ANTIVIRAL COMPOSITION AGAINST INFLUENZA A VIRUS
20240018218 ยท 2024-01-18
Inventors
- Tai Hyun KIM (Gyeonggi-do, KR)
- Young Jun KIM (Gyeongsangbuk-do, KR)
- Kwang Ji OH (Daejeon, KR)
- Gun Sup LEE (Jeollabuk-do, KR)
- Yong Jun LEE (Gyeonggi-do, KR)
Cpc classification
C07K2317/14
CHEMISTRY; METALLURGY
International classification
Abstract
An antiviral composition includes an antibody or a fragment thereof, which includes a heavy chain CDR1 (VH CDR1) represented by SEQ ID NO: 1, VH CDR2 represented by SEQ ID NO: 2, VH CDR3 represented by SEQ ID NO: 3, a light chain CDR1 (VL CDR1) represented by SEQ ID NO: 4, VL CDR2 represented by SEQ ID NO: 5, and VL CDR3 represented by SEQ ID NO: 6, so as to exhibit excellent antiviral effects to influenza A virus, while achieving effects of preventing, treating or improving diseases derived from influenza A virus.
Claims
1: An antiviral composition for influenza A virus, comprising an antibody or a functional fragment thereof, the antibody comprising: a heavy chain CDR1 (VH CDR1) represented by SEQ ID NO: 1; VH CDR2 represented by SEQ ID NO: 2; VH CDR3 represented by SEQ ID NO: 3; a light chain CDR1 (VL CDR1) represented by SEQ ID NO: 4; VL CDR2 represented by SEQ ID NO: 5; and VL CDR3 represented by SEQ ID NO: 6.
2: The antiviral composition according to claim 1, wherein the antibody or the functional fragment thereof includes a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 7.
3: The antiviral composition according to claim 1, wherein the antibody or the functional fragment thereof includes a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
4: The antiviral composition according to claim 1, wherein the functional fragment is scFv comprising the amino acid sequence of SEQ ID NO: 9.
5: The antiviral composition according to claim 1, wherein the influenza A virus is at least one selected from the group consisting of influenza A virus H1 subtype, influenza A virus H2 subtype, influenza A virus H5 subtype and influenza A virus H6 subtype, influenza A virus H3 subtype, influenza A virus H4 subtype, influenza A virus H14 subtype, and variants thereof.
6: The antiviral composition according to claim 1, wherein the influenza A virus is at least one selected from the group consisting of influenza A virus N1 subtype, influenza A virus N2 subtype, and variants thereof.
7: The antiviral composition according to claim 1, wherein the influenza A virus is at least one of H1N1 subtype, H3N2 subtype, and variants thereof.
8: The antiviral composition according to claim 1, wherein the influenza A virus is an oseltamivir-resistant influenza A virus.
9: A method for treating an influenza A virus-infectious disease, the method comprising: administering the antiviral composition of claim 1 to a subject in need thereof.
10. (canceled)
11. (canceled)
12. (canceled)
13: The method of claim 9, wherein the antibody or the functional fragment thereof includes a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 7.
14: The method of claim 9, wherein the antibody or the functional fragment thereof includes a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8.
15: The method of claim 9, wherein the functional fragment is scFv comprising the amino acid sequence of SEQ ID NO: 9.
16: The method of claim 9, wherein the influenza A virus is at least one selected from the group consisting of influenza A virus H1 subtype, influenza A virus H2 subtype, influenza A virus H5 subtype and influenza A virus H6 subtype, influenza A virus H3 subtype, influenza A virus H4 subtype, influenza A virus H14 subtype, and variants thereof.
17: The method of claim 9, wherein the influenza A virus is at least one selected from the group consisting of influenza A virus N1 subtype, influenza A virus N2 subtype, and variants thereof.
18: The method of claim 9, wherein the influenza A virus is at least one of H1N1 subtype, H3N2 subtype, and variants thereof.
19: The method of claim 9, wherein the influenza A virus is an oseltamivir-resistant influenza A virus.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DETAILED DESCRIPTION
[0047] Hereinafter, the present invention will be described in detail.
[0048] The present invention provides an antiviral composition for influenza A virus, including an antibody or fragment thereof which includes: a heavy chain CDR1 (VH CDR1) represented by SEQ ID NO: 1; VH CDR2 represented by SEQ ID NO: 2; VH CDR3 represented by SEQ ID NO: 3; a light chain CDR1 (VL CDR1) represented by SEQ ID NO: 4; VL CDR2 represented by SEQ ID NO: 5; and VL CDR3 represented by SEQ ID NO: 6.
[0049] The term complementarity determining region (CDR) refers to a region involved in antigen recognition, wherein the specificity of the antibody to an antigen is determined when a sequence of this region changes. As used herein, the VH CDR refers to a heavy chain complementarity determining region present in a heavy chain variable region, and the VL CDR refers to a light chain complementarity determining region present in a light chain variable region.
[0050] The term variable region refers to a region that shows sequence variation while performing a function of specifically binding to an antigen, and CDR1, CDR2 and CDR3 exist in the variable region. A framework region (FR) portion exists between the CDRs, which may serve to support the CDRs. Irrespective of the framework regions, CDRs may be important regions that allow an antibody or fragment thereof to exhibit specific functions.
[0051] The antibody or fragment thereof may include the heavy chain variable region which includes: a heavy chain CDR1 (VH CDR1) represented by SEQ ID NO: 1, VH CDR2 represented by SEQ ID NO: 2, and VH CDR3 represented by SEQ ID NO: 3; and a light chain variable region which includes: a light chain CDR1 (VL CDR1) represented by SEQ ID NO: 4, VL CDR2 represented by SEQ ID NO: 5, and VL CDR3 represented by SEQ ID NO: 6.
[0052] The antibody or fragment thereof may include a heavy chain variable region which includes an amino acid sequence of SEQ ID NO: 7. According to one embodiment, the antibody or fragment thereof may include a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 7.
[0053] The antibody or fragment thereof may include a light chain variable region which includes an amino acid sequence of SEQ ID NO: 8. According to one embodiment, the antibody or fragment thereof may include a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8.
[0054] A fragment of antibody (antibody fragment) may be at least one selected from the group consisting of single chain antibodies, Fv, scFv, di-scFv, Fab, Fab, F(ab).sub.2, Fd, LC, dAb, CDR, scFv-Fc, and diabodies.
[0055] The antibody fragment may include an amino acid sequence of SEQ ID NO: 9. According to one embodiment, the antibody fragment may consist of the amino acid sequence of SEQ ID NO: 9. According to one embodiment, the antibody fragment may consist of scFv including the amino acid sequence of SEQ ID NO: 9.
[0056] An antibody or fragment thereof may be a humanized antibody or fragment thereof; a chimeric antibody or fragment thereof. Humanized antibodies may be prepared by methods known in the art.
[0057] According to an embodiment, the antibody fragment may be a humanized scFv including CDR sequences of the scFv of SEQ ID NO: 9.
[0058] The antibody or fragment thereof may penetrate into the cytoplasm of a virus-infected host cell. The penetrating effect of the antibody or fragment thereof into the cytoplasm may be considered to be due to Caveolae mediated endocytosis.
[0059] The antibody or fragment thereof according to the present invention may specifically bind to a nucleic acid of influenza A virus. In particular, the antibody or fragment thereof according to the present invention may specifically bind to RNA of influenza A virus. The antibody or fragment thereof according to the present invention has nuclease activity and can degrade RNA and DNA of viruses.
[0060] The antibody or fragment thereof according to the present invention can penetrate into the cytoplasm of a host infected with influenza A virus, and it may induce a decrease in amount of viral gene replication and a decrease in the viral protein by removing naked viral RNA from the infected cells, while having the efficacy of virus treatment.
[0061] Influenza A virus as a surface antigen may be divided into hemagglutinin (HA) subtype and neuraminidase (NA) subtype or variants thereof.
[0062] The mutant may be a mutant of influenza A virus subtype, for example, may be one in which a mutation in hemagglutinin and/or neuraminidase of the influenza A virus occurs.
[0063] Specifically, the mutant is a mutant of the influenza A virus subtype, and may be one in which a mutation in neuraminidase of the influenza A virus occurs thus to exhibit Oseltamivir (Tamiflu) resistance. For example, the variant may be H1N1/H275Y. H1N1/H275Y is a protein mutation resulting from H1N1/pdm09.
[0064] The functional mechanism of Tamiflu is to inhibit the spike protein of neuraminidase of H1N1 and thus prevent spreading thereof. H1N1/H275Y in which amino acid mutation of H275Y of neuraminidase of H1N1 occurs has very weak binding force between neuraminidase and Tamiflu, thereby exhibiting Tamiflu resistance. Hemagglutinin may serve to recognize the surface of a host cell and penetrate into the cell. Further, it may induce different inflammatory responses inside the cell and serve to self-replication.
[0065] Influenza A virus may be formed in various subtypes defined by hemagglutinin or variants thereof.
[0066] The subtypes defined by hemagglutinin may include H1 subtype, H2 subtype, H3 subtype, H4 subtype, H5 subtype, H6 subtype, H7 subtype, H8 subtype, H9 subtype, H10 subtype, H11 subtype, H12 subtype, H13 subtype, H14 subtype, H15 subtype, and H16 subtype (
[0067] Influenza A virus may be any of subtypes, for example: a subtype including H1 hemagglutinin, a subtype including H2 hemagglutinin, a subtype including H3 hemagglutinin, a subtype including H4 hemagglutinin, a subtype including H5 hemagglutinin, a subtype including H6 hemagglutinin, a subtype including H7 hemagglutinin, a subtype including H8 hemagglutinin, a subtype including H9 hemagglutinin, a subtype including H10 hemagglutinin, a subtype including H11 hemagglutinin, a subtype including H12 hemagglutinin, a subtype including H13 hemagglutinin, a subtype including H14 hemagglutinin, a subtype including H15 hemagglutinin, a subtype including H16 hemagglutinin, and/or variants thereof.
[0068] The influenza A virus may be at least one of the remaining 15 subtypes except for H1 subtype among 16 subtypes defined by hemagglutinin (HA).
[0069] For example, the antibody or fragment thereof according to the present invention may exhibit antiviral efficacy to at least one selected from the group consisting of influenza A virus H1 subtype, influenza A virus H2 subtype, influenza A virus H5 subtype, influenza A virus H6 subtype, influenza A virus H3 subtype, influenza A virus H4 subtype, influenza A virus H14 subtype, and variants thereof. According to one embodiment, the antibody or fragment thereof according to the present invention may exhibit antiviral efficacy to at least one selected from the group consisting of influenza A virus H1 subtype, influenza A virus H3 subtype, and variants thereof.
[0070] Further, the influenza A virus may include a variety of subtypes and variants thereof defined by neuraminidase (NA).
[0071] Neuraminidase is an enzyme acting as a scissor so that the virus proliferated in the host cell can break through the cell membrane, and may play a key role in the spread of the virus.
[0072] For example, the influenza A virus may include influenza A virus N1 subtype, N2 subtype, N3 subtype, N4 subtype, N5 subtype, N6 subtype, N7 subtype, N8 subtype, N9 subtype, and variants thereof.
[0073] The influenza A virus may be a subtype including N1 neuraminidase, a subtype including N2 neuraminidase, and variants thereof.
[0074] According to one embodiment, the antibody or fragment thereof according to the present invention may exhibit antiviral efficacy to at least one selected from the group consisting of influenza A virus N1 subtype, influenza A virus N2 subtype, and variants thereof.
[0075] According to one embodiment, the antibody or fragment thereof according to the present invention may exhibit antiviral efficacy to at least one selected from the group consisting of H1N1 subtype, H3N2 subtype, and variants thereof. For example, the antibody or fragment thereof according to the present invention may exhibit antiviral efficacy to H1N1/PR8, H3N2/X-31, H1N1/H275Y virus strains.
[0076] Further, the present invention provides a pharmaceutical composition for prevention or treatment of influenza A virus-infectious diseases, which includes the above-described antiviral composition.
[0077] Since the antiviral composition, the antibody or fragment thereof, and influenza A virus have been described above, and therefore will not be described in detail.
[0078] Specifically, the present invention provides a pharmaceutical composition capable of treating influenza A virus-infectious diseases, which includes the above-described antiviral composition.
[0079] The term prevention refers to any action that suppresses a disease caused by a virus or delays the onset of the disease.
[0080] The term treatment refers to any action that improves or beneficially changes symptoms of a disease caused by a virus.
[0081] Influenza A virus may be a subtype defined by hemagglutinin (HA) or a variant thereof. The subtypes defined by hemagglutinin (HA) may include H1 subtype, H2 subtype, H3 subtype, H4 subtype, H5 subtype, H6 subtype, H7 subtype, H8 subtype, H9 subtype type, H10 subtype, H11 subtype, H12 subtype, H13 subtype, H14 subtype, H15 subtype and H16 subtype (
[0082] According to one embodiment, the influenza A virus may be at least one selected from the group consisting of H1N1 subtype, H3N2 subtype, and variants thereof.
[0083] Influenza A virus-infectious diseases may include fever, vomiting, diarrhea, malaise, cough, dyspnea, pneumonia, headache, muscle pain, sputum, sore throat, flu, cold, pain/pressure in the chest, and sudden dizziness, however, they are not limited thereto so long as they are diseases caused by viral infection.
[0084] The influenza A virus-infectious disease is not limited so long as it is a disease with clinical symptoms of influenza A.
[0085] The pharmaceutical composition of the present invention may be used alone or in combination with conventional methods using surgery, drug therapy, and biological response modifiers for prevention and treatment of diseases.
[0086] The pharmaceutical composition may include an additional component effective to influenza A virus infection, and the additional component may be any component known to be effective to viral infection, which includes compounds, natural products, proteins, peptides, nucleic acids and the like.
[0087] The pharmaceutical composition may further include suitable carriers, excipients and diluents commonly used in the preparation of the composition. Such carriers, excipients and diluents may include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate, mineral oil or the like.
[0088] The pharmaceutical composition of the present invention may be formulated in oral dosage forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, external preparations, suppositories, and sterile injection solutions according to conventional methods, and such formulations may be performed by a method commonly performed in the pharmaceutical field. In the case of formulation, it may be prepared by additionally applying diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
[0089] Solid preparations for oral administration may include tablets, pills, powders, granules, capsules, etc., and such solid preparations may include at least one excipient, for example, starch, calcium carbonate, sucrose or lactose, gelatin, etc. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used. Liquid formulations for oral administration may include suspensions, internal solutions, emulsions, syrups, etc., and various excipients such as wetting agents, sweeteners, fragrances, and preservatives, other than water and liquid paraffin, which are commonly used simple diluents, may be included. Formulations for parenteral administration may include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations and suppositories. As the non-aqueous agent and suspending agent, propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used. As the base of the suppository, witepsol, macrogol, tween, cacao butter, laurin, glycerogelatin, etc. may be used.
[0090] Further, the present invention provides a food composition for prevention or improvement of influenza A virus-infectious diseases, which includes the above-described antiviral composition.
[0091] The antiviral compositions, antibodies or fragments thereof, influenza A virus and diseases have been described above, and therefore will not be described in detail.
[0092] Specifically, the present invention provides a food composition capable of improving influenza A virus-infectious diseases, which includes the above-described antiviral composition.
[0093] The term improvement refers to any action that reduces the symptoms of a disease caused by a virus.
[0094] The food composition may be used together with other foods or food ingredients, and may be appropriately used according to a conventional method.
[0095] A mixing amount of the active ingredient included in the food composition may be suitably determined according to the purpose of its use (for prevention or improvement).
[0096] The type of food composition is not particularly limited and may include, for example, meat, sausage, bread, chocolate, candy, snacks, confectionery, pizza, ramen, other noodles, gums, dairy products including ice cream, various soups, beverages, tea, drinks, alcoholic beverages and vitamin complexes.
[0097] Like conventional foods, the food composition may further include additional ingredients such as flavoring agents or natural carbohydrates other than active ingredients. The natural carbohydrates may include: monosaccharides such as glucose and fructose; disaccharides such as maltose and sucrose; polysaccharides such as dextrin and cyclodextrin; as well as a sugar alcohol such as xylitol, sorbitol, or erythritol. Examples of the sweetener may include natural sweeteners such as thaumatin and stevia extract; and synthetic sweeteners such as saccharin and aspartame.
[0098] In addition to the above, the health food of the present invention may include various nutrients, vitamins, electrolytes, flavoring agents, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH adjusters, stabilizers, preservatives, glycerin, alcohol, carbonation agents used in carbonated beverages and the like. In addition, it may contain the pulp for production of natural fruit juice, fruit juice beverage and vegetable beverage.
[0099] Further, the present invention provides a method for preventing or treating an influenza A virus-infectious disease, which includes administering the above-described antiviral composition to a subject. In particular, the present invention provides a method for treating an influenza A virus-infectious disease, which includes administering the above-described antiviral composition to a subject.
[0100] The subject may be a human and/or a non-human animal, and specifically, a mammal capable of exhibiting beneficial effects by treatment using the drug of the present invention.
[0101] The subject may include all subjects who have or are at risk of having symptoms of influenza A virus-infectious diseases (e.g., fever, malaise, cough, dyspnea, pneumonia, sputum, sore throat, flu, cold, etc.). The influenza A virus is the same as described above, and therefore will not be described in detail.
[0102] An amount effective for preventing or treating influenza A virus-infectious diseases means an amount capable of achieving a desired outcome in a subject in need thereof, or an amount capable of providing objective or subjective benefits to a subject in need thereof.
[0103] The amount effective for preventing or treating influenza A virus-infectious diseases may be single or multiple doses. An effective amount for preventing or treating an influenza A virus-infectious disease may be an amount when the drug of the present invention is provided alone, but may also be an amount when provided in combination with one or more other compositions (e.g., other respiratory disease treatment agents, etc.).
[0104] Numerical values described herein should be construed to include equivalent ranges unless otherwise specified.
[0105] Further, the present invention provides the use of a pharmaceutical composition which includes the above-described antiviral composition for prevention or treatment of an influenza A virus-infectious disease.
[0106] Specifically, the present invention provides the use of a pharmaceutical composition which includes the above-described antiviral composition for treating an influenza A virus-infectious disease.
[0107] Hereinafter, examples will be given to describe the present invention in detail.
[0108] 1. Experimental Materials: Cell Lines and Viruses
[0109] MDCK cells were preserved in Eagle's minimal essential medium (EMEM) containing 5% fetal bovine serum (Gibco, Cergy Pontois, France), 100 U/ml penicillin and 100 g/ml streptomycin (Hyclone, Logan, UT, USA). HeLa and Vero cells were cultured in DMEM (Dulbecco's Modified Eagle's medium), and A549 cells were cultured in Roswell park Memorial Institute 1640 medium (RPMI 1640 medium; Hyclone) containing the same serum as the MDCK culture medium. The cell line was purchased from the Korea Cell Line Bank and maintained at 37 C. and 5% CO.sub.2. Influenza strains A/Puerto Rico/8/34 (H1N1/PR8) and A/X-31 (H3N2/X-31) were provided by Professor Kweon (Sungkyunkwan University, Korea). Further, Pandemic H1N1/H275Y NA mutant virus (A/Korea/2785/2009pdm: NCCP 42017; Oseltamivir-resistant) was obtained from the National Pathogen Resources Bank. H1N1/H275Y is a variant resulting from H1N1/pdm09. Viruses were proliferated in the allantoic sacs of 9-day-old eggs at 37 C. for 3 days. Allantoic fluid was harvested and removed using density gradient centrifugation. Viral titers were determined using plaque assay.
[0110] 2. Expression and Purification of Antibody Fragment
[0111] Using E. coli BL21 cell as a host, scFv having the amino acid sequence of SEQ ID NO: 9 of Table 1 below was produced (see
TABLE-US-00001 TABLE1 Division Aminoacidsequence SEQIDNo. VHCDR1 GYTFTSYVMH SEQIDNO:1 VHCDR2 INPYNDG SEQIDNO:2 VHCDR3 GAYKRGYAMDY SEQIDNO:3 VLCDR1 KSSQSLFNSRTRKNYLA SEQIDNO:4 VLCDR2 WASTRES SEQIDNO:5 VLCDR3 KQSYYHMYT SEQIDNO:6 VH EVQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHW SEQIDNO:7 VKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTS DKSSSTAYMELSSLTSEDSAVYYCARGAYKRGYAMD YWGQGTSVTVSSR VL DLVMSQSPSSLAVSAGEKVTMSCKSSQSLENSRTRK SEQIDNO:8 NYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSG SGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGT KLEIK 3D8ScFV EVQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHW SEQIDNO:9 VKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTS DKSSSTAYMELSSLTSEDSAVYYCARGAYKRGYAMD YWGQGTSVTVSSRGGGGSGGGGSGGGGSDLVMSQSP SSLAVSAGEKVTMSCKSSQSLENSRTRKNYLAWYQQ KPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLT ISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK 3D8scFv GAGGTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTA SEQIDNO:10 gene AAGCCTGGGGCTTCAGTGAAGATGTCCTGCAAGGCT sequence TCTGGATACACATTCACTAGCTATGTTATGCACTGG GTGAAGCAGAAGCCTGGGCAGGGCCTTGAGTGGATT GGATATATTAATCCTTACAATGATGGTACTAAGTAC AATGAGAAGTTCAAAGGCAAGGCCACACTGACTTCA GACAAATCCTCCAGCACAGCCTACATGGAGCTCAGC AGCCTGACCTCTGAGGACTCTGCGGTCTATTACTGT GCAAGAGGGGCCTATAAAAGGGGATATGCTATGGAC TACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCT AGAGGTGGGGGCGGTTCGGGTGGCGGGGGCTCGGGC GGGGGTGGCTCAGATCTTGTGATGTCACAGTCTCCA TCCTCCCTGGCTGTGTCAGCAGGAGAGAAGGTCACT ATGAGCTGCAAATCCAGTCAGAGTCTGTTCAACAGT AGAACCCGAAAGAACTACTTGGCTTGGTACCAGCAG AAACCAGGGCAGTCTCCTAAACTGCTGATCTACTGG GCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTC ACAGGCAGTGGATCTGGGACAGATTTCACTCTCACC ATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTAT TACTGCAAGCAATCTTATTATCACATGTATACGTTC GGATCGGGGACCAAGCTGGAAATAAAA
[0112] 3. Analysis of Cell Penetration Activity of Antibody Fragment
[0113] First, cell penetration activity as an important prerequisite for antiviral effects of 3D8 scFv was investigated. A549, HeLa, Vero and MDCK cells (210.sup.4) were cultured in 8-well chamber slides (Nunc Lab-Tek). Cells were treated with 3 M of 3D8 scFv and incubated at 37 C. under 5% CO.sub.2 for 24 hours. Next, the slides were washed twice with PBS and fixed in methanol cold at 25 C. for 15 minutes. Samples were permeabilized for 5 minutes using Intracellular Staining Perm wash buffer (BioLegend, San Diego, CA, USA). After blocking with 1% BSA (in PBST) for 1 hour, the samples were incubated with monoclonal mouse anti-3D8 scFv antibody (1:1000 dilution; AbClon, Seoul, Korea) at 4 C. for 24 hours. Then, the samples were incubated with goat anti-mouse IgG Alexa Fluor 488 secondary antibody (1:1000 dilution; Abcam, Cambridge, MA, USA) at 25 C. for 1 hour, followed by mounting the slides on antifade mounting medium containing DAPI (Vectashield, Burlingame, CA, USA). The samples were then visualized using a Zeiss LSM 700 confocal microscope. Nuclei were detected with DAPI staining (blue) and 3D8 scFv was visualized with an antibody conjugated with Alexa flour 488 fluorescent dye (green). 3D8 scFv was detected in the cytoplasm of all cell lines within 24 hours after treatment (
[0114] 4. Viral RNA Degradation Activity of Antibody Fragment
[0115] Total RNA was isolated from H1N1/PR8 and viral cDNA was synthesized. Sequences corresponding to NA and NP were amplified using PCR (Table 2) and then cloned into pGEM-T Easy (Promega, Madison, WI, USA) which is a vector carrying T7 and SP6 promoters. Neuramindase (NA) and Nucleoprotein (NP) RNAs were synthesized using a HiScribe T7 in vitro transcription kit (New England BioLabs, Ipswich, MA, USA) and then incubated along with 3D8 scFv purified protein (0.5 g) in TBS containing 0.1 mM MgCl.sub.2 at 37 C. for 1 hour. After terminating the reaction by adding 10 loading buffer (Takara, Otsu, Shinga, Japan), the reaction was analyzed by electrophoresis on a 1% agarose gel followed by staining the product with ethidium bromide. As a result of the analysis, it was confirmed that viral RNAs were degraded by 3D8 scFv treatment (
TABLE-US-00002 TABLE2 Accession Gene Forward(5.fwdarw.3) Reverse(5.fwdarw.3) No. Hemagglutinin GCTACCATGCGAACAATTC CTGCACTGCAAAGATCCATT NC_002017.1 (HA) AAC(SEQIDNO:11) AG(SEQIDNO:12) Neuramindase CCATTGGATCAATCTGTCT TGTCAATGGTGAATGGCAAC NC_002018.1 (NA) GG(SEQIDNO:13) TC(SEQIDNO:14) Nucleoprotein ACTGATGGAGAACGCCAGA ATGTCAAAGGAAGGCACGAT NC_002019.1 (NP) AT(SEQIDNO:15) C(SEQIDNO:16)
[0116] 5. Cytotoxicity Analysis of Antibody Fragments
[0117] MDCK cells (210.sup.4) were cultured in 96-well plates. Cells were treated with 3D8 scFv (1 to 10 M) and incubated at 37 C. under 5% CO.sub.2 for 48 hours. Then, 10 l of MTT solution was added and the cells were incubated at 37 C. under 5% CO.sub.2 for 4 hours. Formazan crystals formed were dissolved with DMSO and the absorbance of each well was read at 595 nm using an ELISA microplate reader (TECAN, Mannedorf, Switzerland).
[0118] Cytotoxicity was determined by treating MDCK cells with different concentrations of 3D8 scFv (0 to 10 M). A minimal cytotoxicity of less than 5% was observed at all concentrations, indicating that the toxicity of the 3D8 scFv was maintained to a minimum at the concentration at which the experiment was performed (
[0119] 6. Efficacy of Antibody Fragment to Increase Viability of Influenza a Virus-Infected Cell
[0120] MDCK cells (210.sup.4) were cultured in 96-well plates and treated as follows: (i) 3D8 scFv pre-treatment: 3D8 scFv (3, 5, 7 M) was added to MDCK cells at 37 C. under 5% CO.sub.2. After 24 hours of treatment, 3D8 scFv-treated cells were independently infected using three influenza virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) (MOI=0.1) in MEM-free medium at 37 C. for 1 hour. The infection medium was then removed and the cells were cultured in serum-free MEM-free medium (1% BSA) containing tosylphenylalanyl chloromethyl ketone (TPCK)-treated trypsin (1 g/ml) at 37 C. under 5% CO.sub.2 for 48 hours (the upper part of
[0121] (i) When 3D8 scFv was pre-treated, the survival rate of the 3D8 scFv untreated group (0 M) in H1N1/PR8-infected cells was 66.8%, while the survival rate of the group pre-treated with 5 M of 3D8 scFv was about 88.3% (H1N1/PR8(Pre) in
[0122] Treatment of 3D8 scFv before or after viral infection in vitro increased the viability of virus-infected cells by 20%.
[0123] 7. Efficacy of Antibody Fragment to Reduce Viral RNA/Protein Expression
[0124] (1) Measurement of the Expression of Viral RNA Using qRT-PCR
[0125] MDCK cells (410.sup.5) were cultured in 6-well plates and treated as follows: (i) 3D8 scFv pre-treatment: MDCK cells were treated with 3D8 scFv (3 M) at 37 C. under 5% CO.sub.2 for 24 hours. Then, 3D8 scFv-treated cells were independently infected with three influenza virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) (MOI=0.1) in MEM-free medium at 37 C. for 1 hour. Thereafter, the infection medium was removed and the cells were cultured in MEM-free medium (1% BSA) containing tosyl phenylalanyl chloromethyl ketone (TPCK)-treated trypsin (1 g/ml) at 37 C. under 5% CO.sub.2 for 24 hours. (ii) 3D8 scFv post-treatment: MDCK cells were independently infected with three influenza virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) (MOI=0.1) in MEM-free medium at 37 C. for 1 hour, and then, the infection medium was removed. After replacing the medium with MEM-free medium (1% BSA) containing 3D8 scFv (3, 5, 7 M) and TPCK-treated trypsin (1 g/ml), the culturing was performed at 37 C. under 5% CO.sub.2 for 24 hours (the upper part of
TABLE-US-00003 TABLE3 Accession Gene Forward(5.fwdarw.3) Reverse(5.fwdarw.3) No. GAPDH(MDCK AACATCATCCCT GGCAGGTCAGAT NM_001003142.2 CellLine) GCTTCCACT(SEQ CCACAAC(SEQID IDNO:17) NO:18) GAPDH GGCATTGCTCTC TGTGAGGGAGAT NC_000072.7 (Mouse) AATGACAA(SEQID GCTCAGTG(SEQ NO:19) IDNO:20) Hemagglutinin AGTGCCCAAAAT CAGTCCATCCCC NC_002017.1 (A/PuertoRico/ ACGTCAGG(SEQID CTTCAATA(SEQ 8/1934 NO:21) IDNO:22) (H1N1)) Hemagglutinin GAAAATGGTTGG GATGGCTGCTTG DQ874876.1 (A/X-31 GAGGGAATG(SEQ AGTGCTTTT(SEQ (H3N2)) IDNO:23) IDNO:24) Hemagglutinin GGAACGTGTTAC GCTGCCGTTACA NC_026433.1 (A/California/ CCAGGAG(SEQID CCTTTGTT(SEQ 07/2009 NO:25) IDNO:26) (H1N1)) Nucleoprotein ACCAATCAACAG TGATTTCGGTCC NC_002019.1 (A/PuertoRico/ AGGGCATCT(SEQ TCATGTCAG(SEQ 8/1934 IDNO:27) IDNO:28) (H1N1)) Nucleoprotein AAAATCATGGCG CGGTGCACATTT AB036779.1 (A/X-31 TCTCAAGGC(SEQ GGATGTAGA(SEQ (H3N2)) IDNO:29) IDNO:30) Nucleoprotein CCAGATCAGTGT GGCTTTGCACTT NC_026436.1 (A/California/ GCAGCCTA(SEQID TCCATCATTC 07/2009 NO:31) (SEQIDNO:32) (H1N1)) Interferon TTACACTCGCTT TCCCACGTCAAT NC_000070.6 beta TGCCATCCAA(SEQ CTTTCCTCTT (Mouse) IDNO:33) (SEQIDNO:34)
[0126] As a result of determining the expression of viral RNAs (HA and NP) at 24 hours after infection with three types of influenza virus, in the cells infected with H1N1/PR8, the viral HA and NP RNA expression of the 3D8 scFv pre-treated group was reduced by 50% or more compared to the 3D8 scFv untreated group (H1N1/PR8(Pre) in
[0127] (2) Measurement of Viral Protein Expression Using Immunocytochemistry (ICC)
[0128] MDCK cells (210.sup.4) were cultured in 8-well chamber slides. 3D8 scFv treatment and virus infection (H1N1/PR8 and H1N1/H275Y) were performed in the same manner as described in (1) above (the upper part of
[0129] Immunofluorescence analysis was performed to confirm the presence of viral HA protein and 3D8 scFv. In the 3D8 scFv untreated group of H1N1/PR8-infected cells, viral HA protein was detected in the cytoplasm (red signal), whereas in the 3D8 scFv pre-treated group, no viral HA protein was detected (H1N1/PR8 in
[0130] 8. Antibody Fragment In-Vivo Antiviral Activity Test
[0131] (1) Clinical Antiviral Efficacy in H1N1/H275Y Infected Mice
[0132] In order to assess clinical antiviral effects of 3D8 scFv, an experiment was performed on mice as an experimental in vivo model. Six-week-old male specific pathogen-free (SPF) BALB/c mice (DBL; body weight 18 to 20 g) were housed under standard laboratory conditions. These mice were divided into 5 groups of 8 to 10 mice.
[0133] PBS treatment prior to virus infection in each group of mice; PBS treatment after viral infection; 3D8 scFv treatment prior to viral infection; 3D8 scFv treatment after viral infection; and Oseltamivir phosphate (Sigma-Aldrich, ST. Louis, MO, USA) was orally administered for 5 days after viral infection. Mice in each group were intra-nasally infected with 50 l lethal dose of 50% H1N1/H275Y virus (510.sup.4 PFU). Mice were infected with H1N1/H275Y and monitored daily for clinical signs (weight change, cough, slouched back, coarse hair, flocking (fever), abnormal secretions, survival, etc.) until day 11 (
[0134] Only 25% of the PBS pre-treated group survived, whereas 90% of the 3D8 scFv pre-treated group survived. 40% of the 3D8 scFv post-treated group survived but none of the PBS post-treated groups survived. 30% of the oseltamivir-treated group survived (
[0135] For body weight change, the average body weight of the PBS pre-treated group was 21.1 g after infection 0 day (0 dpi), and decreased by 27% to 15.5 g after infection 11 day (11 dpi). The average body weight of the 3D8 scFv pre-treated group was 22.2 g at 0 dpi, and decreased by about 18% to 18.2 g at 7 dpi. However, the average weight rebounded to 20.6 g at 11 dpi. In the oseltamivir-treated group, the average body weight was 21.8 g at 0 dpi and decreased by 30% at 7 dpi, but rebounded at 11 dpi. In the PBS post-treated group, the average body weight was 20.8 g at 0 dpi, but no mice survived at 8 dpi. The average body weight of the 3D8 scFv post-treated group was 23 g at 0 dpi and decreased by about 30% to 16 g at 10 dpi, but the average body weight was recovered thereafter (
[0136] From this, it can be confirmed that the treatment of 3D8 scFv increases the viability of virus-infected cells and rapidly recovers the initial weight loss caused by the virus attack.
[0137] (2) Morphological Analysis of Lungs of Influenza a Virus-Infected Mice
[0138] Lung tissues from each group of mice (5 dpi) in (1) above were collected and morphological analysis of lung lesion scores was performed by visually observing.
[0139] Each lung lobe was assigned with a number reflecting the approximate percentage of a total lung volume. The total score for all lobes formed an estimate of total percentage of the lungs with visible pneumonia. For morphological analysis of microscopic lung lesion scores, lung tissue was fixed in 10% neutral buffered formalin. After fixation, the tissue was dehydrated through a series of alcohol solutions and xylene, and embedded in paraffin wax. Sections (5 m) were prepared from each tissue, and hematoxylin and eosin (HE) staining was performed. The prepared tissue slides were examined in a blinded fashion and scored for the estimated severity of interstitial pneumonia as follows: 0, no lesion; 1, mild interstitial pneumonia; 2, moderate multifocal interstitial pneumonia; 3, moderate diffuse interstitial pneumonia; and 4, severe interstitial pneumonia. For morphological analysis of IHC (Immunohistochemistry), sections were analyzed with NIH Image J 1.43 m Program (https://imagej.nih.gov/ij) to obtain quantitative data. Ten fields were randomly selected and the number of positive cells per unit area (0.25 mm.sup.2) was determined, followed by calculating an average value thereof.
[0140] Visible lesions were mainly present in the mesenchymal, caudate and accessory lobes. Pathologically, the lungs of the 3D8 scFv pre-treated group were not significantly different from those of the non-virally infected WT group. On the other hand, significant lung congestion and tan enhancement were observed in the PBS pre-treated group and the oseltamivir-treated group (the upper part of
[0141] The microscopic lesion was characterized by a thickened alveolar septum with increased numbers of interstitial macrophages and lymphocytes in the PBS and oseltamivir treated groups. The lungs of 3D8 scFv pre-treated and WT groups were normal (the upper part of
[0142] (3) Measurement of Viral RNA and Interferon Levels in Influenza a Virus-Infected Mouse Lung
[0143] Viral RNA and interferon levels were measured in the lungs of mice. Total RNA was extracted from lysed mouse lung tissue (5 dpi) samples using TRI reagent according to the manufacturer's instructions. RNA concentration was determined using a spectrophotometer. cDNA was synthesized using CellScript All-in-One 5 First Strand cDNA Synthesis Master Mix according to the manufacturer's protocol. The genes (HA, NP and IFN-) were amplified with the primers in Table 3 using qRT-PCR as previously described. GAPDH was amplified as an internal control. In the lungs of the 3D8 scFv pre-treated group, as evidenced by the reduced expression of HA (68%), NP (71%) and IFN- (51%) in the lungs of the 3D8 scFv pre-treated group compared to the PBS pre-treated group, the expression of viral RNA and IFN- was decreased compared to other groups. Expression of viral RNA in the lungs of the 3D8 scFv post-treated group was as low as 35% (HA) and 18% (NP) (
[0144] (4) Confirmation of Virus Titer in Influenza a Virus-Infected Mouse Lung
[0145] Further, virus titers were investigated in the lungs of influenza A virus-infected mice. Specifically, mouse lung tissues were homogenized in 1 ml of MEM-free medium using TissueRuptor (Qiagen, Chadstone, Victoria, Australia). Then, a homogenate was obtained by centrifugation at 6,000g and at 4 C. for 5 minutes. Confluent MDCK cells were cultured in 12-well plates. After infecting the tissue supernatant (1:1000 dilution) in MEM-free medium at 37 C. for 1 hour, the infection medium was removed. The medium was replaced with 1Dulbecco's modified eagle medium containing TPCK-treated trypsin (1 g/ml) and 1% agarose. Cells were further incubated under 5% CO.sub.2 at 37 C. for 3 days. Cell monolayers were fixed with 4% formaldehyde and stained with 0.5% crystal violet for visualization. The viral titer of the lungs was reduced by about 70% in the 3D8 scFv pre-treated group compared to the PBS pre-treated group (
[0146] (5) Measurement of Viral Protein Expression Using Immunohistochemistry (IHC)
[0147] After de-paraffinizing and rehydrating the tissue sections, antigen recovery was performed at 95 C. for 20 minutes using citrate buffer. Slides were washed with TBST (TBS, 0.025% Triton X-100) and blocked with 10% fetal bovine serum+1% BSA solution (in TBST) for 2 hours. Tissue sections were incubated with polyclonal rabbit anti-HA antibody (1:750 dilution) overnight at 4 C. The tissue slides were then each incubated with goat anti-rabbit IgG TRITC secondary antibody (1:1000 dilution) at 25 C. for 1 hour. Anti-fade mounting medium containing DAPI was put on tissue section slides, a cover glass was put on, and cells were visualized using an LSM 700 Zeiss confocal microscope. A signal of viral HA was reduced in an alveolar epithelial cell inner layer (the left side in
[0148] 9. Statistical Analysis
[0149] Continuous data were analyzed by a one-way analysis of variance (ANOVA). When the ANOVA analysis was significant (P<0.05), pairwise Tukey's adjustment was further performed. Discrete data were analyzed by Chi-square and Fisher's exact test. If necessary, the relationship between the data was assessed using Pearson's correlation coefficient and/or Spearman's rank correlation coefficient. Values of P<0.05 were considered significant. All statistical analyzes were performed using GraphPad Prism software (GraphPad Software, San Diego, CA, USA).
[0150] From the above results, it was confirmed that 3D8 scFv not only exhibits prophylactic effects of protecting the host from viral infection, but also exhibits therapeutic effects by alleviating excessive inflammation and potential additional etiology after viral infection.
[0151] The description of the present invention is for illustrative purposes, and those of ordinary skill in the art to which the present invention pertains will understand that it can be easily modified into other specific forms without changing the technical spirit or essential features of the present invention. Accordingly, it should be understood that the embodiments described above are illustrative in all respects and not restrictive.
[0152] The scope of the present invention is indicated by the following appended claims, and all changes or modifications derived from the meanings and scope of the claims and their equivalents should be construed as being included in the scope of the present invention.
[0153] A sequence listing electronically submitted with the present application on Feb. 17, 2023 as an ASCII text file named 20230217_LC0502302_TU_SEQ.TXT, created on Jan. 20, 2023 and having a size of 12,041 bytes, is incorporated herein by reference in its entirety.