibodies and antigen-binding fragments are well known in the art (see, e.g. Sambrook et al, Molecular Cloning: A Laboratory Manual (2nd Ed.), Cold Spring Harbor Laboratory Press (1989); Lewin, Genes IV, Oxford University Press, New York, (1990), and Roitt et al., Immunology (2nd Ed.), Gower Medical Publishing, London, New York (1989), WO2006/040153, WO2006/122786, and WO2003/002609).
(69) In some embodiments, the binding partner for STING is the D2P2F Rabbit antibody 13647 from Cell Signaling Technology (cellsignal.com/products/primary-antibodies/sting-d2p2f-rabbit-mab/13647).
(70) Binding partners also include proteins or peptides that bind to or interact with a target biomarker, e.g. through non-covalent bonding. For example, if the biomarker is a ligand, a binding partner may be a receptor for that ligand. In another example, if the biomarker is a receptor, a binding partner may be a ligand for that receptor. In yet another example, a binding partner may be a protein or peptide known to interact with a biomarker. Methods for producing proteins are well known in the art (see, e.g. Sambrook et al, Molecular Cloning: A Laboratory Manual (2nd Ed.), Cold Spring Harbor Laboratory Press (1989) and Lewin, Genes IV, Oxford University Press, New York, (1990)) and can be used to produce binding partners such as ligands or receptors.
(71) Binding partners also include aptamers and other related affinity agents. Aptamers include oligonucleic acid or peptide molecules that bind to a specific target molecule. Methods for producing aptamers to a target molecule are well known in the art (see, e.g., published US Patent Application No. 2009/0075834, U.S. Pat. Nos. 7,435,542, 7,807,351, and 7,239,742). Other examples of affinity agents include SOMAmer (Slow Off-rate Modified Aptamer, SomaLogic, Boulder, CO) modified nucleic acid-based protein binding reagents.
(72) Binding partners also include any molecule capable of demonstrating selective binding to any one of the protein targets disclosed herein, e.g., peptoids (see, e.g., Reyna J Simon et al., Peptoids: a modular approach to drug discovery Proceedings of the National Academy of Sciences USA, (1992), 89(20), 9367-9371; U.S. Pat. No. 5,811,387; and M. Muralidhar Reddy et al., Identification of candidate IgG biomarkers for Alzheimer's disease via combinatorial library screening. Cell 144, 132-142, Jan. 7, 2011).
(73) Detectable Labels
(74) Detectable binding partners may be directly or indirectly detectable. A directly detectable binding partner may be labeled with a detectable label such as a fluorophore. An indirectly detectable binding partner may be labeled with a moiety that acts upon (e.g., an enzyme or a catalytic domain) or is acted upon (e.g., a substrate) by another moiety in order to generate a detectable signal. These various methods and moieties for detectable labeling are known in the art.
(75) Controls
(76) In some embodiments, methods provided herein involve measuring a level of a biomarker in a biological sample and comparing the biomarker level to a control level in order to characterize the level of STING or SPARCS expression in a subject. The control level is a level of the same biomarker in a control tissue, control subject, or a population of control subjects.
(77) The control may be (or may be derived from) a normal subject (or normal subjects). Normal subjects, as used herein, refer to subjects that are apparently healthy and show no cancer symptoms. The control population may therefore be a population of normal subjects. In some embodiments, the control is from a normal healthy subject or subjects and is from the same tissue type as the biological sample.
(78) In other instances, the control may be (or may be derived from) an ill subject (or ill subjects) that presents with one or more cancer without elevated or reduced STING or SPARCS expression.
(79) In other instances, the control may be (or may be derived from) an ill subject (or ill subjects) that presents with one or more cancer with elevated or reduced STING or SPARCS expression.
(80) In some embodiments, the control may be non-cancerous tissue from the subject being tested.
(81) In still other instances, the control may be a biomarker level from a population of subjects regardless of whether they manifest or do not manifest cancer-like symptoms (e.g., a subset of the general population).
(82) In any of the above embodiments, the control may be of the same tissue type as the biological sample.
(83) It is to be understood however that the methods provided herein do not require that a control level be measured every time a subject is tested. In some embodiments, a control level be measured when a subject is tested. In other embodiments, it is contemplated that control levels of biomarkers are obtained and recorded and that any test level is compared to such a pre-determined level. Such pre-determined control levels may also be referred to herein as reference values which are discussed in greater detail herein.
(84) Reference Values
(85) A reference value describes a measurement value for a biomarker that aids in identifying a subject with a cancer susceptible to treatment with agents described herein.
(86) The reference value may be calculated from control levels of each biomarker as measured from a control subject or population of subjects, or from non-cancerous tissue.
(87) In some embodiments, the reference value for STING is the same as or 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 50%, 100%, or more above the control level. In some embodiments, the reference value for STING is 1%, 2%, 3%, 4%, or 5% below the control level. In some embodiments, the reference value for the one or more SPARCS genes is the same as or 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 50%, 100%, or more above the control level. In some embodiments, the reference value for the one or more SPARCS genes is 1%, 2%, 3%, 4%, or 5% below the control level.
(88) The foregoing reference values are exemplary and it is to be understood that one of ordinary skill in the art is able to determine a control level based on the teachings provided herein and thereby establish new reference values that may be used in the methods provided herein.
(89) Treatment
(90) In some embodiments, a subject with a STING level or a level of one or more SPARCS genes above a reference value is treated with one or more of (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and (iii) an interferon gamma signaling agonist. In some embodiments, a subject with a STING level or a level of one or more SPARCS genes below a reference value is treated with one or more of a DNA methyltransferase inhibitor and an EZH2 inhibitor and optionally one or more of (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and (iii) an interferon gamma signaling agonist.
(91) In some embodiments, the subject to be treated by the methods described herein is human. In some embodiments, a human subject who needs the treatment may be a human patient having, at risk for, or suspected of having cancer. A subject having cancer can be identified by routine medical examination, e.g., laboratory tests, functional tests, biopsy, CT scans, or ultrasounds. A subject suspected of having cancer might show one or more symptoms of the disorder. A subject at risk for cancer can be a subject having one or more of the risk factors for that disorder. For example, risk factors associated with cancer include (a) hereditary cancer, (b) age, and (c) family history of cancer.
(92) Cancers include but are not limited to: Oral: buccal cavity, lip, tongue, mouth, pharynx; Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: non-small cell lung cancer (NSCLC), small cell lung cancer, bronchogenic carcinoma (squamous cell or epidermoid, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, larynx, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel or small intestines (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel or large intestines (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma), rectal, colon, colon-rectum, colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma, biliary passages; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; Nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), head and neck cancer, meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa-thecal cell tumors, SertolI-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome), Hodgkin's disease, non-Hodgkin's lymphoma [malignant lymphoma] hairy cell; lymphoid disorders; Skin: malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, keratoacanthoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis, Thyroid gland: papillary thyroid carcinoma, follicular thyroid carcinoma; medullary thyroid carcinoma, multiple endocrine neoplasia type 2A, multiple endocrine neoplasia type 2B, familial medullary thyroid cancer, pheochromocytoma, paraganglioma; and Adrenal glands: neuroblastoma.
(93) In some embodiments, the subject has KRAS lung cancer. In some embodiments, the subject has triple negative breast cancer, HER2+ breast cancer, or luminal B breast cancer. The data presented herein demonstrates that each of KRAS LKB1+ lung cancer, triple negative breast cancer, HER2+ breast cancer, and luminal B breast cancer are consistently associated with upregulated STING levels. As such, in some embodiments, a subject having KRAS LKB1+ lung cancer, triple negative breast cancer, HER2+ breast cancer, or luminal B breast cancer is treated with one or more of (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; and (iii) an interferon gamma signaling agonist without measuring STING levels or the level of one or more SPARCs genes.
(94) KRAS Lung Cancer
(95) Non-small-cell lung cancer (NSCLC) is a heterogeneous disease, with multiple different oncogenic mutations. Approximately 25-30% of NSCLC patients present KRAS mutations, which confer poor prognosis and high risk of tumor recurrence. In the majority of cases, these KRAS mutations are missense mutations which introduce an amino acid substitution at position 12, 13, or 61 (e.g., an amino acid substitution at position 12, 13, or 61 of NCBI NP_004976.2). The result of these mutations is constitutive activation of KRAS signaling pathways. The role of KRAS mutations and their potential association with other common genetic lung cancer lesions (LKB1, P53) has recently been investigated in different cohorts of human lung adenocarcinomas using transcriptional, mutational, copy-number and proteomic data. These studies highlighted how LKB1 inactivation is significantly associated with KRAS mutations compared to P53 deletion and that co-occurrence of KRAS mutation with inactivation of LKB1 or P53 genes generates different tumor subsets with distinct biology, immune profiles, and therapeutic vulnerabilities. About half of NSCLCs with activating KRAS lesions also have deletions or inactivating mutations in the serine/threonine kinase 11 (LKB1) gene. Loss of LKB1 on a KRAS-mutant background may represent a significant source of heterogeneity contributing to poor response to therapy. LKB1 mutations associated with lung cancer are extensively characterized in the art. Exemplary LKB1 mutations can be found, for example, in Kaufman et al, Cancer Research, 2016, the entirety of which is incorporated herein by reference.
(96) The genotype of lung cancer can be determined by means readily known to those of skill in the art for assessing the genotype and/or levels of the markers, e.g., KRAS, LKB1, and p53, as described, for example, in Sholl, (Transl Lung Cancer Res. 2017 6(5): 560-569) including but not limited to, determining the genomic sequence of marker, e.g., by DNA sequencing or allele specific PCR, determining expression of the marker, e.g., by northern analysis, quantative PCR, or microarray analysis, or determining protein levels of the marker, e.g., by western analysis, mass spectrometry, immunohistochemostry, ect.
(97) Breast Cancer
(98) Breast cancers can be classified at the molecular level based on their genes and proteins by dividing them into four main molecular subtypes: HER2-positive, luminal A, luminal B and triple-negative.
(99) One in five invasive breast cancers is HER2-positive, making this one of the more common breast cancer subtypes in the United States. HER2-positive cancers are ER- and PR-negative and human epidermal growth factor receptor 2 (HER2)-positive. HER2-positive breast cancer cells carry excess copies of the HER2 gene, which makes HER2-protein receptors, found on breast cells.
(100) Luminal A breast cancer is the most common subtype of breast cancer for every race and age. These tumors tend to be estrogen receptor (ER)-positive and progesterone receptor (PR)-positive and are typically slow growing.
(101) Luminal B breast cancer includes tumors that are estrogen receptor positive, progesterone receptor negative and HER2 or Ki67 positive. These tumors tend to grow more quickly than luminal A tumors.
(102) In triple negative breast cancer (TNBC), the cells do not contain receptors for estrogen, progesterone or HER2. This type of breast cancer is usually invasive and usually begins in the breast ducts.
(103) The classification of breast cancer can be determined by means readily known to those of skill in the art and is described, e.g., in Russnes et al., (Am Jounal of Pathology 2017 187(10): 2152-2162) for assessing the genotype and/or levels of the markers, e.g., HER2, ER, PR, and Ki67 including but not limited to, determining the genomic sequence of marker, e.g., by DNA sequencing or allele specific PCR, determining expression of the marker, e.g., by northern analysis, quantative PCR, or microarray analysis, or determining protein levels of the marker, e.g., by western analysis, mass spectrometry, immunohistochemistry, ect.
(104) The terms administer, administering, or administration, as used herein refers to implanting, absorbing, ingesting, injecting, or inhaling the one or more therapeutic agents.
(105) As used herein, the term treating refers to the application or administration of a composition including one or more active agents to a subject, who has cancer, a symptom of cancer, or a predisposition toward the disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease.
(106) Alleviating cancer includes delaying the development or progression of the disease, or reducing disease severity. Alleviating the disease does not necessarily require curative results. As used therein, delaying the development of a disease (such as cancer) means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated. A method that delays or alleviates the development of a disease, or delays the onset of the disease, is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.
(107) Development or progression of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. Development includes occurrence, recurrence, and onset. As used herein onset or occurrence of cancer includes initial onset and/or recurrence.
(108) An effective amount refers to an amount sufficient to elicit the desired biological response, i.e., treating the cancer. As will be appreciated by those of ordinary skill in this art, the effective amount of the compounds described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and health of the subject. An effective amount includes, but is not limited to, that amount necessary to slow, reduce, inhibit, ameliorate or reverse one or more symptoms associated with cancer. For example, in the treatment of cancer, such terms may refer to a reduction in the size of the tumor.
(109) The compounds provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. Specifically contemplated routes are oral administration, intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), and/or the condition of the subject (e.g., whether the subject is able to tolerate oral administration).
(110) The exact amount of a compound required to achieve an effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound, mode of administration, and the like. The desired dosage can be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks. In certain embodiments, the desired dosage can be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
(111) As used herein, the term in combination refers to the use of more than one therapeutic agent. The use of the term in combination does not restrict the order in which the therapeutic agents are administered to a subject with neoplasia. A first therapeutic agent, such as (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; (iii) an interferon gamma signaling agonist; (iv) a DNA methyltransferase inhibitor; or (v) an EZH2 inhibitor, can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapeutic agent, such as (i) a STING agonist; (ii) an Immune Checkpoint Blockade (ICB) agent; (iii) an interferon gamma signaling agonist; (iv) a DNA methyltransferase inhibitor; or (v) an EZH2 inhibitor described herein, to a subject. Thus, a first agent can be administered separately, sequentially or simultaneously with the second therapeutic agent.
(112) In some embodiments, levels of STING and/or levels of one or more SPARCS genes are determined in a subject and a therapy is selected based on the level(s). In some embodiments, the therapy is a STING agonist. In some embodiments, the therapy is an Immune Checkpoint Blockade (ICB) agent. In some embodiments, the therapy is an interferon gamma signaling agonist. In some embodiments, the therapy is a DNA methyltransferase inhibitor. In some embodiments, the therapy is an EZH2 inhibitor.
(113) In one embodiment, the STING agonist is a cyclic dinucleotide or a chemical molecule that binds to and activates STING, e.g., a cyclic dinucleotide comprising purine or pyrimidine nucleobases (e.g., adenosine, guanine, uracil, thymine, or cytosine nucleobases). In some embodiments, the nucleobases of the cyclic dinucleotide comprise the same nucleobase or different nucleobases. In some embodiments, the STING agonist comprises an adenosine or a guanosine nucleobase. In some embodiments, the STING agonist comprises one adenosine nucleobase and one guanosine nucleobase. In some embodiments, the STING agonist comprises two adenosine nucleobases or two guanosine nucleobases. In some embodiments, the STING agonist comprises a modified cyclic dinucleotide, e.g., comprising a modified nucleobase, a modified ribose, or a modified phosphate linkage. In some embodiments, the modified cyclic dinucleotide comprises a modified phosphate linkage, e.g., a thiophosphate. In some embodiments, the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with 2,5 or 3,5 phosphate linkages. In some embodiments, the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with Rp or Sp stereochemistry around the phosphate linkages.
(114) The bacteria-produced cyclic dinucleotides, c-di-AMP, c-di-GMP and 33-cGAMP, are agonists of STING. Other exemplary STING agonists include, e.g., cGAMP, c-di-GAMP, 2,3-cGAMP, 23-c-di-AM(PS)2 (Rp,Rp), c-AIMP; (3,2)c-AIMP; (2,2)c-AIMP; (2,3)c-AIMP; c-AIMP(S); c-(dAMP-dITMP); c-(dAMP-2FdIMP); c-(2FdAMP-2FdIMP); (2,3)c-(AMP-2FdIMP); c-[2FdAMP(S)-2FdIMP(S)]; c-[2FdAMP(S)-2FdIMP(S)](POM)2; Rp,Rp dithio 2,3 c-di-AMP (e.g., Rp,Rp-dithio c-[A(2,5)pA(3,5)p]) or a cyclic dinucleotide analog thereof; c-[G(2,5)pG(3,5)p] or a dithio ribose 0-substituted derivative thereof; c-[A(2,5)pA(3,5)p] or a dithio ribose 0-substituted derivative thereof, 2-O-propargyl-cyclic-[A(2,5)pA(3,5)p] (2-O-propargyl-ML-CDA), CL614 (Invitrogen), CL614 (Invitrogen), CL656 (Invitrogen), 23-cGAM(PS)2 (Rp/Sp), cyclic [FdG(3,5)pFdA(3,5)p], cyclic [FdA(3,5)pFdA(3,5)p], 23-c-di-AMP, cyclic [FdG(3,5)pFdG(3,5)p], 23-c-di-GMP, c-di-IMP, 5601 (Tocris), G10 (Tocris), SB 11285 (Spring Bank Pharmaceuticals), MK-1454 (Merck), or ADU-S100 (Aduro Biotech). In another embodiment, the unnatural or synthetic dinucleotide 22-cGAMP is an agonist of STING In some embodiments, the STING agonist can comprise a flavonoid. In other embodiments, the STING agonist can consist of a flavonoid. Suitable flavonoids include, but are not limited to, 10-(carboxymethyl)-9(10H)acridone (CMA), acid (DMXAA), methoxyvone, 6,4-dimethoxyflavone, 4-methoxyflavone, 3,6-dihydroxyflavone, 7,2-dihydroxyflavone, daidzein, formononetin, retusin 7-methyl ether, xanthone, or any combination thereof. In some embodiments, the STING agonist is a dimeric amidobenzimidazole. In some embodiments, the STING agonist is SRCB-0074 (See Chin et al., Open 2018; 3). Other exemplary STING agonists are disclosed, e.g., in PCT Publication Nos. WO 2014/189805 and WO 2014/189806, and U.S. Publication Nos. 2015/0056225 2016/0287623 and 2018/0028553, each of which is incorporated by reference.
(115) In some embodiments, a STING agonist comprises the STING protein or a fragment thereof. In some embodiments, a fragment of the STING protein comprises 10 or more consecutive amino acid residues of SEQ ID NO: 1, e.g., 15 or more, 20 or more, 25 or more, 30 or more, 35 or more, 50 or more, 100 or more, or 200 or more consecutive amino acid residues of SEQ ID NO: 1. In some embodiments, the STING agonist is a protein that is about 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 1.
(116) In some embodiments, a STING agonist comprises an mRNA, e.g., a synthetic mRNA expressing the STING protein or a fragment thereof. As used herein the term, synthetic mRNA refers to a mRNA produced through an in vitro transcription reaction or through artificial (non-natural) chemical synthesis or through a combination thereof. In some embodiments, the synthetic RNA further comprises a poly A tail, a Kozak sequence, a 3 untranslated region, a 5 untranslated region, or any combination thereof. Poly A tails in particular can be added to a synthetic RNA using a variety of art-recognized techniques, e.g., using poly A polymerase (Yokoe, et al. Nature Biotechnology. 1996; 14:1252-1256), using transcription directly from PCR products, or by ligating to the 3 end of a synthetic RNA with RNA ligase (see, e.g., Molecular Cloning A Laboratory Manual, 2 nd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press: 1991 edition)).
(117) In some embodiments, a STING agonist comprises a vector encoding the STING protein or a fragment thereof. Viral vectors are engineered to transduce one or more desired nucleic acids into a cell. In some embodiments, the viral vector is a retroviral transfer vector, an adenoviral vector, a lentiviral vector or an adeno-associated viral vector. In some embodiments, the viral vector is an adenoviral vector, and the adenoviral vector is a subgroup A, subgroup B, subgroup C, subgroup D, subgroup E, or subgroup F adenoviral vector. In some embodiments, the viral vector is a lentiviral vector, and the lentiviral vector is an HIV, SIV, FIV, EIAVor ovine lentiviral vector. In some embodiments, the viral vector is an adeno-associated viral vector, and the adeno-associated viral vector is an AAV1, AAV2, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10 or AAV11 adeno-associated viral vector. In some embodiments, the viral vector is a chimeric viral vector. In one embodiment of any one of the methods provided herein, the chimeric viral vector is an AAV-adenoviral transfer vector.
(118) In any of the foregoing aspects and following embodiments, an Immune Checkpoint Blockade (ICB) agent is, for example, an antagonist of surface proteins which are members of either the TNF receptor or B7 superfamilies, including without limitation, programmed death 1 (PD-1), programmed death ligand 1 (PD-L1), cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), V-domain Ig suppressor of T cell activation (VISTA), programmed death ligand 2 (PD-L2), indoleamine 2,3-dioxygenase (IDO), arginase, B7 family inhibitory ligand B7-H3, B7 family inhibitory ligand B7-H4, lymphocyte activation gene 3 (LAG3), 2B4, B and T lymphocyte attenuator (BTLA), T cell membrane protein 3 (TIM3; also known as HAVcr2), adenosine A2a receptor (A2aR), a killer inhibitory receptor, CD160, CD244, TIGIT, BMA, and/or signal transducer and activator of transcription (STAT)3. In some embodiments, the antagonist of the is agent that binds to and antagonizes the surface protein, e.g., PD-1, PD-L1, CTLA-4, VISTA, PD-L2, IDO, B7-143, B7-H4, LAG3, 2B4, BTLA, TIM3, A2aR, CD160, CD244, TIGIT, BMA, and/or STAT3 is (i) an antisense molecule directed against a nucleic acid encoding the surface protein, (ii) an adnectin directed against a nucleic acid encoding the surface protein, (iii) a single stranded or double stranded RNAi inhibitor of the surface protein, (iv) a small molecule inhibitor of the surface protein, or (v) an antibody that specifically binds the surface protein.
(119) In any of the foregoing aspects and embodiments, the PD-1 antagonist is, for example, an agent that binds to and antagonizes PD-1. Such agents can be, for example, a peptide that binds PD-1. Such agents can be a humanized antibody that selectively binds PD-1. In some embodiments, the humanized antibody that selectively binds PD-1 is lambrolizumab, nivolumab, pembrolizumab, pidilizumab, MEDI-0680, REGN2810, or AMP-224. In some embodiments, the humanized antibody that selectively binds PD-1 is nivolumab, pembrolizumab, or pidilizumab. In some embodiments, the antagonist is (i) an antisense molecule directed against PD-1 nucleic acid, (ii) an adnectin directed against PD-1 nucleic acid, (iii) a single stranded or double stranded RNAi inhibitor of PD-1, and/or (iv) a small molecule inhibitor of PD-1.
(120) In any of the foregoing aspects and embodiments, the PD-L1 antagonist is, for example, an agent that binds to and antagonizes PD-L1. Such agents can be, for example, a peptide that binds PD-L1. Such agents can be a humanized antibody that selectively binds PD-L1. In some embodiments, the humanized antibody that selectively binds PD-L1 is BMS-936559/MDX-1105, MPDL33280A/RG7446/atezolizumab, MSB0010718C/avelumab, MIH1, pembrolizumab, or MEDI4736/durvalumab. In some embodiments, the antagonist is (i) an antisense molecule directed against PD-L1, (ii) an adnectin directed against PD-L1, (iii) a single stranded or double stranded RNAi inhibitor of PD-L1, or (iv) a small molecule inhibitor of PD-L1.
(121) B7-H3 checkpoint inhibitors, include, without limitation, antibodies neutralizing human B7-113 (e.g. MGA271 disclosed as BRCA84D and derivatives in U.S. Patent Application Publication No. 2012/0294796, incorporated herein by reference). In some embodiments, the antagonist is (i) an antisense molecule directed against B7-H3, (ii) an adnectin directed against B7-H3, (iii) a single stranded or double stranded RNAi inhibitor of B7-H3, or (iv) a small molecule inhibitor of B7-H3.
(122) B7H4 checkpoint inhibitors include, without limitation, antibodies to human B7H4 (disclosed in WO 2013025779 A1, and in U.S. Patent Application Publication No. 2014/0294861, incorporated herein by reference) or soluble recombinant forms of B7H4 (such as disclosed in U.S. Patent Application Publication No. 2012/0177645, incorporated herein by reference, or Anti-human B7H4 clone H74: eBiocience #14-5948). In some embodiments, the antagonist is (i) an antisense molecule directed against B7-H4, (ii) an adnectin directed against B7-H4, (iii) a single stranded or double stranded RNAi inhibitor of B7-H4, or (iv) a small molecule inhibitor of B7-H4.
(123) TIM3 checkpoint inhibitors include, without limitation, antibodies targeting human TIM3 (e.g. as disclosed in U.S. Pat. No. 8,841,418, incorporated herein by reference, or the anti-human TIM3, blocking antibody F38-2E2 disclosed by Jones et al., J Exp Med., 205(12):2763-79 (2008)). In some embodiments, the antagonist is (i) an antisense molecule directed against TIM3, (ii) an adnectin directed against TIM3, (iii) a single stranded or double stranded RNAi inhibitor of TIM3, or (iv) a small molecule inhibitor of TIM3.
(124) TIGIT checkpoint inhibitors preferably inhibit interaction of TIGIT with polovirus receptor (CD155) and include, without limitation, antibodies targeting human TIGIT, such as those disclosed in U.S. Pat. No. 9,499,596 and U.S. Patent Application Publication Nos. 20160355589, 20160176963 and polovirus variants such as those disclosed in U.S. Pat. No. 9,327,014. In some embodiments, the antagonist is (i) an antisense molecule directed against TIGIT, (ii) an adnectin directed against TIGIT, (iii) a single stranded or double stranded RNAi inhibitor of TIGIT, or (iv) a small molecule inhibitor of TIGIT.
(125) In any of the foregoing aspects and embodiments, the CTLA-4 antagonist is, for example, an agent that binds to and antagonizes CTLA-4. Such agents can be, for example, a peptide that binds CTLA-4. Such agents can be a humanized antibody that selectively binds CTLA-4. In some embodiments, the humanized antibody that selectively binds CTLA-4 is ipilimumab or tremelimumab. In some embodiments, the CTLA-4 antagonist is (i) an antisense molecule directed against CD80, CD86, and/or CTLA-4 nucleic acid, (ii) an adnectin directed against CD80, CD86, and/or CTLA-4 nucleic acid, (iii) a single stranded or double stranded RNAi inhibitor of CD80, CD86, and/or CTLA-4, or (iv) a small molecule inhibitor of CD80, CD86, or CTLA-4.
(126) In any of the foregoing aspects and embodiments, the VISTA antagonist is, for example, an agent that binds to and antagonizes VISTA. Such agents can be, for example, a peptide. Such agents can be an inhibitory antibody directed to VISTA. In some embodiments, the agent that binds to and antagonizes VISTA is a humanized antibody. In some embodiments, the agent that binds to and antagonizes VISTA is (i) an antisense molecule directed against VISTA nucleic acid, (ii) an adnectin directed against VISTA nucleic acid, (iii) a single stranded or double stranded RNAi inhibitor of VISTA, or (iv) a small molecule inhibitor of VISTA.
(127) Exemplary interferon gamma signaling agonists include, e.g., interferon gamma or interferon gamma variants. In some embodiments, an interferon gamma or interferon gamma variant comprises Actimmune (Genentech). In some embodiments, an interferon gamma or interferon gamma variant comprises recombinant interferon gamma described, for example, in Gray et al., Nature 295, 503-508 (1982); U.S. Pat. Nos. 4,762,791, 4,929,544, 4,727,138, 4,925,793, 4,855,238, 5,582,824, 5,096,705, 5,574,137, and 5,595,888, the contents of each of which are incorporated by reference herein in their entirety. In some embodiments, an interferon gamma or interferon gamma variant comprises recombinant interferon gamma variants described in 7,038,015 or 6,958,388, the contents of each of which are incorporated by reference herein in their entirety.
(128) Interferon gamma has the following amino acid sequence:
(129) TABLE-US-00004 (SEQIDNO:110) mkytsyilafqlcivlgslgcycqdpyvkeaenlkkyfna ghsdvadngtlflgilknwkeesdrkimqsqivsfyfklf knfkddqsiqksvetikedmnvkffnsnkk krddfekltnysvtdlnvqrkaiheliqvmaelspaaktg krkrsqmlfrgrrasq
(130) In some embodiments, an interferon gamma signaling agonist comprises the interferon gamma protein or a fragment thereof. In some embodiments, a fragment of the interferon gamma protein comprises 10 or more consecutive amino acid residues of SEQ ID NO: 110, e.g., 15 or more, 20 or more, 25 or more, 30 or more, 35 or more, 50 or more, 100 or more, or 200 or more consecutive amino acid residues of SEQ ID NO: 110. In some embodiments, the interferon gamma signaling agonist is a protein that is about 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO: 110. In some embodiments, an interferon gamma signaling agonist comprises an mRNA, e.g., a synthetic mRNA expressing the interferon gamma protein or a fragment thereof. In some embodiments, an interferon gamma signaling agonist comprises a retroviral vector encoding the interferon gamma protein or a fragment thereof.
(131) In some embodiments, the interferon gamma signaling agonist comprises baicalin, poly I:C, IL-18, IL-2, IL-12, IL-27, an IL-27 hyperkine, IRF-10, or PTPN2 inhibitors
(132) In some embodiments, the interferon gamma signaling agonist comprises mitogens. Exemplary mitogens include but are not limited to lectins, phytohemagglutinin, concanavalin A, pokeweed mitogen, lipopolysaccharide, endotoxin, lipid A, polysaccharide and bacterium.
(133) In some embodiments, the interferon gamma signaling agonist comprises a nucleic acid. In some embodiments, the nucleic acid comprises bacterial DNA. In some embodiments, the nucleic acid comprises an oligonucleotide containing CpG motifs.
(134) In some embodiments, the interferon gamma signaling agonist comprises a small molecule mimic of interferon gamma. Exemplary small molecule mimics of interferon gamma are described, for example, in U.S. Ser. No. 10/197,557, the entire contents of which is incorporated herein by reference in its entirety.
(135) Exemplary DNA methyltransferase inhibitors include, e.g., azacitidine, decitabine, zebularine, NPEOC-DAC, CP-4200, RX-3117, cytosine analogues, thio-cytidine derivatives, e.g., T-dCyd and 5-aza-T-dCyd, decitabine-p-deoxyguanosine (SGI-110), SAM analogues, SAH analogues, SGI-1027, alcyne derivatives, cyclopenta derivatives, cyclohexathiophene derivatives, tryptophane derivates, e.g., RG108, procainamide derivatives, flavonoid derivatives, curcumin, psammaplin, hydralazine, disulfiram, 5-fluro-2-deoxycitidine, 5-azacytidine, 5-aza-2-deoxycytidine, 5,6-dihydro-5-azacytidine, 5-fluoro-2-deoxycytidine, 1-(beta-D-ribofuranosyl)-1,2-dihydropyrimidin-2-one, 5-aza-2-deoxycytidine-p-deoxyguanosine, fluorocyclopentenylcytosine, 2-(p-nitrophenyl) ethoxycarbonyl-5-aza-2-deoxycytidine, 4-thio-2-deoxycytidine, 5-aza-4-thio-2-deoxycytidine, 1-beta-D-arabinofuranosyl-5-azacytosine, hydralazine, procaine, mithramycin A, nanaomycin A, N-(4-((2-amino-6-methylpyrimidin-4-yl)amino)phenyl)-4-(quinolin-4-ylamino)benzamide, N-phthalyl-L-tryptophan, N-phthalyl-L tryptophan derivatives, alkine derivatives, halomon, S-adenosyl-L-methionine analogues, S-adenosyl-L-homocysteine, S-adenosyl-L-homocysteine analogues, MG98, miR-29a, miR-29c, Sinefungin, procainamide, procainamide derivatives, procainamide-N-phthalyl-L-tryptophan conjugates, cyclopentathiophene derivatives, cyclohexathiophene derivatives, flavone derivatives, 3-nitroflavone derivatives, flavanones derivatives, 3-chloro-3-nitroflavanone derivatives, diclone, laccaic acid, acridine, 5,5-Methylenedisalicylic acid, 4-(2-((5-Chloro-2-methoxybenzoyl)amino)ethyl)hydrocinnamic acid, 4-Chloro-N-(4-hydroxy-1-naphthalenyl)-3-nitro-benzenesulfonamide, (S)-3-(1H-Indol-3-yl)-2-(5-nitro-1,3-dioxo-1,3-dihydro-isoindol-2-yl)-propionic acid, (R)-2-(1,3-Dioxo-5-phenylethynyl-1,3-dihydro-isoindol-2-yl)-3-(1H-indol-3-yl)-propionic acid, (S)-2-(2,6-Dioxo-piperidin-1-yl)-3-(1H-indol-3-yl)-propionic acid, N-hydroxy-4-(2-(4-aminobenzamido)-ethylcarbamoyl)butanamide, 4-amino-N-(2-(ethyl(3-(hydroxyamino)-3-oxopropyl)amino)ethyl)benzamide, N<1>-(2-(4-aminobenzamido)ethyl)-N<1>-ethyl-N<6>-hydroxyadipamide, tetraethylthiuramdisulfide, ()-epigallocatechin-3-gallate, genistein, psammaplin A, psammaplin derivatives, and anti-DNA methyltransferase antibodies.
(136) Non-limiting examples of EZH2 inhibitors include S-adenosyl-methionine-competitive small molecule inhibitors. In particular non-limiting embodiments, the EZH2 inhibitor is derived from tetramethylpiperidinyl compounds. Further non-limiting examples include UNC1999, 3-Deazaneplanocin A (DZNcp), EI1, EPZ-5676, EPZ-6438, GSK343, EPZ005687, EPZ011989, GSK126, CAS #1346574-57-9, (S)-1-(sec-butyl)-N-((4,6-dimethyl-2-oxo-1,2-dihydropyridin-3-yl)methyl)-3-methyl-6-(6-(piperazin-1-yl)pyridin-3-yl)-1H-indole-4-carboxamide, DZNep, tazemetostat, anti-EZH2 antibodies, and siRNA directed against EZH2.
Example 1: Tumor Innate Immunity Primed by Specific Interferon-Stimulated Endogenous Retroviruses
(137) Mesenchymal tumor subclones secrete pro-tumorigenic cytokines and promote treatment resistance, but the underlying mechanism remains poorly understood. Here an epigenetically regulated subclass of endogenous retroviruses (ERVs) that engages innate immune signaling in mesenchymal cells is identified. Stimulated 3 Prime Antisense Retroviral Coding Sequences (SPARCS) are oriented inversely in 3UTRs of certain interferon-inducible genes silenced by EZH2. De-repression of these loci results in dsRNA generation following IFN exposure due to bi-directional transcription from the STAT1-activated gene promoter and the 5 LTR of the antisense ERV. dsRNA sensing by MAVS fuels activation of TBK1, IRF3, and STAT1 signaling, sustaining a positive feedback loop. SPARCS induction in human tumors is tightly associated with B2M and MHC class 1 antigen expression, mesenchymal markers, and downregulation of chromatin modifying enzymes, including EZH2. Analysis of cell lines poised to induce high levels of SPARCS expression reveals strong association with an AXL positive mesenchymal cell state. While SPARCS.sup.high tumors are marked by immune infiltration, they also exhibit multiple features of immune suppression including checkpoint gene expression and myeloid cell infiltration. Together, these data unveil a novel subclass of ERVs whose de-repression triggers pathologic innate immune signaling in cancer, with important implications for cancer immunotherapy.
(138) Subclonal tumor heterogeneity promotes cancer progression via different growth and metastatic properties, drug sensitivity, and paracrine signaling.sup.1-4. Resistant small cell lung cancer (SCLC), for example, undergoes a mesenchymal state switch induced by RAS/MET signaling or chemotherapy (e.g. H69M or H69AR cells) (
(139) Enhanced innate immune and RAS signaling are noted in H69M cells, including elevated phosphorylated-TBK1 (pTBK1), pIRF3, IKK and NF-B gene sets (
(140) H69M PD-L1.sup.high cells reverted morphologically over time and were genomically similar to parental H69 cells (
(141) Since ERV dsRNAs are sensed by MAVS or reverse-transcribed and detected via the cGAS-cGAMP STING pathway.sup.14, and since STING especially was upregulated in concert with this phenotype (
(142) In contrast to H69M-PD-L1.sup.high cells, which secreted IFN at baseline (
(143) It was sought to determine if SPARCS promote positive feedback signal amplification, which would explain their propensity to be silenced. High levels of dsRNA preferentially produced from MLT1C49, MLT1J and MLT1A were detected in 10 minute IFN pulsed H69AR cells, even after 24 hours (
(144) The contribution of SPARCS ERV sensing to feedforward signaling in H69AR cells was also directly assessed. As expected, MAVS deletion impaired Poly(I:C)-induced CXCL10 and type I/II IFN expression and CXCL10 secretion (
(145) To determine the broader relevance of SPARCS and to begin to explore the relationship to immune contexture, next the expression of the 15 gene SPARCS signature across the Cancer Genome Atlas (TCGA) (Pancan12, n=3602 tumors).sup.17 was ranked using single sample gene set enrichment analysis (ssGSEA) 18 (
(146) At the gene level, SPARCS expression correlated with markers of T cell (CD4, PRF1 and GZMA) and myeloid (CD40, CD86, CD14, CD68) infiltration uniquely in TCGA. In both CCLE and TCGA datasets SPARCS associated with expression of MHC, APOBEC, immunosuppressive factors such as CD274 (PD-L1), PDCD1LG2 (PD-L2), C10orf54 (VISTA), TIM3, and IDO1, and EMT genes (
(147) High SPARCS expression in TCGA was enriched in distinct cancer histologies beyond SCLC, including clear cell renal (KIRC), lung adenocarcinoma (LUAD), head/neck squamous (HNSC), and glioblastoma (GBM) (
(148) Immune cell GSEA.sup.20 was next used to assess whether certain immune infiltrates might be associated with elevated SPARCS expression in TCGA (
(149) Finally, ex vivo culture of patient-derived organotypic tumor spheroids (PDOTS) was utilized, which retain autologous tumor infiltrating lymphocytes.sup.21, to determine the potential translational relevance of these findings. Using multiplexed immunofluorescence, T cell infiltration of two different KRAS mutant non-small lung cancer specimens was confirmed (
(150) Here SPARCS was identified as a novel subclass of ERVs silenced by EZH2 and poised to undergo positive feedback signal amplification due to their antisense localization in 3 UTRs of IFN stimulated genes. Whereas prior reports utilized DNMT inhibition to uncover ERVs more generally.sup.11,12, the data reveal that mesenchymal tumor subclones with high AXL expression and low EZH2 levels trigger SPARCS expression when exposed to IFN. This SPARCS.sup.high state was also associated with downregulation of multiple SWI/SNF components and RCC, potentially contributing to the immunogenicity recently reported following PBRM1 inactivation.sup.22,23. While SPARCS expression promotes MHC class 1 upregulation and T cell infiltration, activation of immune checkpoints and myeloid infiltration may promote tumor immune suppression, similar to a chronic virally infected state. Therapeutically, this may have important implications for drug combinations with PD-1 blockade. For example, in contrast to potential antagonism by JAK1/2 inhibitors, therapies that activate JAK signaling such as PTPN2 inhibition.sup.24, inhibit certain chromatin regulators.sup.22,23,25, or target TBK.sup.21,24, could alter SPARCS physiology to favor response.
Methods
(151) Patients Samples
(152) SCLC and NSCLC human tumor samples were collected and analyzed according to Dana-Farber/Harvard Cancer Center IRB-approved protocols. These studies were conducted according to the Declaration of Helsinki and approved by Dana-Farber and Brigham and Women's Hospital IRBs.
(153) Cell Lines
(154) The human SCLC cell lines H69, H69M, H69AR, H841, SHP77, H187, H345 and 11524 were obtained from the laboratory of Dr. Joan Albanell and were authenticated following Short Tandem Repeat (STR) genotyping. Clear cell renal carcinoma (ccRCC) cell lines A704, A498, 786-O, 769-P and Caki-2 were obtained from the laboratory of Dr. William G. Kaelin Jr. and were authenticated following STR genotyping. HCC44 cell line was obtained from Broad Institute and was authenticated following STR genotyping. Jr. Jurkat T cells, THP-1 monocytes, H196, MDA-MB-231, HCC1143, MDA-MB-468, H522, T47D, MDA-MB-453, H1436 and H2081 were obtained from the American Type Culture Collection (ATCC) (Rockville, MD) and used for all experiments before reaching 10 passages.
(155) H69, H69M, H69AR, H841, SHP77, H187, H345, H524, H196, HCC44, MDA-MB-231, MDA-MB-453, MDA-MB-468, T47D, HCC1143, H522, H1436, H2081, THP-1, Jurkat and 769-P were cultured in RPMI-1640 (Thermo Fisher Scientific, #11875-119) containing 10% FBS (Gemini Bio-products, #100-106) and 1 pen-strep (Gemini Bio-products, #400-109). 786-O and A498 were maintained in Dulbecco's Modified Eagles Medium (DMEM) (Thermo Fisher Scientific, #11965-118) containing 10% FBS and 1 pen-strep. Caki-2 cells were maintained in McCoy's 5A medium (Life Technologies #16600108) supplemented with 10% FBS and 1 Penicillin-Streptomycin. A704 cell lines was maintained in Eagle's Minimum Essential Medium (EMEM) (Sigma, #M4780) supplemented with 2 mM Glutamine (Life Technologies, #25030081), 1% Non-Essential Amino Acids (NEAA) (Life Technologies, #11140-050), 1 mM Sodium pyruvate (Life Technologies, #11360-070), 15% FBS and 1 Penicillin-Streptomycin.
(156) Compounds and Treatments
(157) Recombinant human IFN- (#285-IF) IFN- (#11100-1) and IFN- (#8499-IF) proteins were purchased from R&D Systems (Minneapolis, MN) and reconstituted in sterile, deionized water. MRT67307 and Ruxolitinib were synthesized and purchased from Shanghai Haoyuan Chemexpress Co. Both drugs were reconstituted at 10 mM in DMSO and stored at 20 C. GSK126 (#S7061) was purchased from Selleck chemicals (Houston, TX) and reconstituted at 5 mM in DMSO and stored at 20 C.
(158) For IFN pulse experiments, cells were pulsed 10 minutes with IFN- 200 ng/mL or 10 ng/mL), IFN- 10 000 U/mL), or IFN- 10 000 U/mL), extensively washed, and chased in fresh media for an additional 24, 48 or 72 hours. To test drug effects on gene expression or protein secretion, IFN- pulsed H69AR cells were treated with DMSO, 1 M MRT67307 or 100 nM Ruxolitinib for 24, 48 and 72 hours.
(159) For EZH2 inhibition experiments, H69 cells were treated with 5 M GSK126 for 6 days. Drug was replenished every 3 days with both suspension and adherent cells carried each time. After the GSK126 treatment period, equal numbers of DMSO-treated and GSK126-treated cells were exposed to either H.sub.2O or 200 ng/mL IFN- for 24 hours before harvesting of RNA or conditioned media (CM).
(160) SCLC GEM Model
(161) All mouse experiments were conducted in accord with a Dana-Farber Cancer Institute Institutional Animal Care and Use Committee (IACUC) approved protocol. Primary tumor and metastasis tissue sections used in this study were from the genetically engineered mouse (GEM) model of SCLC consisting of the Rb.sup.L/L/p53.sup.L/L allelic genotype.sup.26. A total number of 24 slices of 1 mm thickness were collected providing a sufficient number to cover the lung volume. Tumor volume per animal was quantified using 3D Slicer by manual quantification of at least 8 consecutive axial image sequences. MRI was performed to follow tumor volume and weights were monitored bi-weekly. Mice were euthanized and lungs and livers were perfused with 10% formalin, stored in fixative overnight, and embedded in paraffin. For further staining with hematoxylin and eosin (H % E) and antibodies, sections of 5 m were cut.
(162) Xenograft Studies
(163) H69AR xenograft model was established by subcutaneous (s.c.) injection of 2.510.sup.5 sgCTRL or sgMAVS-H69AR cells in matrigel (Corning, Corning, NY) into the flank of nude mice (Charles River Laboratories, Wilmington, MA). Tumor volume was determined from caliper measurements of tumor length (L) and width (W) according to the formula LW.sup.2/2. Both tumor size and body weight were measured three times per week.
(164) Immunoblotting, Antibodies and ELISA
(165) Protein was isolated from cell lines and measured by BCA (Pierce Biotechnology). Protein extracts were subjected to polyacrylamide gel electrophoresis using the 4%-12% NuPAGE gel system (Invitrogen, Carlsbad, CA), transferred to PVDF (Millipore) membranes, and immunoblotted using antibodies that specifically recognize TBK1 (#3013), S172 pTBK1 (#5483), pERK1/2 (#4370), ERK1/2 (#9107), S473 pAKT (#4060), AKT (#9272), S396 pIRF3 (#4947), IRF3 (#4302), Y701 pSTAT1 (#9171), STAT1 (#9172), AXL (#8661), EZH2 (#5246), STING (#13647), MAVS (#3993), E-Cadherin (#3195), Vimentin (#5741), -Actin (#4970), Tubulin (#2144) (Cell Signaling Technologies, Danvers, MA) and IKK (#14907) (Sigma-Aldrich, St. Louis, MO).
(166) Secondary antibodies were from LICOR Biosciences (Lincoln, NE): IRDye 800CW Goat anti-Mouse IgG (H+L) (#926-32210), IRDye 800CW Goat anti-Rabbit IgG (H+L) (#926-32211). LICOR blocking buffer (#927-40000) was used to dilute primary and secondary antibodies, with the exception of phosho-specific antibodies, which were diluted in HIKARI Signal Enhancer Solutions 1 and Solution 2 (Nacalai USA, Inc. #NU00101). Imaging of blots and quantitation of bands was performed using the LICOR Odyssey system.
(167) Proteome Profiler Human Cytokine Array Kit (#ARY005B) and CXCL10 ELISA (#DIP100) (R&D Systems, Minneapolis, MN), were performed according to manufacturer's instructions. For cytokine array, conditioned media (CM) from SCLC cells at basal conditions was collected after 48 and 72 hours. For CXCL10 ELISA, CM from IFN- pulsed cells was collected after 72 hours.
(168) Microfluidic Devices Design and Fabrication
(169) Microfluidic device design and fabrication was performed as described.sup.27, with modifications of device dimensions to accommodate larger volumes of media. DAX-1 3D cell culture chip (AIM Biotech, Singapore) was also used for select studies.
(170) Microfluidic Culture
(171) H69, H69M and H69AR cell suspensions (2.510 4 cells) were pelleted and resuspended in type I rat tail collagen (Corning, Corning, NY) at a concentration of 2.5 mg/mL following addition of 10PBS with phenol red with pH adjusted using NaOH. pH 7.0-7.5 confirmed using PANPEHA Whatman paper (Sigma-Aldrich, St. Louis, MO). The cell-collagen mixture was then injected into the center gel region of the 3D microfluidic culture device. Microfluidic culture devices were designed with a central region containing the cell-collagen mixture, surrounded by 2 media channels located on either side formed by bonding a coverslip to a patterned polydimethylsiloxane (PDMS) substrate. Collagen hydrogels containing cells were incubated 30 minutes at 37 C. and then hydrated with media with or without 2.510.sup.4 cells CFSE labeled Jurkat T cells and THP1 monocytes in the side media channels. Jurkat T cells or THP1 monocytes were labeled with the CFSE Cell Division Tracker Kit (BioLegend, San Diego, CA) following manufacturer's instructions. Following 48 hours of incubation, images were captured on a Nikon Eclipse 80i fluorescence microscope equipped with Z-stack (Prior) and CoolSNAP CCD camera (Roper Scientific). Image capture and analysis was performed using NIS-Elements AR software package. Whole device images were achieved by stitching in multiple captures. Cell quantitation was performed by measuring total cell area of CFSE dye.
(172) Ex Vivo Culture of Patient-Derived Organotypic Tumor Spheroids (PDOTS)
(173) PDOTS from human NSCLC resection specimens were generating according to the recent publication.sup.21. Briefly, fresh tumor specimens were minced and resuspended in media with collagenase type IV (Life Technologies, Carlsbad, CA). After digestion, samples were strained over 100 m filter and 40 m filters to generate S1 (>100 m), S2 (40-100 m), and S3 (<40 m) spheroid fractions. S2 spheroid fraction was pelleted and resuspended in type I rat tail collagen (Corning, Corning, NY) at a concentration of 2.5 mg/mL. The spheroid-collagen mixture was then injected into the center gel region of the 3D microfluidic culture device. Collagen hydrogels containing PDOTS were hydrated with media and treated with anti-PD-1 (Nivolumab, 100 g/mL), IFN (200 ng/mL), Poly (I:C) (0.5 g/mL) or combination (Nivolumab+IFN Nivolumab+Poly (I:C)). The number of Live/Dead cells in each treatment condition was determined by Trypan Blue Exclusion method and plotted as percentage of viability.
(174) Flow Cytometry Analysis and Cell Sorting
(175) Cells were stained with anti-PD-L1 (Biolegend, Cat #329717), anti-CD44 (Biolegend, Cat #103011) or isotype IgG control antibodies (Biolegend, Cat #400326 and Cat #400611), in PBS containing 2% FBS for analysis and cell sorting. Briefly, cells were washed and further incubated with the indicated antibodies at 2 g/mL. After 3 washes with PBS, cells were resuspended in PBS containing 2% FBS and analyzed on BD FACSCanto II or sorted to >95% purity using a BD FACSAria II. Levels were compared with isotype control antibodies. PD-L1 and CD44 mean fluorescence intensity (MFI) was normalized to isotype control. The data analyses were performed with FlowJo software (TreeStar).
(176) Cytokine Profiling
(177) Multiplex assays were performed utilizing the bead-based immunoassay approach Bio-Plex Pro Human Cytokine 40-plex Assay (Cat #171AK99MR2) on a Bio-plex 200 system (Cat #171000201) (Bio-Rad Laboratories, Hercules, CA) and the Human Cytokine/Chemokine Maganetic Bead Panel (Cat #HCYTMAG-60K-PX30) on a Luminex MAGPIX system (Merck Millipore, Billerica, MA). Conditioned media concentration levels [pg/ml] of each protein were derived from 5-parameter curve fitting models. Fold changes relative to the corresponding control were calculated and plotted as log 2FC. Lower and upper limits of quantitation (LLOQ/ULOQ) were imputed from standard curves for cytokines above or below detection.
(178) Quantitative RT-PCR
(179) Total cellular RNA was extracted using the miRNeasy Mini Kit (Qiagen, Hilden, Germany) according to manufacturer's instructions. After extraction, 1 g total RNA was used to generate cDNA with the SuperScript III First-Strand Synthesis SuperMix for qRT-PCR kit (Thermo Fisher Scientific, Waltham, MA). Quantitative reverse transcription PCR (qRT-PCR) of the indicated genes was performed using SYBR green PCR Master Mix (Applied Biosystems, Foster City, CA) and the Applied Biosystems 7300 Fast real-time PCR system and software. The relative expression was normalized with the expression of the housekeeping gene 36B4. The sequences of primers used have been listed in Table 3.
(180) TABLE-US-00005 TABLE3 Geneprimersequences Gene name Forward(5-3) Reverse(5-3) 36B4 CAGATTGGCTACCCAACTGTT GGAAGGTGTAATCCGTCTCCAC (SEQIDNO:2) (SEQIDNO:14) PD-L1 TATGGTGGTGCCGACTACAA TGCTTGTCCAGATGACTTCG (SEQIDNO:3) (SEQIDNO:15) TRIM22 CCCTGCAGAGGCTGATAAAG GCCAGGTTATCCAGCACATT (SEQIDNO:4) (SEQIDNO:16) IFNG TCGGTAACTGACTTGAATGTCCA TCGCTTCCCTGTTTTAGCTGC (SEQIDNO:5) (SEQIDNO:17) IFNB ATGACCAACAAGTGTCTCCTCC GGAATCCAAGCAAGTTGTAGCTC (SEQIDNO:6) (SEQIDNO:18) IFNA2 GCTTGGGATGAGACCCTCCTA CCCACCCCCTGTATCACAC (SEQIDNO:7) (SEQIDNO:19) CXCL10 GTGGCATTCAAGGAGTACCTC TGATGGCCTTCGATTCTGGATT (SEQIDNO:8) (SEQIDNO:20) IKKE ATTACAACACTGCCAAGGGCGTGT GGAGCACCTCCATGACCCAGTGCA (SEQIDNO:9) (SEQIDNO:21) E-Cadherin CGAGAGCTACACGTTCACGG GGGTGTCGAGGGAAAAATAGG (SEQIDNO:10) (SEQIDNO:22) Vimentin GACGCCATCAACACCGAGTT CTTTGTCGTTGGTTAGCTGGT (SEQIDNO:11) (SEQIDNO:23) CD44 CTGCCGCTTTGCAGGTGTA CATTGTGGGCAAGGTGCTATT (SEQIDNO:12) (SEQIDNO:24) CCL2 CCCCAGTCACCTGCTGTTAT TGGAATCCTGAACCCACTTC (SEQIDNO:13) (SEQIDNO:25)
(181) TABLE-US-00006 TABLE4 ERVPrimerSequences ERVname Forward(5-3) Reverse(5-3) ERVMER34-1 GAATTCAGTGCCACTAAGCAGAC TCGGTATATCCAAGACATGATCC (SEQIDNO:26) (SEQIDNO:58) MER21C GGAGCTTCCTGATTGGCAGA ATGTAGGGTGGCAAGCACTG (SEQIDNO:27) (SEQIDNO:59) LTR12F GCAGGGAGGATTGAAAGAAA TGGTGCTGACTTCAAGAACG (SEQIDNO:28) (SEQIDNO:60) MER66C AGGAAGCAGCAAATGGCTAA CAAATTAAGGAGCGGGTCAA (SEQIDNO:29) (SEQIDNO:61) ERV316A3 AGCAGATAGCCCAGACCTCA CAAAGCTCTGCCCACTAAGG (SEQIDNO:30) (SEQIDNO:62) ERVFb1 ATATCCCTCACCACGATCCTAATA CCCTCTGTAGTGCAAAGACTGATA (SEQIDNO:31) (SEQIDNO:63) ERV9.1 TCTTGGAGTCCTCACTCAAACTC ACTGCTGCAACTACCCTTAAACA (SEQIDNO:32) (SEQIDNO:64) ERV-F CAGGAAACTAACTTTCAGCCAGA TAAAGAGGGCATGGAGTAATTGA (SEQIDNO:33) (SEQIDNO:65) ERVL ATATCCTGCCTGGATGGGGT GAGCTTCTTAGTCCTCCTGTGT (SEQIDNO:34) (SEQIDNO:66) MLT1B TGCCTGTCTCCAAACACAGT TACGGGCTGAGCTTGAGTTG (SEQIDNO:35) (SEQIDNO:67) MLT1C49 TATTGCCGTACTGTGGGCTG TGGAACAGAGCCCTTCCTTG (SEQIDNO:36) (SEQIDNO:68) MLT1C627 TGTGTCCTCCCCCTTCTCTT GCCTGTGGATGTGCCCTTAT (SEQIDNO:37) (SEQIDNO:69) MER4D CCCTAAAGAGGCAGGACACC TCAAGCAATCGTCAACCAGA (SEQIDNO:38) (SEQIDNO:70) MER57B1 CCTCCTGAGCCAGAGTAGGT ACCAGTCTGGCTGTTTCTGT (SEQIDNO:39) (SEQIDNO:71) MTL2B4 GGAGAAGCTGATGGTGCAGA ACCAACCTTCCCAAGCAAGA (SEQIDNO:40) (SEQIDNO:72) MLTA10 TCTCACAATCCTGGAGGCTG GACCAAGAAGCAAGCCCTCA (SEQIDNO:41) (SEQIDNO:73) THE1D CACCCTGCTTCTCCTGCT AATGCCTGAGACTGGGTGAT (SEQIDNO:42) (SEQIDNO:74) TRIM38/MLT1A TGGGCTCTTTGGGTGATAGT TTGCAGATGGCTACCTTCCT (SEQIDNO:43) (SEQIDNO:75) TRIM38/MLT1J GCTGTTGCACACATGCTCTT GATGTGGAAGTCTGGGAAGC (SEQIDNO:44) (SEQIDNO:76) SPATS2L/MLT1K CAGATGAAGCCCTCTCTCAGA CCTTCCTCTCTCCTGGTGTC (SEQIDNO:45) (SEQIDNO:77) BEND6/PABL_B GAAGGCACATAACCCCAACC GGGTCCAGCTGTGTTTTCTG (SEQIDNO:46) (SEQIDNO:78) AIG1/MLT1A0 ATGAATGGGATTGGTGGGCT TTCTAGAGCCTGGGAAGTCC (SEQIDNO:47) (SEQIDNO:79) MSRB2/MSTA TAACTGGGTCATGAGGGTGG CATTTGCTCGGATTCTGGGG (SEQIDNO:48) (SEQIDNO:80) ANTXR1/LTR79 AACTCTGGGCTTCCGTTTCC AAAGCATGCCTCTTTCCTGC (SEQIDNO:49) (SEQIDNO:81) ADAM19/MER92B GTTAAGCTTCCCTCCTCCCC AGTGAAAAGGCTCAGACCGA (SEQIDNO:50) (SEQIDNO:82) F3/MLT1I TTCCCTCTGCCCTGATCTAA GTCAGTGGCTTACAACAACGT (SEQIDNO:51) (SEQIDNO:83) IFI44L/LTR26 CTCCAAGGAATTGACTCAGCA TCTACCTCCCTGCTGAGTCT (SEQIDNO:52) (SEQIDNO:84) IL32/THE1D CACCCTGCTTCTCCTGCT AATGCCTGAGACTGGGTGAT (SEQIDNO:53) (SEQIDNO:85) HERC3/MSTB ACCTCCTCTCCACTCTTCCT AGTTCTGCAGGCTCTACAGG (SEQIDNO:54) (SEQIDNO:86) TNFRSF9/MLT1I AGCTGTTACAACATAGTAGCCAC GGACAGGGACTGCAAATCTGAT (SEQIDNO:55) (SEQIDNO:87) EPHA3/LTR37A CTGCTCTGTTCTCGACAGCTT CAGCTCCCCTTGAATTGTTTTTG (SEQIDNO:56) (SEQIDNO:88) SERPINB9/MER50 AATGCAAGTGGTACTTTTGCCA AAGCCCGATGAATGTCTTCCT (SEQIDNO:57) (SEQIDNO:89)
dsRNA Enrichment
(182) For dsRNA enrichment, RNA was first treated or not for 30 minutes with 50 g/ml RNase A (Qiagen, Hilden, Germany) in high-salt concentration (NaCl, 0.35 M) to prevent dsRNA degradation. After treatment, RNase A was removed by ethanol precipitation and the product was resuspended in sterile water. Next, RNase A-treated RNA was immunoprecipitated (IP) using the J2 dsRNA-specific antibody (English and Scientific Consulting Kft, Szirk, Hungary). In brief, the product of 9 g of RNase A-treated RNA was incubated in binding buffer (150 mM NaCl, 50 mM TRIS pH8.0, 1 mM EDTA, 1% NP-40) with 5 g of J2 antibody rotating overnight at 4 C. J2-bound dsRNA was incubated in biding buffer with 25 L of Dynabeads Protein G (Thermo Fisher Scientific, Waltham, MA) for 4 hours at 4 C., followed by washes in cold binding buffer. RNA was then extracted with TRIzol Reagent and expression levels of indicated genes were analyzed by qRT-PCR.
(183) Enrichment of dsRNA over ssRNA was then calculated by normalizing the delta Ct of ERVs (dsRNA) against beta-actin (ssRNA).
(184) First Strand cDNA Synthesis and Strand Specific PCR for Detection of Sense and Antisense ERV Transcripts Using TASA-TD Methodology
(185) Components from the SuperScript III First-Strand Synthesis System for RT-PCR (Thermo Fisher Scientific, Waltham, MA) were adapted to perform reverse transcription with RNA from H69AR previously pulsed with IFN 10 minutes. For first strand cDNA synthesis 400 ng RNA was used for -actin, MLT1C49, MLT1A and MLT1J. 1 M of a gene specific primer ligated to a TAG-sequence not specific for the human genome (GSP sense/antisense (RT) TAG) was implemented in the reaction. RNA and primers were preheated at 65 C. for 5 min. For the total reaction: the GSP-TAG, 0.5 mM dNTP, 5 mM MgCl2, 10 mM DTT, 40U RNaseOUT, 100U SuperScriptIII RT and 240 ng Actinomycin D (Sigma-Aldrich, St. Louis, MO) were added with the RNA for a 20 l reaction. Synthesis was performed at 50 C. for 50 minutes and terminated at 85 C. for 5 mM. RT with extremely low intrinsic RNase H activity (for cleavage of RNA from RNA/DNA duplexes) and Actinomycin D was added to prevent second strand cDNA RT resulting in antisense artifacts.sup.28. After cDNA synthesis 2U recombinant RNase H was added to each reaction and incubated 20 minutes at 37 C. Finally, the first strand cDNA mix was ethanol precipitated and resuspended in 10 l sterile water. Afterwards gene and strand specific qRT-PCR was performed using SYBR green PCR Master Mix. To amplify sense cDNA and antisense cDNA a TAG-primer and GSP sense-primer and a TAG-primer and GSP antisense-primer were used, respectively. Sense and antisense specific qRT-PCR was performed using both sense and antisense cDNA of beta-actin as an internal negative control that was previously demonstrated to have no antisense transcript.sup.29. The sequences of primers used have been listed in Table 5.
(186) TABLE-US-00007 TABLE5 PrimersusedforTASA-TDmethod SequencesforfirststrandcDNA synthesis(GSPsense/antisenseTAG) Primer (5-3) -actin GCACACGACGACAGACGACGCACCAAACATGATCTGGGT senseTAG CATCTTCTC (SEQIDNO:90) -actin GCACACGACGACAGACGACGCACGCTCGTCGTCGACAAC antisense GGCTCCGGCA TAG (SEQIDNO:91) MLT1C49 GCACACGACGACAGACGACGCACTGGAACAGAGCCCTTC senseTAG CTTG (SEQIDNO:92) MLT1C49 GCACACGACGACAGACGACGCACTATTGCCGTACTGTGG antisense GCTG TAG (SEQIDNO:93) MLT1J GCACACGACGACAGACGACGCACGATGTGGAAGTCTGGG senseTAG AAGC (SEQIDNO:94) MLT1J GCACACGACGACAGACGACGCACGCTGTTGCACACATGC antisense TCTT TAG (SEQIDNO:95) MLT1A GCACACGACGACAGACGACGCACTTGCAGATGGCTACCT senseTAG TCCT (SEQIDNO:96) MLT1A GCACACGACGACAGACGACGCACTGGGCTCTTTGGGTGA antisense TAGT TAG (SEQIDNO:97) Sequencesforgeneandstrandspecific Primer qRT-PCR(5-3) -actin GCTCGTCGTCGACAACGGCTCCGGCA sense (SEQIDNO:98) -actin CAAACATGATCTGGGTCATCTTCTC antisense (SEQIDNO:99) MLT1C49 TATTGCCGTACTGTGGGCTG sense (SEQIDNO:100) MLT1C49 TGGAACAGAGCCCTTCCTTG antisense (SEQIDNO:101) MLT1J GCTGTTGCACACATGCTCTT sense (SEQIDNO:102) MLT1J GATGTGGAAGTCTGGGAAGC antisense (SEQIDNO:103) MLT1A TGGGCTCTTTGGGTGATAGT sense (SEQIDNO:104) MLT1A TTGCAGATGGCTACCTTCCT antisense (SEQIDNO:105) TAG GCACACGACGACAGACGACGCAC sequence (SEQIDNO:106)
CRISPR-Cas9 Gene Editing and Lentiviral Infection
(187) Oligonucleotides coding for guide RNAs that target STING and MAVS genes were chosen from the Avana library and the Brunello library.sup.30. A non-targeting sgRNA from the Gecko library v2 was used as a dummy sgRNA for control.sup.31. Lenti CRISPRv2 vectors were cloned as previously described.sup.31,32. sgRNA target sequences are described on Table 6.
(188) HEK-293T cells were transduced with lentiCRISPRv2 using X-treme Gene 9 (Roche, Basel, Switzerland) according to the manufacturer's instructions. On day 2, target cells were seeded, and allowed to adhere overnight. On day 3 the supernatant of transduced HEK293T cells was collected and added to the target cells through a 0.45 m filter. Supernatant from transduced HEK293T cells was again collected and added to target cells on day 4. On day 5, puromycin or blasticidin was added to select infected cells (for four days).
(189) TABLE-US-00008 TABLE6 CRISPR-Cas9sgRNAstargetsequences TargetGene sgRNATargetSequence MAVS AGTACTTCATTGCGGCACTG (SEQIDNO:107) STING GGTACCGGGGCAGCTACTGG (SEQIDNO:108) sgCTRL ATCGTTTCGCTTAACGGCG (SEQIDNO:109)
Poly(I:C) Treatment
(190) For Poly(I:C) dsRNA treatment experiments, H69ARsgCTRL and H69ARsgMAVS cells were plated in RPMI media, transfected with 0.5 g/mL Poly(I:C) HMW (InvivoGen, Sand Diego, CA) using XtremeGene HP transfection reagent (Sigma-Aldrich, St. Louis, MO) and cultured for 72 hours. On day 3 after transfection, conditioned media was recovered and CXCL10 protein expression was quantified using Human CXCL10/IP-10 Quantikine ELISA kit (R&D Systems, Minneapolis, MN). RNA was extracted and expression levels of relevant genes were analyzed by qRT-PCR.
(191) Immunohistochemical Staining
(192) After deparaffinizing tissue blocks, antigen retrieval was achieved by wet autoclave (121 degrees Celsius, 15 min) in Antigen Retrieval Solution, pH 9 (Dako, S2367) for p-TBK1. In order to block endogenous peroxide enzyme, tissue sections were incubated for 30 minutes using Peroxidase-Blocking Solution (Dako, S2023). Then, to block non-specific background staining, tissue sections were incubated for 20 minutes with Protein Block (Dako, X0909) (human tissue) or Mouse on Mouse blocking reagent (Vector Laboratories, MKB-2213) (mouse tissue). Primary antibody specific for pTBK1 (Cell Signaling Technology, 5483; 1:50 dilution) was applied, and slides were incubated for 16 hours at 4 C. Visualization was achieved using EnVision+/HRP, Rabbit (Dako, K4003) for pTBK1, followed by diaminobenzidine (Dako, K3468), and hematoxylin counterstain. Expression levels of pTBK1 were evaluated by two pathologists who were blinded to other data.
(193) Multiplexed Immunofluorescence
(194) Multiplex Immunofluorescent staining was performed overnight for approximately 12 hours on BOND RX fully automated stainers (Leica Biosystems) as previously described.sup.33. Briefly, tissue sections of 5-m thick FFPE were baked for 3 hours at 60 C. before loading into the BOND RX. Slides were deparaffinized (BOND DeWax Solution, Leica Biosystems) and rehydrated with series of graded ethanol to deionized water. Antigen retrieval was performed in BOND Epitope Retrieval Solution 1 (ER1, Leica Biosystems) at pH 6 for 10 minutes at 98 C. Deparaffinization, rehydration and antigen retrieval were all preprogrammed and executed by the BOND RX. Next, slides were serially stained with primary antibodies, such as anti-CD8 (clone C8/144B; DAKO, dilution 1:5000). Incubation time per primary antibody was 40 minutes. Subsequently, anti-rabbit Polymeric Horseradish Peroxidase (Poly-HRP, BOND Polymer Refine Detection Kit, Leica Biosystems) was applied as a secondary label with an incubation time of 10 minutes. Signal for antibody complexes was labeled and visualized by their corresponding Opal Fluorophore Reagents (PerkinElmer) by incubating the slides for 5 minutes. The same process was repeated for the following antibodies/fluorescent dyes. Slides were air dried, mounted with Prolong Diamond Anti-fade mounting medium (#P36965, Life Technologies) and stored in a light-proof box at 4 C. prior to imaging. The target antigens, antibody clones, and dilutions for markers included in this report and details of controls are listed in Table 7.
(195) TABLE-US-00009 TABLE 7 Antibodies used for multiplexed immunofluorescence assay. Primary Opal Kit Opal Fluor Antibody Clone ID/Company Dilution Fluor Dilution Anti-CD8 C8/144B, DAKO 1:5000 Opal 520 1:100 Anti-CD4 4B12, DAKO 1:250 Opal 540 1:200 Cytokeratin AEI/AE3/DAKO 1:2000 Opal 690 1:50
Table summarizing target antigens, antibody clones, dilutions and detail of controls used for multiplexed immunofluorescence staining of NSCLC human specimens used to generate PDOTS.
Image Acquisition and Analysis
(196) Image acquisition was performed using the Mantra multispectral imaging platform (Vectra 3, PerkinElmer, Hopkinton, MA) as previously described.sup.33. Areas with non-tumor or residual normal tissue (i.e. residual lymph node) were excluded from the analysis. Representative regions of interest were chosen by the pathologist, and 5-7 fields of view (FOVs) were acquired at 20 resolution as multispectral images. Image Analysis was performed using the Inform 2.3 Image Analysis Software (PerkinElmer, Hopkinton, MA).
(197) OncoPanel Assay
(198) Somatic mutations, copy number variations and structural variants in parental H69 cells and H69M-PD-L.sup.low/H69M-PD-L1.sup.high subclones were evaluated by performing the OncoPanel assay from the Center for Advanced Molecular Diagnostics from Brighman and Women's Hospital.
(199) This OncoPanel assay surveys exonic DNA sequences of 300 cancer genes and 113 introns across 35 genes for rearrangement detection. DNA was isolated from cell lines and analyzed by massively parallel sequencing using a solution-phase Agilent SureSelect hybrid capture kit and an Illumina HiSeq 2500 sequencer.
(200) The 300 genes are: ABL1, AKT1, AKT2, AKT3, ALK, ALOX12B, APC, AR, ARAF, ARID1A, ARID1B, ARID2, ASXL1, ATM, ATRX, AURKA, AURKB, AXL, B2M, BAP1, BCL2, BCL2L1, BCL2L12, BCL6, BCOR, BCORL1, BLM, BMPR1A, BRAF, BRCA1, BRCA2, BRD4, BRIP1, BUB1B, CADM2, CARD11, CBL, CBLB, CCND1, CCND2, CCND3, CCNE1, CD274, CD58, CD79B, CDC73, CDH1, CDK1, CDK2, CDK4, CDK5, CDK6, CDK9, CDKN1A, CDKN1B, CDKN1C, CDKN2A, CDKN2B, CDKN2C, CEBPA, CHEK2, CIITA, CREBBP, CRKL, CRLF2, CRTC1, CRTC2, CSF1R, CSF3R, CTNNB1, CUX1, CYLD, DDB2, DDR2, DEPDC5, DICER1, DIS3, DMD, DNMT3A, EED, EGFR, EP300, EPHA3, EPHA5, EPHA7, ERBB2, ERBB3, ERBB4, ERCC2, ERCC3, ERCC4, ERCC5, ESR1, ETV1, ETV4, ETV5, ETV6, EWSR1, EXT1, EXT2, EZH2, FAM46C, FANCA, FANCC, FANCD2, FANCE, FANCF, FANCG, FAS, FBXW7, FGFR1, FGFR2, FGFR3, FGFR4, FH, FKBP9, FLCN, FLT1, FLT3, FLT4, FUS, GATA3, GATA4, GATA6, GLI1, GLI2, GLI3, GNA11, GNAQ, GNAS, GNB2L1, GPC3, GSTM5, H3F3A, HNF1A, HRAS, ID3, IDH1, IDH2, IGF1R, IKZF1, IKZF3, INSIG1, JAK2, JAK3, KCNIP1, KDM5C, KDM6A, DM6B, KDR, KEAP1, KIT, KRAS, LINC00894, LMO1, LMO2, LMO3, MAP2K1, MAP2K4, MAP3K1, MAPK1, MCL1, MDM2, MDM4, MECOM, MEF2B, MEN1, MET, MITF, MLH1, MLL(KMT2A), MLL2(KTM2D), MPL, MSH2, SH6, MTOR, MUTYH, MYB, MYBL1, MYC, MYCL1(MYCL), MYCN, MYD88, NBN, NEGR1, NF1, NF2, NFE2L2, NFKBIA, NFKBIZ, NIOC2-1, NOTCH1, NOTCH2, NPM1, NPRL2, NPRL3, NRAS, NTRK1, NTRK2, NTRK3, PALB2, PARK2, PAX5, PBRM1, PDCD1LG2, PDGFRA, PDGFRB, PHF6, PHOX2B, PIK3C2B, PIK3CA, PIK3R1, PIM1, PMS1, PMS2, PNRC1, PRAME, PRDM1, PRF1, PRKAR1A, PRKCI, PRKCZ, PRKDC, PRPF40B, PRPF8, PSMD13, PTCH1, PTEN, PTK2, PTPN11, PTPRD, QKI, RAD21, RAF1, RARA, RB1, RBL2, RECQL4, REL, RET, RFWD2, RHEB, RHPN2, ROS1, RPL26, RUNX1, SBDS, SDHA, SDHAF2, SDHB, SDHC, SDHD, SETBP1, SETD2, SF1, SF3B1, SH2B3, SLITRK6, SMAD2, SMAD4, SMARCA4, SMARCB1, SMCIA, SMC3, SMO, SOCS1, SOX2, SOX9, SQSTM1, SRC, SRSF2, STAG1, STAG2, STAT3, STAT6, STK11, SUFU, SUZ12, SYK, TCF3, TCF7L1, TCF7L2, TERC, TERT, TET2, TLR4, TNFAIP3, TP53, TSC1, TSC2, U2AF1, VHL, WRN, WT1, XPA, XPC, XPO1, ZNF217, ZNF708, ZRSR2.
(201) Intronic regions are tiled on specific introns of ABL1, AKT3, ALK, BCL2, BCL6, BRAF, CIITA, EGFR, ERG, ETV1, EWSR1, FGFR1, FGFR2, FGFR3, FUS, IGH, IGL, JAK2, MLL, MYC, NPM1, NTRK1, PAX5, PDGFRA, PDGFRB, PPARG, RAF1, RARA, RET, ROS1, SS18, TRA, TRB, TRG, TMPRSS2.
(202) ATAC-Sequencing and Analysis
(203) ATAC sequencing was performed on H69 and H69AR cells according to.sup.34.
(204) Briefly, 40-50,000 cells were sorted per biological replicate, which were then washed once in cold PBS and lysed in 50 L cold lysis buffer (10 mM Tris-HCl, pH 7.4, 10 mM NaCl, 3 mM MgCl2, 0.1% IGEPAL CA-630). Lysed nuclei were incubated in Tn5 transposition reaction mix and purified using MinElute Reaction Cleanup kit (Qiagen). ATAC-seq fragments from one set of replicates for H69 and H69AR cells were size selected for fragments between 115 and 600 bp using Pippin Prep 2% Agarose Gel Cassettes and the Pippin Prep DNA Size Selection System (Sage Science). Post size-selection, ATAC libraries were amplified and Nextera sequencing primers ligated using Polymerase Chain Reaction (PCR). Finally, PCR primers were removed using Agencourt AMPure XP bead cleanup (Beckman Coulter/Agencourt) and library quality was verified using a Tapestation machine. High quality multiplexed DNA libraries were sequenced on the Illumina HiSeq2000.
(205) The ends of the paired-end fragments are used as cut sites and enriched peaks were called with MACS2 with following parameters (-nomodel-extsize 200-shift-100-g hs-B-nolambda). For IGV visualization, shifted bedGraph were converted to wig files at 10 bp resolution and normalized to read counts by wigmath tool of JavaGenomic toolkit.
(206) Genomic Analysis and SPARCS Gene Set Derivation
(207) The H69 vs H69M expression microarray data analyzed in this study were obtained from the publicly available dataset GSE45120.
(208) ChIP-seq data for STAT1 and IRF1 data on CD14+ monocytes were retrieved from GEO database (GSE43036). Replicates data for each ChIP were aggregated into a single wiggle file and visualized in IGV genome browser at the locus of TRIM22 gene.sup.35.
(209) Genomic coordinates of all 3UTR from NCBI RefSeq transcripts were intersected with all repeat elements that are 50 bp or longer and have its family name containing a string ERV from UCSC Repeat Masker. Those 5880 3UTRs that overlap with any ERVs were collapsed to the gene level. Those 1,080 unique genes were further used to find overlaps with differentially expressed gene from an analysis comparing H69M vs H69. Of 452 significantly upregulated genes (adjP<1E-4 and logFC>2) in H69M, 22 genes were found overlapped. As only 86 genes were identified at the same threshold, the same number of genes (452) most significantly downregulated genes at logFC<1 were used to find overlaps with the genes containing ERV in its 3 UTR (25 genes).
(210) Gene Set Enrichment Analysis
(211) SPARCS signature was created by overlapping 3UTR repeat elements from Ref Seq with genes upregulated in H69M when compared to parental H69.sup.5. The SPARCS gene set scores across CCLE (broadinstitute.org/CCLE) or TCGA (Pancan12).sup.17 were derived by using ssGSEA algorithm.sup.36. These scores were used to identify top associated features from the matching datasets containing profiles of mRNA, pathways (MsigDB), and mutations/copy number variation data (broadinstitute.org/CCLE). To quantify the degree of association, an information-theoretic measure Information Coefficient (IC).sup.18 was used and an empirical permutation test for statistical significance calculations.
(212) Statistical Analyses
(213) All graphs depict means.d. unless otherwise indicated. Tests for differences between two groups were performed using two-tailed unpaired Student's t-test or Mann-Whitney's two-tailed test, as specified in the figure legends. Two-way ANOVA with a Sidak post hoc test was performed to compare tumor growth between groups in xenograft studies. P values were considered significant if less than 0.05. Asterisks used to indicate significance correspond with: *p<0.05, **p<0.01, ***p<0.001. GraphPad Prism7 was used for statistical analysis of experiments, data processing and presentation.
REFERENCES
(214) 1 Hanahan, D. & Weinberg, R. A. Hallmarks of cancer: the next generation. Cell 144, 646-674, doi:10.1016/j.cell.2011.02.013 (2011). 2 Marusyk, A. et al. Non-cell-autonomous driving of tumour growth supports sub-clonal heterogeneity. Nature 514, 54-58, doi:10.1038/nature13556 (2014). 3 Junttila, M. R. & de Sauvage, F. J. Influence of tumour micro-environment heterogeneity on therapeutic response. Nature 501, 346-354, doi:10.1038/nature12626 (2013). 4 Tabassum, D. P. & Polyak, K. Tumorigenesis: it takes a village. Nat Rev Cancer 15, 473-483, doi:10.1038/nrc3971 (2015). Canadas, I. et al. Targeting epithelial-to-mesenchymal transition with Met inhibitors reverts chemoresistance in small cell lung cancer. Clin Cancer Res 20, 938-950, doi:10.1158/1078-0432.CCR-13-1330 (2014). 6 Calbo, J. et al. A functional role for tumor cell heterogeneity in a mouse model of small cell lung cancer. Cancer Cell 19, 244-256, doi:10.1016/j.ccr.2010.12.021 (2011). 7 Konieczkowski, D. J. et al. A melanoma cell state distinction influences sensitivity to MAPK pathway inhibitors. Cancer Discov 4, 816-827, doi:10.1158/2159-8290.CD-13-0424 (2014). 8 Tirosh, I. et al. Dissecting the multicellular ecosystem of metastatic melanoma by single-cell RNA-seq. Science 352, 189-196, doi:10.1126/science.aad0501 (2016). 9 Crescenzo, R. et al. Convergent mutations and kinase fusions lead to oncogenic STAT3 activation in anaplastic large cell lymphoma. Cancer Cell 27, 516-532, doi:10.1016/j.ccell.2015.03.006 (2015). 10 Wu, X. et al. AXL kinase as a novel target for cancer therapy. Oncotarget 5, 9546-9563, doi:10.18632/oncotarget.2542 (2014). 11 Chiappinelli, K. B. et al. Inhibiting DNA Methylation Causes an Interferon Response in Cancer via dsRNA Including Endogenous Retroviruses. Cell 162, 974-986, doi:10.1016/j.cell.2015.07.011 (2015). 12 Roulois, D. et al. DNA-Demethylating Agents Target Colorectal Cancer Cells by Inducing Viral Mimicry by Endogenous Transcripts. Cell 162, 961-973, doi:10.1016/j.cell.2015.07.056 (2015). 13 Chuong, E. B., Elde, N. C. & Feschotte, C. Regulatory evolution of innate immunity through co-option of endogenous retroviruses. Science 351, 1083-1087, doi:10.1126/science.aad5497 (2016). 14 Gao, D. et al. Cyclic GMP-AMP synthase is an innate immune sensor of HIV and other retroviruses. Science 341, 903-906, doi:10.1126/science.1240933 (2013). 15 Poirier, J. T. et al. DNA methylation in small cell lung cancer defines distinct disease subtypes and correlates with high expression of EZH2. Oncogene 34, 5869-5878, doi:10.1038/onc.2015.38 (2015). 16 Henke, C. et al. Selective expression of sense and antisense transcripts of the sushi-ichi-related retrotransposon-derived family during mouse placentogenesis. Retrovirology 12, 9, doi:10.1186/s12977-015-0138-8 (2015). 17 Hoadley, K. A. et al. Multiplatform analysis of 12 cancer types reveals molecular classification within and across tissues of origin. Cell 158, 929-944, doi:10.1016/j.cell.2014.06.049 (2014). 18 Kim, J. W. et al. Characterizing genomic alterations in cancer by complementary functional associations. Nat Biotechnol 34, 539-546, doi:10.1038/nbt.3527 (2016). 19 Rhodes, D. A., Reith, W. & Trowsdale, J. Regulation of Immunity by Butyrophilins. Annu Rev Immunol 34, 151-172, doi:10.1146/annurev-immunol-041015-055435 (2016). 20 Bindea, G. et al. Spatiotemporal dynamics of intratumoral immune cells reveal the immune landscape in human cancer. Immunity 39, 782-795, doi:10.1016/j.immuni.2013.10.003 (2013). 21 Jenkins, R. W. et al. Ex Vivo Profiling of PD-1 Blockade Using Organotypic Tumor Spheroids. Cancer Discov, doi:10.1158/2159-8290.CD-17-0833 (2017). 22 Pan, D. et al. A major chromatin regulator determines resistance of tumor cells to T cell-mediated killing. Science, doi:10.1126/science.aao1710 (2018). 23 Miao, D. et al. Genomic correlates of response to immune checkpoint therapies in clear cell renal cell carcinoma. Science, doi:10.1126/science.aan5951 (2018). 24 Manguso, R. T. et al. In vivo CRISPR screening identifies Ptpn2 as a cancer immunotherapy target. Nature 547, 413-418, doi:10.1038/nature23270 (2017). 25 Peng, D. et al. Epigenetic silencing of TH1-type chemokines shapes tumour immunity and immunotherapy. Nature 527, 249-253, doi:10.1038/nature15520 (2015). 26 Christensen, C. L. et al. Targeting transcriptional addictions in small cell lung cancer with a covalent CDK7 inhibitor. Cancer Cell 26, 909-922, doi:10.1016/j.ccell.2014.10.019 (2014). 27 Aref, A. R. et al. Screening therapeutic EMT blocking agents in a three-dimensional microenvironment. Integr Biol (Camb) 5, 381-389, doi:10.1039/c2ib20209c (2013). 28 Perocchi, F., Xu, Z., Clauder-Munster, S. & Steinmetz, L. M. Antisense artifacts in transcriptome microarray experiments are resolved by actinomycin D. Nucleic Acids Res 35, e128, doi:10.1093/nar/gkm683 (2007). 29 Chen, J. et al. Over 20% of human transcripts might form sense-antisense pairs. Nucleic Acids Res 32, 4812-4820, doi:10.1093/nar/gkh818 (2004). 30 Doench, J. G. et al. Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol 34, 184-191, doi:10.1038/nbt.3437 (2016). 31 Sanjana, N. E., Shalem, 0. & Zhang, F. Improved vectors and genome-wide libraries for CRISPR screening. Nat Methods 11, 783-784, doi:10.1038/nmeth.3047 (2014). 32 Shalem, O. et al. Genome-scale CRISPR-Cas9 knockout screening in human cells. Science 343, 84-87, doi:10.1126/science.1247005 (2014). 33 Carey, C. D. et al. Topological analysis reveals a PD-L1-associated microenvironmental niche for Reed-Sternberg cells in Hodgkin lymphoma. Blood 130, 2420-2430, doi:10.1182/blood-2017-03-770719 (2017). 34 Sen, D. R. et al. The epigenetic landscape of T cell exhaustion. Science 354, 1165-1169, doi:10.1126/science.aae0491 (2016). 35 Qiao, Y. et al. Synergistic activation of inflammatory cytokine genes by interferon-gamma-induced chromatin remodeling and toll-like receptor signaling. Immunity 39, 454-469, doi:10.1016/j.immuni.2013.08.009 (2013). 36 Barbie, D. A. et al. Systematic RNA interference reveals that oncogenic KRAS-driven cancers require TBK1. Nature 462, 108-112, doi:10.1038/nature08460 (2009).
Example 2: STING Levels
(215) STING Levels Vary Widely in KRAS Mutant Lung Cancer and Correlate with LKB1 and DNMT1 Status
(216) KRAS mutant non-small cell lung cancer (NSCLC) is a heterogeneous disease, and co-mutation of the tumor suppressor genes p53 or LKB1 defines different subtypes. KRAS; p53 mutant (KP) or KRAS;LKB1 mutant (KL) NSCLC cells exhibit divergent gene expression profiles and sensitivity to immune therapies. For example, KL NSCLC showed significantly lower expression of immune checkpoint molecules such as PD-L1 compared with KP NSCLC, implying less efficacy to PD-L1 targeted therapy in KL NSCLC patients (2, 3)
(217) Using the Cancer Cell Line Encyclopedia (CCLE) database (4), differentially expressed genes between KP and KL cell lines were first extracted. Of those genes, 48 genes were highly expressed in KP cell lines, and also annotated as immune-related genes based on Gene Ontology (GO) term. TMEM173/STING (hereafter STING) is a critical regulator of innate immune response to cytosolic double strand DNA, and one of the top-ranked genes in this list. It was next demonstrated that STING expression was higher in KP cell lines in both mRNA and protein levels (
(218) Given these data, it was next examined whether LKB1 directly regulates STING expression in KRAS mutant lung cancer. Interestingly, LKB1 reconstitution clearly increased STING expression in specific KL cell lines such as H1944, H2122 and H1355 (
(219) It was next examined whether increased STING expression following LKB1 reconstitution in KL cells altered their innate immune responsiveness to dsDNA. Transfection of a synthetic analogue of B-DNA, poly(dA:dT), strongly activated STING downstream pathway including TBK1 and IRF3 in LKB1 reconstituted KL cells compared with control cells (
(220) Regulation of STING by EZH2 in Small Cell Lung Cancer
(221) More broadly, epigenetic silencing, including regulation of specific histone modifications, is increasingly recognized in addition to DNA methylation as an important determinant in cancer immunology and immunotherapy response. For example, EZH2, which promotes histone H3K27 trimethylation and silencing of gene transcription, has been shown to play a key role in regulating Th1 chemokine expression and CD8(+) T cell infiltration in certain tumors (6), although the mechanism has been incompletely characterized. Interestingly, recent studies have implicated Endogenous Retrovirus (ERV) reactivation following DNA methyltransferase (DNMT) as a specific mechanism that may prime tumor immune responses through recognition of dsRNA and potentially dsDNA, suggesting a potentially synergistic approach to enhance immunogenicity in combination with PD-1 immune checkpoint blockade (7, 8).
(222) Along these lines, by exploiting a human Small Cell Lung Cancer Model (SCLC) that exhibits tumor cell heterogeneity (H69 cells), an epigenetically regulated subclass of ERVs that promotes pathologic innate immune signaling, termed Stimulated 3 Prime Antisense Retroviral Coding Sequences (SPARCS) was recently identified (Canadas et al., Nature Medicine, in revision). These ERVs are poised to undergo positive feedback signal amplification due to their antisense localization in 3 UTRs of IFN stimulated genes, resulting dsRNA production, viral sensing, and positive feedback induction of their expression by IFN. Whereas neuroendocrine SCLC cells and other epithelial cancer cell lines silence these genes, mesenchymal subclones with high AXL/MET expression and low EZH2 levels are particularly susceptible to triggering SPARCS expression when exposed to IFN. Furthermore, it was directly demonstrated that these ERVs are silenced by EZH2, since treatment with an EZH2 inhibitor (GSK126) induced their reactivation in parental neuroendocrine H69 cells.
(223) Given the above observations differences in STING levels between the parental neuroendocrine cell line H69 and the derivative drug-resistant subclones H69M and H69AR were also examined. Interestingly it was found that, in contrast to H69 cells, the resistant subclones expressed high levels of STING, as well as the H69M-PD-L1 hi g h subpopulation (
(224) Variability of STING Expression Across Human Cancer Types
(225) To determine the broader relevance of STING expression in cancer, as well as specific features linked to the SPARCS.sup.high state, STING expression across SPARCS.sup.high and SPARCS.sup.low cell lines was explored using the Cancer Cell Line Encyclopedia (CCLE) database. Interestingly, a robust and significant association of SPARCS.sup.high cell lines with high levels of STING was observed when compared with SPARCS.sup.low cell lines (
(226) Finally, it was observed that within this larger panel of cell lines, triple negative breast cancer (TNBC) cells (MDA-MB-231, HCC1143, MDA-MB-468) were STING positive, whereas estrogen receptor positive (ER+) cells (T47D, MDA-MB-453) were STING negative. Therefore a larger panel of breast cancer cell lines was characterized to determine if this trend held up. Indeed, whereas 5/6 TNBC cell expressed detectable levels of STING (1569, 1143, 70, 468, and 231), all 3 ER+ cell lines were STING negative (CAMA-1, T47D, and MCF7). These data suggest that TNBC in particular is a tumor type in which focused examination of STING levels in tumors and deployment of STING agonists+/PD-1 blockade may have significant therapeutic impact. As above, it is also likely that epigenetic inhibitors (e.g. DNMT or EZH2) may convert STING.sup.low TNBC tumors or ER+ cell lines into STING.sup.high and prime them to respond to STING directed immunotherapy approaches.
REFERENCES
(227) 1. Barber G N. STING: infection, inflammation and cancer. Nat Rev Immunol. 2015; 15(12):760-70. 2. Skoulidis F, Byers L A, Diao L, Papadimitrakopoulou V A, Tong P, Izzo J, Behrens C, Kadara H, Parra E R, Canales J R, et al. Co-occurring Genomic Alterations Define Major Subsets of KRAS-Mutant Lung Adenocarcinoma with Distinct Biology, Immune Profiles, and Therapeutic Vulnerabilities. Cancer Discov. 2015; 5(8):860-77. 3. Koyama S, Akbay E A, Li Y Y, Aref A R, Skoulidis F, Herter-Sprie G S, Buczkowski K A, Liu Y, Awad M M, Denning W L, et al. STK11/LKB1 deficiency promotes neutrophil recruitment and proinflammatory cytokine production to suppress T cell activity in the lung tumor microenvironment. Cancer Res. 2016. 4. Barretina J, Caponigro G, Stransky N, Venkatesan K, Margolin A A, Kim S, Wilson C J, Lehar J, Kryukov G V, Sonkin D, et al. The Cancer Cell Line Encyclopedia enables predictive modelling of anticancer drug sensitivity. Nature. 2012; 483(7391):603-7. 5. Kottakis F, Nicolay B N, Roumane A, Karnik R, Gu H, Nagle J M, Boukhali M, Hayward M C, Li Y Y, Chen T, et al. LKB1 loss links serine metabolism to DNA methylation and tumorigenesis. Nature. 2016; 539(7629):390-5. 6. Peng D, Kryczek I, Nagarsheth N, Zhao L, Wei S, Wang W, Sun Y, Zhao E, Vatan L, Szeliga W, et al. Epigenetic silencing of TH1-type chemokines shapes tumour immunity and immunotherapy. Nature. 2015; 527(7577):249-53. 7. Chiappinelli K B, Strissel P L, Desrichard A, Li H, Henke C, Akman B, Hein A, Rote N S, Cope L M, Snyder A, et al. Inhibiting DNA Methylation Causes an Interferon Response in Cancer via dsRNA Including Endogenous Retroviruses. Cell. 2015; 162(5):974-86. 8. Roulois D, Loo Yau H, Singhania R, Wang Y, Danesh A, Shen S Y, Han H, Liang G, Jones P A, Pugh T J, et al. DNA-Demethylating Agents Target Colorectal Cancer Cells by Inducing Viral Mimicry by Endogenous Transcripts. Cell. 2015; 162(5):961-73.
Example 3: STING Levels in Breast Cancer Subtypes
(228) STING protein expression was measured in different breast cancer cell subtypes by western blot analysis on protein extracts from the breast cancer cell lines. Western results are shown in
(229) TNBC cell lines were also assayed for their responsiveness to the STING agonist AduroS100. Cells were treated with AduroS100 or a control and CXCL10 levels secreted into the supernatant were measured. As is shown in
EQUIVALENTS
(230) While several inventive embodiments have been described and illustrated herein, those of ordinary skill in the art will readily envision a variety of other means and/or structures for performing the function and/or obtaining the results and/or one or more of the advantages described herein, and each of such variations and/or modifications is deemed to be within the scope of the inventive embodiments described herein. More generally, those skilled in the art will readily appreciate that all parameters, dimensions, materials, and configurations described herein are meant to be exemplary and that the actual parameters, dimensions, materials, and/or configurations will depend upon the specific application or applications for which the inventive teachings is/are used. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific inventive embodiments described herein. It is, therefore, to be understood that the foregoing embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed. Inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein. In addition, any combination of two or more such features, systems, articles, materials, kits, and/or methods, if such features, systems, articles, materials, kits, and/or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure.
(231) All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.
(232) All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
(233) The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.
(234) The phrase and/or, as used herein in the specification and in the claims, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with and/or should be construed in the same fashion, i.e., one or more of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
(235) As used herein in the specification and in the claims, or should be understood to have the same meaning as and/or as defined above. For example, when separating items in a list, or or and/or shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as only one of or exactly one of, or, when used in the claims, consisting of, will refer to the inclusion of exactly one element of a number or list of elements. In general, the term or as used herein shall only be interpreted as indicating exclusive alternatives (i.e. one or the other but not both) when preceded by terms of exclusivity, such as either, one of, only one of, or exactly one of. Consisting essentially of, when used in the claims, shall have its ordinary meaning as used in the field of patent law.
(236) As used herein in the specification and in the claims, the phrase at least one, in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase at least one refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, at least one of A and B (or, equivalently, at least one of A or B, or, equivalently at least one of A and/or B) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
(237) It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
(238) In the claims, as well as in the specification above, all transitional phrases such as comprising, including, carrying, having, containing, involving, holding, composed of, and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases consisting of and consisting essentially of shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.