Calcium Independent Pectinases with Improved Thermostability

20200149027 · 2020-05-14

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention is in the field of protein chemistry, in particular in the field of enzymology. It provides pectinases, i.e. polypeptides with pectin-degrading properties. In particular the invention provides polypeptides with pectate lyase activity (EC 4.2.2.2). Enzymes according to the invention have improved properties, such as improved thermostability and decreased calcium dependence.

    Claims

    1. A polypeptide with pectate lyase activity, the polypeptide comprising: an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, and a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1, wherein the pectate lyase activity is calcium-independent and/or wherein the polypeptide has an improved thermostability.

    2. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 75% identical to the amino acid according to SEQ ID NO: 1.

    3. (canceled)

    4. A composition comprising the polypeptide of claim 1.

    5. A nucleic acid encoding the polypeptide of claim 1.

    6. A vector comprising the nucleic acid of claim 5.

    7. A composition comprising the nucleic acid of claim 5.

    8. A recombinant host cell comprising the nucleic acid of claim 5.

    9. The recombinant host cell of claim 8, wherein the host cell is selected from the group consisting of Escherichia coli, Bacillus, Corynebacterium, Pseudomonas, Pichia pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, filamentous fungi, yeast, and insect cells.

    10. A method for producing the polypeptide of claim 1, the method comprising: culturing the recombinant host cell of claim 8 under conditions suitable for the production of the polypeptide, and recovering the polypeptide obtained, and optionally purifying said polypeptide.

    11. (canceled)

    12. A method for improving the thermostability of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising: altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    13. A method for decreasing, abolishing or removing the calcium dependence of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising: altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    14. A composition comprising the vector of claim 6.

    15. A recombinant host cell comprising the vector of claim 6.

    16. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 80% identical to the amino acid according to SEQ ID NO: 1.

    17. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 85% identical to the amino acid according to SEQ ID NO: 1.

    18. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 90% identical to the amino acid according to SEQ ID NO: 1.

    19. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 95% identical to the amino acid according to SEQ ID NO: 1.

    20. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 97% identical to the amino acid according to SEQ ID NO: 1.

    21. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 98% identical to the amino acid according to SEQ ID NO: 1.

    22. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is identical to the amino acid according to SEQ ID NO: 1.

    Description

    LEGEND TO THE FIGURES

    [0018] FIG. 1: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6. Pectate lyase activity was determined in the presence and absence of calcium ions according to the method described in example 7. Whereas the wild type sequence according to SEQ ID NO: 1 was calcium dependent, the mutated polypeptides carrying the A231L mutation (SEQ ID NO:s 4-6) were calcium independent.

    [0019] FIG. 2: Thermostability of polypeptides according to SEQ ID NO: 1-6. Diagram showing the relative pectate lyase activity of the polypeptides without the A231L mutation (SEQ ID NO: 1, 2 and 3) and the relative pectate lyase activity of polypeptides with the A231L mutation (SEQ ID NO:s 4, 5 and 6) after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    DETAILED DESCRIPTION OF THE INVENTION

    [0020] The present invention is based on our observation that a single amino acid substitution at a position corresponding to the amino acid position 231 in SEQ ID NO: 1 (A231L variant) in different pectate lyases decreases or abolishes the calcium dependence of the enzyme. We also found that the A231L variant remained its pectate lyase activity.

    [0021] As used herein, the term A231L variant indicates that the amino acid corresponding to the alanine residue at position 231 of SEQ ID NO: 1 is replaced by a leucine residue.

    [0022] The term amino acid substitution is used herein in the same way as it is commonly used, i.e. the term refers to a replacement of one or more amino acids in a protein with one or more other amino acids. Such an amino acid substitution may also be referred to as a mutation, a variant or a variation.

    [0023] We observed the same phenomenon in pectate lyases that were homologous to the polypeptide with an amino acid sequence according to SEQ ID NO: 1. When an A231L amino acid variation was introduced in polypeptides that were 93% and 89% identical to the polypeptide according to SEQ ID NO: 1, this also decreased or abolished the calcium dependence of both these enzymes.

    [0024] The invention thus relates to a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, wherein the polypeptide comprises a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1. This is herein referred to as an A231L variant of SEQ ID NO: 1.

    [0025] Polypeptides with pectate lyase activity are also referred herein as pectate lyases, or pectate lyase enzymes.

    [0026] The term pectate lyase activity is used herein to indicate the ability of a polypeptide to cleave pectin using an eliminative cleavage of (1->4)-alpha-D-galacturonan yielding oligosaccharides with 4-deoxy-alpha-D-galact-4-enuronosyl groups at their non-reducing ends. Methods of measuring this activity are well known in the art.

    [0027] The term at least 70% is used herein to include at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 88%, 87%, 88%, 89%, 90% or more, such as 91%, 92%, 93%, 94%, 95%, 99%, 97%, 98%, 99%, or even 100%.

    [0028] As used herein, the degree of identity between two or more amino acid sequences is equivalent to a function of the number of identical positions shared by the sequences; i.e., % identity=number of identical positions divided by the total number of aligned positions100, excluding gaps, which need to be introduced for optimal alignment of the two sequences, and overhangs. The alignment of two sequences is to be performed over the full length of the polypeptides.

    [0029] The comparison (aligning) of sequences is a routine task for the skilled person and can be accomplished using standard methods known in the art. For example, a freeware conventionally used for this purpose is Align tool at NCBI recourse http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2 seq&LINK_LOC=align2seq, Other commercial and open software such as Vector NTI are also suitable for this purpose, Introduction of a specific mutation in a recombinant gene is also among the routine skills of a molecular biologist. Specific guidance may be obtained from Methods in Molecular Biology Vol 182, In vitro mutagenesis protocols, Eds Jeff Braman, Humana Press 2002. There are commercially available kits for performing site-directed mutagenesis (for example, QuikChange II XL Site-Directed Mutagenesis kit Agilent Technologies cat No 200521).

    [0030] SEQ ID NO: 1 provides the amino acid sequence of a known polypeptide [Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367, Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329] with pectate lyase activity. We replaced the alanine residue at position 231 of SEQ ID NO: 1 with a leucine residue, thereby obtaining a polypeptide according to SEQ ID NO: 4. We found that the calcium dependence of the pectate lyase activity was thereby decreased, diminished or abolished. This is further referred to herein as calcium independence.

    [0031] The calcium independence of an enzyme can be measured according to the procedures as disclosed in examples 5 and 7. Therein the activity of the pectate lyase is measured in the presence and absence of CaCl2.

    [0032] A pectate lyase is considered to be calcium independent if the activity of the enzyme in the absence of CaCl2 is not decreased by more than 20% as compared to its activity in the presence of 0.5 mM CaCl2, under the conditions exemplified in example 5. In a preferred embodiment, the activity of the enzyme is not decreased in the absence of CaCl2. The enzyme is considered to be calcium dependent if it is not calcium independent. We also found that the amino acid position corresponding to position 231 in SEQ ID NO: 1 could be changed in polypeptides with an amino acid sequence homologous to the sequence according to SEQ ID NO: 1 with the same effect. We constructed two pectate lyases that were 93% (SEQ ID NO: 2) and 89% (SEQ ID NO: 3) identical with the amino acid sequence according to SEQ ID NO: 1. These homologous peptides were also found to be calcium dependent in that their pectate lyase activity decreased to only 60% when calcium was omitted from the reaction buffer (FIG. 1).

    [0033] We observed that these two homologous pectate lyases became calcium-independent when the amino acid corresponding to position 231 in SEQ ID NO: 1 was changed to a leucine residue in order to obtain polypeptides comprising an amino acid sequences according to SEQ ID NO:s 5 and 6 respectively.

    [0034] The wild type sequence and the homologous polypeptides according to SEQ ID NO: 2 and SEQ ID NO: 3 only displayed 60% of their activity in the absence of calcium, i.e. when calcium was omitted from the activity assay. However, the polypeptide according to SEQ ID NO: 4 and its homologous polypeptides according to SEQ ID NO: 5 and SEQ ID NO: 6 (all three carrying the A231L mutation) showed full pectate lyase activity in the absence of calcium (100, 105 and 102% respectively, FIG. 1). It is concluded that the pectate lyase activity of the wild type depends on calcium, whereas the activity of the A231L variants is not dependent on calcium.

    [0035] The expression the amino acid corresponding to position 231 in SEQ ID NO: 1 is to be understood as follows. If such a position is to be determined in a given amino acid sequence that is at least 70% identical with the amino acid sequence according to SEQ ID NO: 1, then the two sequences are first to be aligned. That may be done by routine methods and software available in the art. The amino acid in the given amino acid sequence corresponding to amino acid 231 in SEQ ID NO: 1 is then the amino acid aligning with the alanine residue at position 231 in SEQ ID NO: 1.

    [0036] We performed a homology search for proteins homologous to SEQ ID NO: 1 using SEQ ID NO: 1 as the query sequence in the Standard protein BLAST software, available at http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LI NK_LOC=blasthome. More information on the software and database versions is available at the National Center for Biotechnology Information at National library of Medicine at National institute of Health internet site www.ncbi.nlm.nih.gov. Therein, a number of molecular biology tools including BLAST (Basic Logical Alignment Search Tool) is to be found. BLAST makes use of the following databases: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects.

    [0037] There were no polypeptides found comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1.

    [0038] The term amino acid variant, variant, mutant or sequence variant or equivalent has a meaning well recognized in the art and is accordingly used herein to indicate an amino acid sequence that has at least one amino acid difference as compared to another amino acid sequence, such as the amino acid sequence from which it was derived.

    [0039] Surprisingly, we also found that the A231L mutation caused the polypeptides to have an improved thermostability.

    [0040] The term mutant protein or mutation is also used herein to refer to a polypeptide with pectate lyase activity as described herein, comprising a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1.

    [0041] The term wild type protein is also used herein to indicate a polypeptide identical to the mutant protein, with the exception that it does not comprise a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1.

    [0042] The term improved thermostability in reference to a mutant polypeptide, as used herein, means that the mutant polypeptide has a higher residual pectate lyase activity than the corresponding wild type protein, after incubation for 10 minutes in 50 mM Tris-HCl pH 8.0 at a suitable temperature.

    [0043] The term suitable temperature as used in this context refers to a temperature at which the wild type protein loses part of its pectate lyase activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0. In other words, the term suitable temperature refers to a temperature chosen from a temperature range between temperatures X and Y, wherein X is the lowest temperature at which a wild type polypeptide shows a detectable loss of activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0 and wherein temperature Y is the lowest temperature at which a wild type polypeptide loses all activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0.

    [0044] In a more concrete example, the term improved thermostability is exemplified in that the A231L variant polypeptide according to SEQ ID NO: 4 exhibited more pectate lysase activity after pre-incubation at elevated temperatures than the wild type polypeptide (SEQ ID NO: 1). The same was found for the homologous polypeptide according to SEQ ID NO: 5 as compared to the same polypeptide without the A231L variant (SEQ ID NO: 2). Also, the A231L variant polypeptide according to SEQ ID NO: 6 was more thermostable than its non-variant counterpart according to SEQ ID NO: 3.

    [0045] In more detail, we measured the residual relative pectate lyase activity after heat treatment of polypeptides comprising an amino acid sequence according to SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6 and compared this activity to that of a pre-treated polypeptide with an amino acid sequence of SEQ ID NO: 1, 2 and 3 respectively. More specifically, the polypeptides were heated to 70, 75 or 80 degrees Celsius for 10 minutes in 50 mM Tris-HCl at pH 8.0. The residual activity was measured at 60 degrees Celsius at pH 8.0 as described in example 5 and compared to the residual activity of the same polypeptides after pre-incubation at room temperature for 10 minutes. The results are shown in table 1.

    TABLE-US-00001 TABLE 1 Relative pectate lyase activity after pre- incubation at elevated temperatures. SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID Temp. NO: 1 NO: 2 NO: 3 NO: 4 NO: 5 NO: 6 RT 100% 100% 100% 100% 100% 100% 70 C. 60% 70% 50% 105% 110% 100% 75 C. 1% 5% 1% 20% 25% 18% 80 C. 1% 1% 1% 1% 1% 1%

    [0046] We observed that the pectate lyase activity of the wildtype polypeptide according to SEQ ID NO: 1 decreased to 60% after pre-incubation at 70 degrees Celsius for 10 minutes. The same was found for the homologous polypeptides with an amino acid sequence according to SEQ ID NO: 2 and 3 (70 and 50% respectively) In contrast, the activity of the A231L variants according to SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6 were unaffected, or even higher than the same polypeptides pre-incubated at room temperature.

    [0047] We also observed that, in contrast to the wild type sequence (SEQ ID NO: 1) and its homologues according to SEQ ID NO: 2 and SEQ ID NO: 3, the A231L variant polypeptides (SEQ ID NO:s 4-6) all showed considerable pectate lyase activity after pre-incubation at 75 degrees C., whereas the wild type enzyme according to SEQ ID NO: 1 and its homologues according to SEQ ID NO: 2 and SEQ ID NO: 3 did not show any significant activity under these conditions (5% or less).

    [0048] The wild-type enzyme according to SEQ ID NO: 1, nor its homologues according to SEQ ID NO: 2 and SEQ ID NO: 3, nor the variants survived pre-treatment at 80 degrees Celsius for 10 minutes. This is graphically represented in FIG. 2.

    [0049] Thermostable pectate lyases have been described to be produced by bacteria of the genus Bacillus [Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367, Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329, Swarupa Rani Chiliveri et al., Carbohydrate Polymers (2014), 111: 264-272, Zhou et al., Appl Environ Microbiol (2015) 81: 5714-5723], hence in a preferred embodiment the invention relates to a polypeptide as described herein wherein the polypeptide is capable of being expressed in a Bacillus species, more preferably Bacillus subtilis.

    [0050] We have shown that several polypeptides may be produced that are homologous to the wild-type sequence according to SEQ ID NO: 1 and still retain their pectate lyase activity. A BLAST search revealed that pectate lyases are available from bacterial origin, in particular from Bacillus species, with an identity as low as 52% or less as compared to SEQ ID NO: 1. The skilled person will therefore have no difficulty in constructing a polypeptide with pectate lyase activity that is at least 70% identical to the sequence of SEQ ID NO: 1 following the procedures and guidance provided herein. He will also be able to make the A231L variants as described herein, thereby obtaining a calcium-independent pectate lyase with an improved thermostability.

    [0051] In a preferred embodiment, the invention relates to a polypeptide as described herein comprising an amino acid sequence that is at least 75% identical to the amino acid according to SEQ ID NO: 1, such as 80%, 85%. 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%. 97%, 98%, 99% or even 100%.

    [0052] Recovery of a polypeptide according to the invention as produced by a host cell may be performed by any technique known to those skilled in the art. Possible techniques include, but are not limited to secretion of the protein into the expression medium, and purification of the protein from cellular biomass. The production method may further comprise a step of purifying the polypeptide obtained. For thermostable polypeptides, non-limiting examples of such methods include heating of the disintegrated cells and removing coagulated thermo labile proteins from the solution. For secreted proteins, non-limiting examples of such methods include ion exchange chromatography, and ultra-filtration of the expression medium. It is preferred that the purification method of choice is such that the purified protein retains its activity.

    [0053] Accordingly, in a further preferred embodiment, the invention relates to a polypeptide as described herein wherein the polypeptide is an isolated polypeptide.

    [0054] We have shown herein that the A231L variants as described are calcium-independent and have an improved thermostability.

    [0055] The polypeptides as described herein may be used in compositions containing several additional components, such as stabilizers, fillers, cell debris, culture medium etcetera. Hence, the invention provides a composition comprising a polypeptide as described herein.

    [0056] Polypeptides as described herein may be obtained by expressing a recombinant DNA in a heterologous expression system. The term heterologous expression system or equivalent means a system for expressing a DNA sequence from one host organism in a recipient organism from a different species or genus than the host organism. The most prevalent recipients, known as heterologous expression systems, are chosen usually because they are easy to transfer DNA into or because they allow for a simpler assessment of the protein's function. Heterologous expression systems are also preferably used because they allow the upscaling of the production of a protein encoded by the DNA sequence in an industrial process. Preferred recipient organisms for use as heterologous expression systems include bacterial, fungal and yeast organisms, such as for example Escherichia coli, Bacillus, Corynebacterium, Pseudomonas, Pichia pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, filamentus fungi and many more systems well known in the art.

    [0057] The presently disclosed polypeptides or proteins may be fused to additional sequences, by attaching or inserting, including, but not limited to, affinity tags, facilitating protein purification (S-tag, maltose binding domain, chitin binding domain), domains or sequences assisting folding (such as thioredoxin domain, SUMO protein), sequences affecting protein localization (periplasmic localization signals etc), proteins bearing additional function, such as green fluorescent protein (GFP), or sequences representing another enzymatic activity. Other suitable fusion partners for the presently disclosed polypeptides are known to those skilled in the art.

    [0058] The present invention also relates to polynucleotides encoding any of the pectate lyase variants disclosed herein. Means and methods for cloning and isolating such polynucleotides are well known in the art.

    [0059] Furthermore, the present invention relates to a vector comprising a polynucleotide according to the invention, optionally operably linked to one or more control sequences. Suitable control sequences are readily available in the art and include, but are not limited to, promoter, leader, polyadenylation, and signal sequences.

    [0060] Pectate lyase variants according to various embodiments of the present invention may be obtained by standard recombinant methods known in the art. Briefly, such a method may comprise the steps of: culturing a recombinant host cell as described above under conditions suitable for the production of the polypeptide, and recovering the polypeptide obtained. The polypeptide may then optionally be further purified.

    [0061] A large number of vector-host systems known in the art may be used for recombinant production of the pectate lyases as described herein. Possible vectors include, but are not limited to, plasmids or modified viruses which are maintained in the host cell as autonomous DNA molecule or integrated in genomic DNA. The vector system must be compatible with the host cell used as is well known in the art. Non-limiting examples of suitable host cells include bacteria (e.g. E. coli, bacilli), yeast (e.g. Pichia Pastoris, Saccharomyces Cerevisae), fungi (e.g. filamentous fungi) insect cells (e.g. Sf9).

    [0062] In yet other terms, the invention relates to a method for improving the thermostability of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising the step of altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    [0063] In a further preferred embodiment, the invention relates to a method for decreasing, abolishing or removing the calcium dependence of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising the step of altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    [0064] The polypeptides with pectate lyase activity according to the present invention may be used in a wide range of different industrial processes and applications, such as cellulose recovery from lignocellulosic biomass, decreasing the energy required for the refining of wood and production of a sugar from a lignocellulosic material. They may also be used in wood pulp preparation, in pulp delignification, textile dye bleaching, wastewater detoxifixation, xenobiotic detoxification, degrading or decreasing the structural integrity of lignocellulosic material and detergent manufacturing.

    EXAMPLES

    Example 1: Preparation of a Polypeptide According to SEQ ID NO: 1

    [0065] The DNA construct disclosed in Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329 encoding the polypeptide according to SEQ ID NO: 1 was optimized for expression in E. coli and commercially synthesized and cloned into a standard plasmid vector pET28a+ under the control of T7-RNA-polymerase promoter for expression in Escherichia coli BL21(DE3). The nucleotide sequence of the construct is provided herein as SEQ ID NO: 7

    Example 2: Preparation of Variants of a Polypeptide According to SEQ ID NO: 1 with Pectate Lyase Activity

    [0066] Homologous protein sequences (according to SEQ ID NO: 2 and SEQ ID NO: 3) were generated by random mutagenesis of SEQ ID NO:s 7 and SEQ ID NO: 8 using error-prone PCR essentially as described (Curr Protoc Mol Biol. 2001 May; Chapter 8: Unit 8.3. doi: 10.1002/0471142727.mb0803s51, Random mutagenesis by PCR. Wilson DS1, Keefe AD) using a commercial random PCR mutagenesis kit (QuikChange II XL Site-Directed Mutagenesis kit by Agilent Technologies). More in particular, the DNA sequence of SEQ ID NO: 8 was obtained from SEQ ID NO: 7 encoding the polypeptide according to SEQ ID NO: 1. The DNA sequence of SEQ ID NO: 9 was obtained by random mutagenesis of SEQ ID NO: 8 encoding the polypeptide according to SEQ ID NO: 2. SEQ ID NO: 9 is the DNA sequence encoding the polypeptide according to SEQ ID NO: 3.

    [0067] PCR fragments resulting from error-prone PCR were cloned to the plasmid vector pET28a+ under the control of T7-RNA-polymerase promoter for expression in Escherichia coli BL21(DE3), and screened for pectate lyase activity of the recombinant proteins.

    [0068] Active clones were subjected to further rounds of randomization using the same protocol. The polypeptide according to SEQ ID NO: 2 exhibited pectate lyase activity and was found to be 93% identical with SEQ ID NO: 1. The polypeptide according to SEQ ID NO: 3 also exhibited pectate lyase activity and was found to be 89% identical with SEQ ID NO: 1.

    Example 3: Preparation of A231L Variant Polypeptides According to SEQ ID NO: 4-6

    [0069] In order to prepare a polypeptide according to SEQ ID NO: 4, a mutation was introduced into the polypeptide according to SEQ ID NO: 1 at position 231. The alanine residue from that position in SEQ ID NO: 1 was replaced by a leucine residue. This alteration is herein referred as A231L.

    [0070] This was achieved by standard site-directed mutagenesis essentially as described in WO 2013/038062. In more detail: To introduce mutation A231L into the gene encoding SEQ ID NO: 1, we carried out two separate PCR reactions:

    TABLE-US-00002 (1)withprimersPrimer1 (SEQIDNO:13) gaaattaatacgactcactatagg and Primer2(A231L) (SEQIDNO:14) GCCATCATGCTGCTGAAACGGACGACCAAAATAGGTG, (2)withPrimer3(A231L) (SEQIDNO:15) GGTCGTCCGTTTCAGCAGCATGATGGCctgCTGGATATC and Primer4 (SEQIDNO:16) ggttatgctagttattgctcagcggtg.

    [0071] In both reactions, recombinant gene without the mutation was used as the template. Primers 1 and 4 bind inside the vector sequence and are not specific to the recombinant gene. Primers 2 and 3 bind inside the recombinant gene and their binding sites overlap. Primer 3 binding site contains the mutation site. Primer 3 represents the mutated (desired) sequence, which is not 100% matching the template (lower case type font in the primer sequence indicates the mismatched nucleotides). However, the primer has enough affinity and specificity to the binding site to produce the desired PCR product. Purified PCR products from reactions (1) and (2) were combined and used as template for PCR reaction with Primer 1 and Primer 4. The product of this reaction, containing the variant sequence of the gene encoding the polypeptide according to SEQ ID NO: 4, was cloned in a plasmid vector for expression in E. coli.

    [0072] The same protocol and the same primers were used for introducing the A231L mutation into the genes encoding the polypeptide according to SEQ ID NO: 2 and SEQ ID NO: 3, thereby yielding polypeptides according to SEQ ID NO: 5 and SEQ ID NO: 6 respectively.

    Example 4: Heterologous Expression of Polypeptides with Pectate Lyase Activity

    [0073] For recombinant expression in E. coli, recombinant genes were cloned into pET-28 commercial expression vector under the control of T7 bacteriophage promoter.

    [0074] Protein production was carried out in E. coli BL21(DE3) strain according to the plasmid manufacturer protocol available at http://richsingiser.com/4402/Novagen %20pET %20system %20manual.pdf. The incubation temperature for protein production was 30 degrees C., which was found optimal for maximum yield of the active protein. Cells were lysed using lysis buffer (50 mM Tris-HCl pH7.4, 1% Triton X100, 0.5 mM CaCl) and heated at 60 degrees C. for 20 minutes. Coagulated cell debris was removed by centrifugation. The thermostable recombinant pectate lyases were detected in the soluble fraction only, consistent with the notion that they were thermostable enzymes.

    Example 5: Pectate Lyase Activity Assay

    [0075] Pectate lyase activity assay was carried out essentially as described in Takao M, Nakaniwa T, Yoshikawa K, Terashita T, Sakai T., Purification and characterization of thermostable pectate lyase with protopectinase activity from thermophilic Bacillus sp. TS 47. Biosci Biotechnol Biochem. 2000 64:2360-7. In more detail, pectate lyase activity was assayed by measuring the increase in absorbance at 235 nm of the reaction mixture. Polygalacturonic acid (PGA) sodium salt from de-methylated citrus pectin (purchased from MegaZyme) was used as substrate. A reaction mixture containing 1 ml of 0.1% PGA in 10 mM Tris-HCl buffer, pH 8.0 and 0.5 mM CaCl2, and an appropriate amount of enzyme solution was incubated for 30 minutes at 60 degrees C.

    [0076] The reaction was stopped by placing the mixture in 100 degrees C. (boiling water bath) for 5 min. Relative pectate lyase activity was calculated from the difference in absorption of the reaction mixture at 235 nm at the start and at the end of the reaction.

    Example 6: Thermostability of Polypeptides with Pectate Lyase Activity

    [0077] Thermostability of the polypeptides with pectate lyase activity was determined by pre-incubation for 10 minutes in 50 mM Tris-HCl pH 8.0, either at room temperature (control) or at 70 degrees C., 75 degrees C. and 80 degrees C. before measuring their activity according to example 5.

    [0078] After pre-incubation, the samples were brought to 60 degrees C., substrate (PGA) was added and samples were assayed for activity as described in Example 5 at 60 degrees C. pH 8.0. Residual activities for each sample were calculated as % of the activity of the sample pre-incubated at room temperature (control sample).

    Example 7: Calcium Dependence of Polypeptides with Pectate Lyase Activity

    [0079] Calcium dependence of the polypeptides with pectate lyase activity was determined according to the method described in example 5 except that calcium was omitted from the reaction mixture, i.e. with and without 0.5 mM CaCl2.

    Example 8: Sequences Provided Herein

    [0080] Amino acid sequence and nucleotide sequences are provided herewith in the WIPO ST_25 standard. For convenience, the sequences are also provided in table 2.

    [0081] SEQ ID NO: 1 is derived from the prior art and has been disclosed in Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367 and in Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329.

    [0082] SEQ ID NO: 2 was obtained by random mutagenesis of the DNA encoding SEQ ID NO: 1 (shown herein as SEQ ID NO: 7) as described in example 2, SEQ ID NO: 3 was obtained by random mutagenesis of the DNA encoding SEQ ID NO: 2 (shown herein as SEQ ID NO: 8). The DNA encoding the polypeptide according to SEQ ID NO: 3 is shown herein as SEQ ID NO: 9. The amino acids deviating from the wild type sequence of SEQ ID NO: 1 are shown in capital letters.

    [0083] The polypeptide with an amino acid sequence according to SEQ ID NO: 2 is a homologue of the polypeptide according to SEQ ID NO: 1. These two polypeptides have 385 of the 416 amino acids in common, in other words they are 93% identical.

    [0084] The polypeptide according to SEQ ID NO: 3 is also a homologue of the polypeptide according to SEQ ID NO: 1. These two polypeptides have 369 of the 416 amino acids in common, in other words they are 89% identical.

    [0085] The polypeptides according to SEQ ID NO:s 4, 5 and 6 are derivable from the polypeptides according to SEQ ID NO:s 1, 2 and 3 respectively, by altering the amino acid corresponding to the amino acid at position 231 in SEQ ID NO: 1 into a leucine residue. The amino acid corresponding to position 231 in SEQ ID NO: 1 is indicated in bold and underlined typeface in table 2.

    [0086] The nucleotide sequences according to SEQ ID NO:s 10, 11 and 12 encode the polypeptides with the A231L variant according to SEQ ID NO:s 4, 5 and 6 respectively.

    [0087] The nucleotide sequences according to SEQ ID NO:s 13-16 correspond to the primers used for producing A231L variants from the polypeptides with an amino acid sequence according to SEQ ID NO: 1-3, as detailed in example 3.

    TABLE-US-00003 TABLE2 Aminoaddandnucleotidesequencesdisclosedherein, SEQIDNO: Sequence 1 1 kelghevlkpydgwaaygegttggamaspgnvfvvtnrteliqalggnnhtnqynsvpki 61 iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121 kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181 tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldiknssdf 241 itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361 lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 2 1 kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61 iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121 kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181 tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldiknssdf 241 itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361 lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 3 1 kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61 iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121 kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181 EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldiknssdf 241 itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361 lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 4 1 kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61 iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121 kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181 tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdglldiknssdf 241 itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361 lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 5 1 kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61 iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121 kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181 tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdglldiknssdf 241 itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361 lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 6 1 kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61 iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121 kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181 EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdglldiknssdf 241 itisynvfKDhdkvSligSsdsrKTdEghlRvtlhhnyyknvtqrlprvrfgqvhiynny 301 yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361 lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 7 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt 60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa 120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc 180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg 240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca 300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa 360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt 420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc 540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt 600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat 660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc 780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac 900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt 960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg 1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgacccog 1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat 1248 8 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt 60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa 120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc 180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg 240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa 300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa 360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt 420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc 540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt 600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat 660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc 780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac 900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa 960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa 1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgacccog 1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat 1248 9 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt 60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa 120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc 180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg 240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa 300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa 360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt 420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt 540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt 600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat 660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc 780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac 900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa 960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa 1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgacccog 1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat 1248 10 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt 60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa 120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc 180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg 240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca 300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa 360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt 420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc 540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt 600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat 660 tttggtcgtccgtttcagcagcatgatggcctgctggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc 780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac 900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt 960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg 1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgacccog 1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat 1248 11 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt 60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa 120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc 180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg 240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa 300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa 360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt 420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagcaccggtggdttattttccggaatgggatccgaccgatggc 540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt 600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat 660 tttggtcgtccgtttcagcagcatgatggcctgctggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc 780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac 900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa 960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa 1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgacccog 1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat 1248 12 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt 60 acaaccggtggtagcgaagaaagtccggataatgtttataccgttaccaataaaagcgaa 120 ctagttcaggcactggatagtaataatcataccaatcagtataattccaccccgaaaatc 180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg 240 gaatattatgatgatccgaattatgattttgaagcctatctgaaagagtatgatccgaaa 300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa 360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt 420 aaagatgccaaaattgtaggtggtggtttcctgattaaaaacgtggataatgtgatcatc 480 cgcaacatcgaatttgaagaaccggttgatttttttccggaatgggatccgaccgatggt 540 aaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt 600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat 660 tttggtcgtccgtttaagaagcatgatggcctgctggatatcaaaaatagcagcgatttt 720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattagttcaagc 780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa 840 aatgttacccagcgtctgcctcgtgttcgttttgatcaggttcatatctataacaactac 900 tatgagtttagcaacctgaccgattatgactttcaatatgcatggggtgttgatgttgaa 960 agcaaaatctatgoccagaacaactatttcagottcgattgggatattgacccgagcaaa 1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat 1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg 1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg 1200 agcgttccggcactggttaaagcaaaagccggtgaaggtaatctgcat 1248 13 gaaattaatacgactcactatagg 14 gccatcatgctgctgaaacggacgaccaaaataggtg 15 gatcgtccgtttcagcaacatgatggcctgctagatatc 16 ggttatgctagattattctcagaggtg