CYCLIC ACETYLCHOLINESTERASE C-TERMINAL PEPTIDE IN THE TREATMENT OR PREVENTION OF CANCER OR METASTASIS
20200147183 ยท 2020-05-14
Inventors
Cpc classification
A61K38/465
HUMAN NECESSITIES
A61K38/12
HUMAN NECESSITIES
International classification
A61K38/12
HUMAN NECESSITIES
Abstract
The invention relates to cyclic polypeptides derived from the C-terminus of acetylcholinesterase for use in treating or preventing cancer or metastatic disease.
Claims
1. A method of treating, ameliorating or preventing cancer or metastatic disease in a subject, the method comprising, administering to a subject in need of such treatment, a therapeutically effective amount of a cyclic polypeptide, derivative or analogue thereof of SEQ ID No:3.
2. A method according to claim 1, wherein the cancer is leukemia.
3. A method according to claim 1, wherein the cancer is lymphocytic leukemia, chronic lymphocytic leukemia (CLL), myeloid leukemia, or acute myeloid leukemia.
4. A method according to claim 1, wherein the cancer is multiple myeloma or breast cancer.
5. A method according to claim 1, in treating, ameliorating or preventing metastatic disease.
6.-13. (canceled)
14. An anti-cancer or anti-metastatic pharmaceutical composition comprising a therapeutically effective amount of cyclic SEQ ID No:3, or a derivative or analogue thereof, and optionally a pharmaceutically acceptable vehicle.
15. A process for making the anti-cancer or anti-metastatic pharmaceutical composition according to claim 14, the process comprising combining a therapeutically effective amount of the cyclic SEQ ID No:3, or a derivative or analogue thereof, with a pharmaceutically acceptable vehicle.
16. (canceled)
Description
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
EXAMPLES
Rationale
[0075] The inventors have generated a number of linear and cyclic peptides based on the C-terminus of acetylcholinesterase known as T15, T30 and NBP-14 peptides and evaluated their effects in a number of cell lines and primary leukaemia cells derived from patients. It should be noted that SEQ ID No: 3 is referred to herein as cyclated T14, CT14 or NBP-14, and is a cyclic peptide with an amino acid sequence derived from the C-terminus of Tailed acetylcholinesterase.
Objectives
[0076] 1. To determine the cytotoxic and cytostatic profile of NBP-14 in a range of human in vitro cancer models; and [0077] 2. To evaluate the effects of NBP-14 in normal B- and T-lymphocytes.
Materials and Methods
Cyclisation of Peptides
[0078] Three techniques were used to achieve cyclization of linear peptides described herein, i.e. side-chain-to-side-chain, side-chain-to-backbone, and head-to-tail (C-terminus to N-terminus) cyclization. Head-to-tail cyclization has been investigated extensively, and can involve directed Cys-Cys disulphide cyclization (up to two per molecule). Careful monitoring of the reaction ensures 100% cyclization. Two general approaches are used for synthesis: (1) classical solution-phase linear peptide cyclization under high dilution conditions; and (2) resin-based cyclization. Two distinct protocols were employed in the solid phase synthesis (1):
(a) The on-resin cyclization of a peptide anchored via a side-chain functional group, such as imidazole, 3 acid, 4 amine' or alcohol, was carried out. The peptide was orthogonally protected as an ester at the C-terminus, and the peptide was then assembled through regular Boc or Fmoc synthesis followed by saponification, cyclization and cleavage.
(b) Another protocol that was used was the cyclization cleavage approach, in which the cyclic peptide was synthesized by cyclization after step-wise linear peptide synthesis.
[0079] One advantage of this method is that the side-chain does not need to be anchored, making the approach more general than (a). (Christopher J. White and Andrei K. Yudin (2011) Nature Chemistry 3; Valero et al (1999) J Peptide Res. 53, 76-67; Lihu Yang and Greg Morriello (1999) Tetrahedron Letters 40, 8197-8200; Parvesh Wadhwani et al (2006) J. Org. Chem. 71, 55-61).
KG1a, H929, MCF7, MDA-MB-231, MEC-1 and Primary CLL Cell Culture Conditions
[0080] The acute myeloid leukaemia (AML) KG1a cell line was maintained in RPMI medium (Invitrogen) supplemented with 100 units/ml penicillin, 100 g/ml streptomycin and 20% foetal calf serum. The multiple myeloma (MM) cell line H929, the two breast cancer cell lines (MCF7 and MDA-MB-231), the MEC-1 cells and the primary chronic lymphocytic leukaemia cells were maintained in RPMI medium supplemented with 100 units/ml penicillin, 100 g/ml streptomycin and 10% foetal calf serum. The media used contained acetylcholine but after the initial set of experiments an additional 100 M of acetylcholine was added to the culture media. Cells were subsequently aliquoted (10.sup.6 cells/ml) into 24-well plates and were incubated at 37 C. in a humidified 5% carbon dioxide atmosphere for 72 h in the presence of the peptides (T15, T30, NBP-14 and the combination of T30+NBP-14) at concentrations between 0.1 nM and 1 M. In addition, control cultures were carried out to which no peptide was added. Cells were subsequently harvested by centrifugation and were analysed by flow cytometry using the Annexin V assay or were counted using a Vi-Cell XR cell viability counter (Beckman Coulter).
Measurement of In Vitro Apoptosis
[0081] Cultured cells were harvested by centrifugation and then resuspended in 195 of calcium-rich buffer. Subsequently, 5 l of Annexin V (eBiosciences) was added to the cell suspension and cells were incubated in the dark for 10 mins prior to washing. Cells were finally resuspended in 190 l of calcium-rich buffer together with 10 l of propidium iodide. Apoptosis was assessed by dual-colour immunofluorescent flow cytometry using an Accuri C6 flow cytometer and data were analysed using CFlow software (BD Biosciences).
Measurement of In Vitro Proliferation
[0082] Cultured cells were harvested by centrifugation and were then counted using a Vi-Cell XR cell viability counter. The number of viable cells in each culture was then expressed as a percentage of the viable cells in the control cultures (no peptide).
Statistical Analysis
[0083] All statistical analysis was performed using Graphpad Prism 6.0 software (Graphpad Software Inc.).
In Vitro Cytotoxicity Assay
[0084] The in vitro drug sensitivity was measured using the Annexin V/propidium iodide assay. Comparison of the effects of each peptide alone or in combination in the various cell lines and primary cells are shown below.
Example 1Cyclic T14 (i.e. NBP-14)
[0085] The tailed acetylcholinesterase (T-AChE) is expressed at synapses and the inventors have previously identified two peptides that could be cleaved from its C-terminus, one referred to as T14 (14 amino acids long), within the other which is known as T30 (30 amino acids long), and which both have strong sequence homology to the comparable region of -amyloid.
[0086] The amino acid sequence of the linear peptide, T14, is AEFHRWSSYMVHWK [SEQ ID No:3].
[0087] The amino acid sequence of the linear peptide, T30, is
TABLE-US-00005 [SEQIDNo:2] KAEFHRWSSYMVHWKNQFDHYSKQDRCSDL.
[0088] Another peptide referred to as T15 corresponds to the last 15 amino acid residues of SEQ ID No:1, i.e. NQFDHYSKQDRCSDL [SEQ ID No: 4].
[0089] The AChE C-terminal peptide T14 has been identified as being the salient part of the AChE molecule responsible for its range of non-hydrolytic actions. The synthetic 14 amino acids peptide analogue (i.e. T14), and subsequently the larger, more stable, and more potent amino acid sequence in which it is embedded (i.e. T30) display actions comparable to those reported for non-cholinergic AChE.
[0090] Referring first to
Example 2the Effect of Acetylcholinesterase-Derived Peptides in the MCF7 and MDA-MB-231 Cell Lines
[0091] The inventors examined the ability of the acetylcholinesterase-derived peptides (NBP-14 and/or T30) to induce apoptosis in the two breast cancer cell lines, and the results are shown in
Example 3the Effect of the Acetylcholinesterase-Derived Peptides in the KG1a AML Cell Line
[0092] KG1a cells were cultured with the peptides for 72 h and their apoptotic effects were assessed, and the results are shown in
Example 4the Effect of the Acetylcholinesterase-Derived Peptides on H929 and MEC-1 B-Cell Lines
[0093] The acetylcholinesterase-derived peptides showed a small cytotoxic effect in H929 cells and MEC-1 cells, and the results are shown in
Example 5the Effect of Acetylcholinesterase-Derived Peptides in Primary CLL Cells
[0094] The inventors next examined the effects of the acetylcholinesterase-derived peptides in primary CLL cells derived from patients, and the results are shown in
Example 6the Apoptotic Effect of Acetylcholinesterase-Derived Peptides in Normal B- and T-Lymphocytes
[0095] In order to assess the effects of the acetylcholinesterase-derived peptides on normal (non-malignant) cells, B- and T-lymphocytes were isolated from normal healthy volunteers (n=3). The results are shown in
Example 7the Effect of the Acetylcholinesterase-Derived Peptides on Proliferation of the Cell Lines
[0096] The inventors next examined the ability of the acetylcholinesterase-derived peptides to induce cytostasis, i.e. to inhibit proliferation in the various cell lines employed in this study. The results are shown in
[0097] Referring to
Conclusions
[0098] 1. NBP-14 showed modest apoptotic effects in each of the cell lines tested at concentrations >0.1 M. Although MCF7 cells showed relatively increased sensitivity to NBP-14, it was not preferentially cytotoxic in these cells when compared with the control peptide (T15) and the toxic peptide (T30). [0099] 2. None of the peptides tested appeared to show significant cytotoxic effects in normal B- and T-lymphocytes. [0100] 3. NBP-14 showed clear anti-proliferative activity in the migratory cell line, MDA-MB-231 cells. Similar effects were also observed in KG1a cells, MEC-1 cells and H929 cells with concentrations of peptide >0.1 M. The anti-proliferative effects on MCF7 cells were less marked but this is the slowest growing of all the cell lines used in this study. [0101] 4. The lack of toxicity, in normal cells, of NBP-14 is encouraging. [0102] 5. Acetylcholinesterase-derived peptides including NBP-14 exhibit an anti-metastatic effect.
[0103] Based on the above findings, the inventors have demonstrated that cyclic peptides derived from the C-terminus of tailed acetylcholinesterase, and in particular, NBP-14, i.e. SEQ ID No.3, can be used to treat cancer and prevent metastasis. Accordingly, these cyclic peptides can be used as an adjuvant for the treatment of solid or metastatic tumours with chemotherapy/radiotherapy. This means that lower doses and exposure times of chemotherapy and/or radiotherapy are required.
Example 8the Effects of NBP-14 on Migration in Cancer Cell Lines and Primary CLL Samples
[0104] The following assays were performed in order to evaluate the potential anti-migratory (anti-metastatic) activity of NBP-14 shown in
[0108] MDA-MB-231, KG1a, and MEC-1 cells are highly migratory cancer cell lines. JJN3, CLL and MCF-7 are less migratory cancer cell lines. B-lymphocytes are normal, non-cancerous cells.
Rationale
[0109] The previous examples 1-7 indicated that an acetylcholinesterase-derived peptide inhibited endocytic activity in a human metastatic breast cancer cell line. The following examples were designed to establish whether the NBP-14 peptide had the potential to inhibit the migration of a number of cell lines and primary leukaemia cells derived from patients.
Objectives
[0110] 1. To determine whether NBP-14 could inhibit tumour cell migration in a range of human in vitro cancer models. [0111] 2. To evaluate the effects of NBP-14 on the migration of normal B-lymphocytes.
Materials and Methods
KG1a, JJN3, MCF7, MDA-MB-231 and Primary CLL Cell and Normal B-Cell Culture Conditions
[0112] The acute myeloid leukaemia (AML) KG1a cell line was maintained in RPMI medium (Invitrogen) supplemented with 100 units/ml penicillin, 100 g/ml streptomycin and 5% foetal calf serum. The multiple myeloma (MM) cell line JJN3, the two breast cancer cell lines (MCF7 and MDA-MB-231), the primary chronic lymphocytic leukaemia cells and normal B-lymphocytes were maintained in RPMI medium supplemented with 100 units/ml penicillin, 100 g/ml streptomycin and 5% foetal calf serum. In addition, 100 M of acetylcholine was added to the culture media to ensure that the availability of acetylcholine was not a limiting factor in these experiments.
Migration Assays
[0113] In vitro migration assays were performed by using 6.0 m pore size transwell migration plates (Costar, Corning, N.Y.). A total of 10.sup.6 CLL cells in 500 l of RPMI media were added to the upper chamber of the transwell insert. 100 ng/ml of CXCL12 was added to the baso-lateral chamber for all the cell types tested apart from KG1a cells. These cells do not express CXCR4 and so are unresponsive to CXCL12. Instead, media containing 10% foetal calf serum was added to the baso-lateral chamber in these experiments. The plates were incubated for 24 h at 37 C. in 5% CO.sub.2 in the presence of the peptides (T15, T30, NBP-14 and the combination of T30+NBP-14) at concentrations between 0.1 nM and 10 M. In addition, control cultures were carried out to which no peptide was added. Cells were subsequently harvested by centrifugation and were analysed by flow cytometry using an Accuri C6 flow cytometer (BD). None of the conditions tested induced significant cell death in the cultures. Migration of CLL cells was determined by counting cells that migrated to the lower (baso-lateral) chamber of the transwell plate and then expressed as a percentage of the total number of cells initially added to the upper (apical) chamber.
Statistical Analysis
[0114] All statistical analysis was performed using Graphpad Prism 6.0 software (Graphpad Software Inc.).
Results
[0115] Initial experiments were performed to determine whether the acetylcholinesterase-derived peptide, NBP-14, altered the migration of a number of cancer cell lines in a dose-dependent manner. Referring to
Example 9the Effect of Acetylcholinesterase-Derived Peptides in the MCF7 and MDA-MB-231 Cell Lines
[0116] The inventors next examined the ability of 1 M of the peptides to inhibit migration in the two breast cancer cell lines in 24 h transwell experiments. Referring to
Example 10the Effect of the Acetylcholinesterase-Derived Peptides in the KG1a Acute Myeloid Leukaemia Cell Line
[0117] KG1a cells were cultured with the peptides for 24 h and their effects on migration were assessed. Referring to
Example 11the Effect of the Acetylcholinesterase-Derived Peptides on the JJN3 Multiple Myeloma Cell Line
[0118] Referring to
Example 12the Effect of Acetylcholinesterase-Derived Peptides in Primary CLL Cells
[0119] The inventors next examined the effects of the peptides on the migratory activity of primary CLL cells derived from 10 patients. Referring to
Example 13the Effect of Acetylcholinesterase-Derived Peptides in Normal B-Lymphocytes
[0120] In order to assess the effects of the peptides on normal (non-malignant) cells, B-lymphocytes were isolated from normal healthy volunteers (n=5). Referring to
Example 14Comparison of the Anti-Migratory Effects of NBP-14 in CLL Cells and Normal B-Cells
[0121] Referring to
Example 15Relationship Between Baseline Migration and Response to NBP-14
[0122] The inventors plotted the mean baseline percentage migration for each of the cell lines and primary cells tested against the percentage reduction in migration induced by 1 M NBP-14. Referring to
Example 16Comparison of Baseline Migration Between Various Cell Types and Prior to Exposure to NBP-14
[0123] The inventors investigated the percentage baseline migration (i.e. control) for the various cell lines under examination, and the results are shown in
[0124] Then, these control values were compared in each cell line following exposure to 1 M NBP-14, and the results are shown in
Conclusions
[0125] 1. NBP-14 showed significant anti-migratory effects in all of the cell lines tested with the exception of MCF7 cells, which showed the lowest basal migration under control (no peptide) conditions; an observation that is in keeping with the known low metastatic potential of these cells. Dose-response analysis revealed that NBP-14 was effective at inhibiting migration at concentrations 1 M. Therefore, all subsequent comparisons with control peptide (T15) and the toxic peptide (T30) were made at 1 M. [0126] 2. None of the peptides induced significant cytotoxic effects in the cell lines or the primary malignant and non-malignant B-cells under the conditions tested. Therefore, the reductions in migration observed were not caused by increased cell death in the cultures. [0127] 3. The combination of the toxic peptide (T30) with NBP-14 had no significant effect on migration when compared with NBP-14 alone in any of the cell lines and primary cells evaluated. [0128] 4. Primary CLL cells showed baseline heterogeneity in their migratory capacity. However, NBP-14 was able to significantly reduce migration in these primary tumour cells. [0129] 5. Primary CLL cells were more sensitive than normal B-cells to the anti-migratory effects of NBP-14. This suggests that NBP-14 has utility as an anti-cancer therapeutic, particularly in those tumours that are prone to metastasis. [0130] 6. There is a significant reduction in cell migration or metastasis in all cell lines that were tested.