GENE THERAPY VECTORS FOR TREATMENT OF DANON DISEASE

20200148745 ยท 2020-05-14

Assignee

Inventors

Cpc classification

International classification

Abstract

The disclosure relates to optimized polynucleotide sequences for LAMP-2B, expression cassettes, vectors, and methods of use thereof in treating disease, e.g. Danon disease.

Claims

1. An adeno-associated virus (AAV) vector, comprising an expression cassette comprising a polynucleotide sequence that encodes a LAMP-2B protein, operatively linked to a promoter, wherein the polynucleotide sequence comprises any one of SEQ ID NOs: 3-5.

2. The AAV vector of claim 1, wherein the LAMP-2B protein comprises SEQ ID NO: 1.

3. The AAV vector of claim 1, wherein the polynucleotide sequence comprises SEQ ID NO: 3.

4. The AAV vector of claim 1, wherein the polynucleotide sequence comprises SEQ ID NO: 4.

5. The AAV vector of claim 1, wherein the polynucleotide sequence comprises SEQ ID NO: 5.

6. The AAV vector of claim 1, wherein the promoter is a CAG promoter.

7. The AAV vector of claim 1, wherein the promoter comprises an enhancer/promoter region that shares at least 95% identity to SEQ. ID NO: 22.

8. The AAV vector of claim 7, wherein the enhancer/promoter region comprises SEQ ID NO: 22.

9. The AAV vector of claim 1, wherein the expression cassette comprises, in 5 to 3 order: (a) an enhancer/promoter region that comprises SEQ. ID NO: 22; (b) the polynucleotide sequence that encodes the LAMP-2B protein, wherein the polynucleotide sequence comprises SEQ ID NO: 3; (c) a 3 UTR sequence that comprises SEQ ID NO: 27; and (d) a poly-adenylation sequence that comprises SEQ ID NO: 7.

10. (canceled)

11. The AAV vector of claim 9, wherein the expression cassette is flanked by (i) a 5 ITR that comprises SEQ ID NO: 11 and (ii) a 3 ITR that comprises SEQ ID NO: 12.

12. The AAV vector of claim 9, wherein the expression cassette shares at least 95% identity to SEQ ID NO: 8.

13. The AAV vector of claim 12, wherein the expression cassette comprises SEQ ID NO: 8.

14. The AAV vector of claim 1, wherein the AAV vector comprises an AAV9 capsid.

15. The AAV vector of claim 14, wherein the AAV9 capsid comprises one or more capsid proteins that comprise amino acids 1 to 736 of SEQ ID NO: 27; amino acids 138 to 736 of SEQ ID NO: 27; or amino acids 203 to 736 of SEQ ID NO: 27.

16-18. (canceled)

19. A polynucleotide sequence comprising any one of SEQ ID NOs: 3-5.

20. The polynucleotide sequence of claim 19, comprising SEQ ID NO: 3.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0034] FIG. 1A provides a diagram of an illustrative embodiment of a viral vector of the disclosure.

[0035] FIG. 1B provides a diagram of an illustrative embodiment of an expression cassette of an adeno-associated virus (AAV) gene therapy vector.

[0036] FIG. 2 shows the expression cassette of plasmid-based green fluorescence protein (GFP) reporter system used to test and compare wildtype verses codon-optimized LAMP-2B constructs.

[0037] FIG. 3 is a graph showing transfection expression efficiency of LAMP-2B constructs tested using transfection of a plasmid-based GFP reporter system and measured as GFP+ cells per well. A wild-type LAMP-2B construct (WT) is compared to three codon-optimized (CO) constructs, CO 1, CO 2, and CO 3, and a no-vector control (labeled ViaFect Only).

[0038] FIG. 4 is a graph showing the gene expression level in cells transfected with plasmid-based GFP reporting systems used to test LAMP-2B constructs, which is measured as mean GFP intensity of GFP+ cells in absorbance units (A.U.). GFP expression by cells transfected with a wild-type LAMP-2B construct (WT) is compared to GFP expression by three codon-optimized (CO) constructs, CO 1, CO 2, and CO 3, or a no-vector control (labeled ViaFect Only).

[0039] FIG. 5 shows immunofluorescence images of induced pluripotent stem cell (iPSC)-derived cardiomyocytes two days after transfection with a plasmid-based GFP reporter system. Cells were transfected with no DNA, or LAMP-2B constructs expressing wild-type LAMP-2B, the CO 1 variant, the CO 2 variant, or the CO 3 variant.

[0040] FIG. 6 shows immunofluorescence images of iPSC-derived cardiomyocytes seven days after transfection with a plasmid-based GFP reporter system. Cells were transfected with no DNA, or LAMP-2B constructs expressing wild-type LAMP-2B, the CO 1 variant, the CO 2 variant, or the CO 3 variant.

[0041] FIG. 7A shows an immunoblot of human LAMP-2B protein in CHO-Lec2 cells transduced with AAV9 viral vectors comprising the wild-type LAMP-2B v1.0 transgene (AAV9 1.0), the optimized variant LAMP-2B v1.2 transgene (AAV9 1.2) or a GFP transgene (AAV9 GFP). Molecular weight markers (MW) and a control LAMP-2B recombinant protein sample (LAMP2B (+ve control)) were also included.

[0042] FIG. 7B shows quantification of LAMP-2B protein by ELISA in CHO-Lec2 cells transduced with AAV9-wild-type LAMP-2B (v1.0), AAV9-optimized LAMP-2B (v1.2) or AAV9-GFP (GFP) vectors.

[0043] FIG. 8A shows immunofluorescence images of Danon patient iPSC-derived cardiomyocytes transduced with the indicated amounts of AAV9-Luc (Luc), AAV9-wild-type LAMP-2B (LAMP2B v1.0) or AAV9-optimized LAMP-2B (LAMP2B v1.2) vectors.

[0044] FIG. 8B shows quantification of immunofluorescence of human LAMP-2B protein in Danon patient iPSC-derived cardiomyocytes transduced with AAV9-Luc, AAV9-wild-type LAMP-2B (v1.0) or AAV9-optimized LAMP-2B (v1.2) vectors.

[0045] FIG. 8C shows an immunoblot of human LAMP-2B protein in Danon patient iPSC-derived cardiomyocytes transduced with AAV9-Luc, AAV9-wild-type LAMP-2B (v1.0) or AAV9-optimized LAMP-2B (v1.2) vectors.

[0046] FIG. 9A shows PCR quantification of viral vector DNA in cardiac tissue isolated from LAMP-2-deficient mice treated with AAV9-wild-type LAMP-2B (v1.0), AAV9-optimized LAMP-2B (v1.2) or an AAV9 vehicle control. Vector copy number was quantified as VCN/Diploid Nucleus in the cardiac tissue. Control wild-type mice not injected with vector were included as controls (WT).

[0047] FIG. 9B shows quantitative RT-PCR analyses of transgene mRNA, measured by RT-PCR using probes specific for the WPRE element, in cardiac tissue isolated from LAMP-2-deficient mice treated with AAV9-wild-type LAMP-2B (v1.0), AAV9-optimized LAMP-2B (v1.2) or an AAV9 vehicle control (Vehicle). Expression of mRNA was quantified as vector genomes (vg) per g total cellular RNA using a standard curve to convert copy number to vector genomes.

[0048] FIG. 9C shows an immunoblot of LAMP-2B protein in cardiac tissue isolated from LAMP-2-deficient mice treated with AA9-wild-type LAMP-2B (v1.0), AAV9-optimized LAMP-2B (v1.2) or the AAV9 vehicle control (Vehicle) compared to untreated wild-type mice (Untreated).

[0049] FIG. 9D shows immunofluorescence images of human LAMP-2B protein in cardiac tissue isolated from LAMP-2-deficient mice treated with AAV9-wild-type LAMP-2B (v1.0), AAV9-optimized LAMP-2B (v1.2) or the AAV9 vehicle control.

[0050] FIG. 10A shows PCR quantification of viral vector DNA in heart, muscle, liver and brain tissue isolated from primates treated with the AAV9-optimized human LAMP-2B (treated) vector or no vector vehicle control (untreated). Individuals are denoted as black or white squares.

[0051] FIG. 10B shows PCR quantification of viral vector DNA in cardiac chambers isolated from primates treated with AAV9-optimized human LAMP-2B vector (treated) or no vector vehicle control (untreated). Individuals are denoted as B059 (male, M), A991 (female, F), and A602 (male, M).

[0052] FIG. 10C shows quantitative RT-PCR analyses of transgene mRNA, measured by RT-PCR using probes specific for the WPRE element, in heart, muscle, liver and brain tissue isolated from primates treated with the AAV9-optimized human LAMP-2B vector (treated) or no vector vehicle control (untreated).

[0053] FIG. 10D shows quantitative RT-PCR analyses of transgene mRNA in cardiac chambers isolated from primates injected with the AAV9-optimized human LAMP-2B vector (treated) or no vector vehicle control (untreated).

[0054] FIG. 10E shows percentage of cells expressing transgene mRNA in situ in heart, muscle and liver tissue isolated from primates injected with AAV9-optimized human LAMP-2B vector (treated) or no vector vehicle control (untreated). Individuals are denoted as B059 (male, M), A991 (female, F), and A602 (male, M).

[0055] FIG. 10F shows transgene mRNA staining in situ in heart tissue isolated from primates injectioned with the AAV9-optimized human LAMP-2B vector or no vector vehicle control (untreated). Individuals are denoted as B059 (male, M), A991 (female, F), and A602 (male, M).

[0056] FIG. 10G shows fold change of LAMP-2B protein assessed by western blot in heart, muscle and liver tissue isolated from primates treated with the AAV9-optimized human LAMP-2B vector relative to no vector (untreated).

[0057] FIG. 10H shows fold change of LAMP-2B protein assessed by western blot in cardiac chambers isolated from primates treated with the AAV9-optimized human LAMP-2B vector relative to no vector (untreated).

[0058] FIG. 10I shows quantification of LAMP-2B protein by ELISA in heart, muscle and liver tissue isolated from primates treated with the AAV9-optimized human LAMP-2B vector relative to no vector (untreated).

[0059] FIG. 10J shows quantification of LAMP-2B protein by ELISA in cardiac chambers isolated from primates treated with the AAV9-optimized human LAMP-2B vector relative to no vector (untreated).

DETAILED DESCRIPTION OF THE INVENTION

[0060] The present disclosure provides improved polynucleotide sequences, expression cassettes, and vectors encoding an isoform of LAMP-2 (e.g., LAMP-2B), as well as related pharmaceutical compositions, and their use to treat diseases and disorders associated with LAMP-2 deficiency or mutation. The present inventors have discovered that modifications to the gene sequence of LAMP-2B result in increased transgene expression. In addition, the presence of specific sequence elements in the expression cassettes of gene therapy vectors encoding LAMP-2B result in an improvement in transgene expression. Accordingly, the LAMP-2 polynucleotide sequences, expression cassettes, and vectors disclosed herein offer advantages for gene therapy as compared to previous gene therapy vectors, including the ability to achieve higher levels of LAMP-2 expression in therapeutically relevant tissues.

[0061] The wild-type polypeptide sequence of human LAMP-2B (SEQ ID NO: 1) and the wild-type polynucleotide sequence encoding human LAMP-2B (SEQ ID NO: 2) are, respectively:

TABLE-US-00001 (SEQIDNO:1) 1 MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT 61 YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT 121 GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG 181 TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ 241 LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN 301 ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG 361 KYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQT; and (SEQIDNO:2) 1 ATGGTGTGCTTCCGCCTCTTCCCGGTTCCGGGCTCAGGGCTCGTTCTGGTCTGCCTAGTC 61 CTGGGAGCTGTGCGGTCTTATGCATTGGAACTTAATTTGACAGATTCAGAAAATGCCACT 121 TGCCTTTATGCAAAATGGCAGATGAATTTCACAGTTCGCTATGAAACTACAAATAAAACT 181 TATAAAACTGTAACCATTTCAGACCATGGCACTGTGACATATAATGGAAGCATTTGTGGG 241 GATGATCAGAATGGTCCCAAAATAGCAGTGCAGTTCGGACCTGGCTTTTCCTGGATTGCG 301 AATTTTACCAAGGCAGCATCTACTTATTCAATTGACAGCGTCTCATTTTCCTACAACACT 361 GGTGATAACACAACATTTCCTGATGCTGAAGATAAAGGAATTCTTACTGTTGATGAACTT 421 TTGGCCATCAGAATTCCATTGAATGACCTTTTTAGATGCAATAGTTTATCAACTTTGGAA 481 AAGAATGATGTTGTCCAACACTACTGGGATGTTCTTGTACAAGCTTTTGTCCAAAATGGC 541 ACAGTGAGCACAAATGAGTTCCTGTGTGATAAAGACAAAACTTCAACAGTGGCACCCACC 601 ATACACACCACTGTGCCATCTCCTACTACAACACCTACTCCAAAGGAAAAACCAGAAGCT 661 GGAACCTATTCAGTTAATAATGGCAATGATACTTGTCTGCTGGCTACCATGGGGCTGCAG 721 CTGAACATCACTCAGGATAAGGTTGCTTCAGTTATTAACATCAACCCCAATACAACTCAC 781 TCCACAGGCAGCTGCCGTTCTCACACTGCTCTACTTAGACTCAATAGCAGCACCATTAAG 841 TATCTAGACTTTGTCTTTGCTGTGAAAAATGAAAACCGATTTTATCTGAAGGAAGTGAAC 901 ATCAGCATGTATTTGGTTAATGGCTCCGTTTTCAGCATTGCAAATAACAATCTCAGCTAC 961 TGGGATGCCCCCCTGGGAAGTTCTTATATGTGCAACAAAGAGCAGACTGTTTCAGTGTCT 1021 GGAGCATTTCAGATAAATACCTTTGATCTAAGGGTTCAGCCTTTCAATGTGACACAAGGA 1081 AAGTATTCTACAGCCCAAGAGTGTTCGCTGGATGATGACACCATTCTAATCCCAATTATA 1141 GTTGGTGCTGGTCTTTCAGGCTTGATTATCGTTATAGTGATTGCTTACGTAATTGGCAGA 1201 AGAAAAAGTTATGCTGGATATCAGACTCTGTAA.

[0062] Disclosed herein are modified polynucleotide sequences encoding an isoform of lysosome-associated membrane protein 2 (LAMP-2) or a functional variant thereof. In certain embodiments, the modified polynucleotide sequences comprise one or more of the following modifications as compared to the wild-type polynucleotide encoding the isoform of LAMP-2: codon-optimization, CpG depletion, removal of cryptic splice sites, or a reduced number of alternative open-reading frames (ORFs). In some embodiments, the modified polynucleotide encodes LAMP-2A, LAMP-2B, LAMP-2C or a functional variant of any of these isoforms. In embodiments, the disclosure provides a polynucleotide sequence or transgene encoding LAMP-2B or a functional variant thereof comprising one or more nucleotide substitutions as compared to SEQ ID NO:2. In embodiments, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to a sequence selected from SEQ ID NOs: 3-5. The disclosure provides at least three illustrative variant transgene sequences encoding LAMP-2B (SEQ ID NOs: 3-5):

TABLE-US-00002 (SEQIDNO:3) 1 ATGGTCTGCTTCAGACTGTTCCCTGTCCCTGGATCTGGTCTGGTGCTTGTGTGCTTGGTG 61 CTGGGTGCTGTGAGATCCTATGCCCTTGAGCTGAACCTGACTGACTCAGAAAATGCCACT 121 TGCCTGTATGCCAAGTGGCAGATGAACTTCACTGTGAGATATGAGACTACCAACAAGACC 181 TACAAGACTGTGACCATCTCAGACCATGGCACTGTCACCTACAATGGATCAATCTGTGGT 241 GATGATCAGAATGGCCCAAAGATAGCAGTGCAGTTTGGGCCCGGTTTTTCCTGGATTGCT 301 AACTTCACCAAGGCAGCCTCCACCTACAGCATTGACTCAGTCAGCTTCAGCTACAACACT 361 GGGGATAACACCACCTTCCCTGACGCAGAGGACAAGGGAATCCTTACTGTGGACGAACTC 421 CTGGCAATCAGAATCCCCCTTAACGACCTGTTCAGATGCAACTCCCTTTCAACCCTTGAA 481 AAGAATGATGTGGTGCAACACTATTGGGACGTCCTGGTGCAAGCCTTTGTGCAGAATGGG 541 ACAGTGAGTACCAACGAGTTCCTCTGTGACAAGGACAAGACCAGCACTGTGGCCCCCACT 601 ATCCACACCACTGTGCCCAGCCCTACCACTACCCCCACCCCTAAAGAGAAGCCAGAAGCT 661 GGAACCTACTCAGTCAACAATGGAAATGACACATGCCTCCTTGCCACCATGGGACTGCAG 721 CTGAACATCACTCAGGACAAGGTGGCCTCAGTGATTAACATCAACCCTAACACCACTCAT 781 AGCACTGGGAGCTGCAGATCACATACAGCTCTGCTGAGGCTCAACTCCTCCACCATCAAG 841 TACCTGGACTTTGTGTTTGCTGTGAAGAATGAGAACAGGTTCTACCTCAAGGAAGTGAAC 901 ATTTCCATGTACCTGGTCAATGGTTCAGTGTTCTCTATTGCCAACAACAATCTGAGCTAC 961 TGGGATGCACCCCTGGGATCCTCCTACATGTGCAACAAGGAGCAGACTGTGAGTGTGTCA 1021 GGTGCTTTTCAGATCAACACTTTTGACCTGAGGGTGCAGCCCTTCAATGTGACTCAGGGA 1081 AAGTACTCCACTGCACAAGAGTGTTCCTTGGATGATGACACTATCCTCATCCCCATTATT 1141 GTGGGAGCTGGACTGTCAGGATTGATTATAGTGATTGTGATTGCTTATGTGATTGGAAGG 1201 AGAAAGAGCTATGCTGGCTACCAGACCCTGTAA; (SEQIDNO:4) 1 ATGGTGTGCTTTAGACTGTTTCCTGTGCCTGGTTCAGGGCTGGTCCTGGTCTGTCTGGTG 61 CTGGGGGCTGTCAGAAGCTATGCCTTGGAGCTGAACCTCACTGATAGTGAAAATGCCACT 121 TGTCTGTATGCTAAGTGGCAGATGAACTTCACTGTGAGATATGAAACCACCAACAAGACT 181 TACAAAACAGTGACCATCTCAGATCATGGAACTGTGACCTACAACGGCAGCATTTGTGGA 241 GACGACCAGAACGGACCAAAAATCGCTGTCCAATTTGGGCCTGGATTCTCCTGGATTGCC 301 AATTTCACTAAAGCTGCCTCCACATATTCAATTGACTCAGTGTCCTTCTCCTACAACACT 361 GGGGACAACACTACTTTCCCTGATGCTGAAGATAAGGGAATCTTGACAGTGGATGAGCTG 421 CTGGCTATCAGGATCCCTTTGAATGACCTGTTTAGGTGTAATTCACTGAGCACTCTGGAG 481 AAGAACGACGTGGTGCAGCACTACTGGGACGTGCTGGTGCAGGCCTTTGTGCAGAACGGC 541 ACTGTGTCCACCAACGAATTCCTGTGTGATAAGGACAAAACTTCCACTGTGGCACCTACA 601 ATTCACACTACTGTGCCTTCACCTACCACCACTCCAACTCCAAAGGAAAAGCCTGAAGCA 661 GGAACCTACTCTGTGAACAATGGCAATGATACCTGTCTGTTGGCCACCATGGGCCTCCAA 721 CTGAACATTACTCAGGACAAGGTGGCCTCAGTGATTAACATTAACCCCAACACTACCCAC 781 TCCACTGGCAGCTGTAGATCACACACAGCCTTGCTCAGACTGAATAGCAGCACCATCAAG 841 TATTTGGATTTTGTGTTTGCAGTGAAGAATGAAAACAGGTTCTACCTGAAGGAAGTCAAC 901 ATCTCAATGTACCTGGTGAACGGCTCAGTGTTCAGCATTGCCAACAACAACCTCTCCTAT 961 TGGGACGCTCCACTGGGGAGCAGCTACATGTGTAACAAGGAACAGACTGTGTCAGTGTCA 1021 GGAGCCTTCCAGATTAACACCTTTGATCTGAGGGTCCAACCCTTTAATGTCACTCAAGGA 1081 AAGTATAGCACTGCCCAGGAGTGCTCCCTGGATGATGACACCATTCTGATTCCAATCATT 1141 GTGGGTGCAGGACTTTCTGGGCTTATTATTGTGATTGTGATTGCCTATGTGATTGGCAGA 1201 AGGAAATCCTATGCAGGGTACCAAACTCTGTAA; and (SEQIDNO:5) 1 ATGGTCTGTTTTAGGCTGTTCCCTGTCCCTGGTTCAGGACTGGTCTTAGTGTGTCTGGTG 61 CTTGGAGCTGTCAGAAGCTATGCCCTGGAGCTGAACCTGACTGACTCAGAAAATGCCACT 121 TGCCTGTATGCCAAGTGGCAGATGAACTTCACTGTCAGATATGAAACCACCAACAAGACC 181 TATAAGACTGTGACCATCTCAGACCATGGCACTGTGACTTACAATGGGTCAATTTGTGGA 241 GATGACCAGAATGGCCCTAAGATAGCTGTCCAGTTTGGTCCAGGATTCAGCTGGATTGCC 301 AACTTCACCAAGGCAGCCAGCACCTACAGCATTGACTCTGTGTCCTTCTCCTACAACACA 361 GGAGACAACACCACTTTCCCTGATGCAGAGGACAAAGGTATCCTGACTGTGGATGAGTTG 421 CTGGCAATCAGGATCCCACTGAACGATCTGTTCAGGTGCAACTCACTGTCCACTCTGGAA 481 AAGAATGATGTGGTGCAGCACTATTGGGATGTGCTAGTCCAGGCCTTTGTCCAGAATGGG 541 ACTGTGTCAACTAATGAGTTCCTGTGTGACAAGGACAAGACAAGCACTGTAGCCCCCACT 601 ATCCATACCACAGTACCTAGCCCCACCACTACTCCAACCCCCAAGGAGAAGCCTGAGGCT 661 GGCACCTACTCAGTGAACAATGGGAATGACACCTGTTTGCTGGCCACTATGGGACTCCAA 721 CTGAACATCACCCAGGACAAAGTGGCCTCTGTGATCAATATCAATCCCAACACCACCCAC 781 AGCACTGGGTCCTGCAGAAGCCACACTGCCCTCCTGAGGCTCAACTCATCAACTATCAAG 841 TACTTGGATTTTGTGTTTGCAGTGAAGAATGAGAACAGATTCTACCTCAAAGAGGTCAAC 901 ATTTCAATGTACCTGGTGAATGGGAGTGTGTTCTCCATTGCTAACAACAACCTGAGCTAC 961 TGGGATGCCCCTCTGGGCTCCTCATACATGTGCAACAAGGAACAGACTGTGAGTGTGTCA 1021 GGGGCCTTCCAGATCAACACTTTTGACCTGAGAGTGCAGCCCTTTAATGTGACACAGGGA 1081 AAGTACAGCACTGCTCAGGAGTGCAGCCTGGATGATGACACTATCCTGATCCCTATCATT 1141 GTGGGGGCAGGCCTGTCTGGACTCATTATTGTGATTGTGATTGCCTATGTGATAGGGAGA 1201 AGGAAGTCTTATGCTGGATACCAGACCCTGTAA.

[0063] In an embodiment, the transgene shares at least 95% identity to a sequence selected from SEQ ID NOs: 3-5. In an embodiment, the transgene shares at least 99% identity to a sequence selected from SEQ ID NOs: 3-5. In an embodiment, the transgene comprises a sequence selected from SEQ ID NOs: 3-5. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 3. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 4. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 5.

[0064] In some embodiments, the transgene is similar to or identical to a subsequence of any one of SEQ ID NOs: 3-5. In some embodiments, the transgene comprises a subsequence of any one of SEQ ID NOs: 3-5. In various embodiments, the subsequence may comprise any set of consecutive nucleotides (nt) in the full sequence having a length of at least about 50 nt, at least about 100 nt, at least about 150 nt, at least about 250 nt, at least about 200 nt, at least about 350 nt, at least about 450 nt, at least about 400 nt, at least about 450 nt, at least about 550 nt, at least about 600 nt, at least about 650 nt, at least about 600 nt, at least about 650 nt, at least about 700 nt, at least about 750 nt, at least about 800 nt, at least about 850 nt, at least about 900 nt, at least about 950 nt, or at least about 1000 nt.

[0065] In some embodiments, the transgene shares at least 95% identity to a subsequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of any one of SEQ ID NO: 3-5. In an embodiment, the transgene shares at least 99% identity to a subsequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of any one of SEQ ID NO: 3-5. In an embodiment, the transgene comprises a sequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of any one of SEQ ID NOs: 3-5. In embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to a subsequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of any one of SEQ ID NOs: 3-5. In embodiments, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to a subsequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of SEQ ID NO: 3. In embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to a subsequence that comprises nucleotides 1-500, 250-750, 500-1000, or 750-1240 of SEQ ID NO: 3.

[0066] In certain embodiments, the transgene encodes any of the various isoforms of LAMP-2, including any of LAMP-2A, LAMP-2B, or LAMP-2C, or a functional fragment or variant of any of these isoforms. Thus, in particular embodiments, the expression cassette is an optimized polynucleotide sequence encoding any of LAMP-2A, LAMP-2B, or LAMP-2C, or a functional fragment or variant thereof, which comprises one or more modifications as compared to the corresponding wild-type polynucleotide sequence, including one or more modification selected from: codon-optimization of the transgene sequence encoding LAMP-2A, LAMP-2B, or LAMP-2C; the expression cassette or transgene sequence contains fewer CpG sites than its corresponding wild-type sequence; the expression cassette or transgene sequence contains fewer CpG sites than its corresponding wild-type sequence; the expression cassette or transgene sequence contains fewer cryptic splice sites than its corresponding wild-type sequence; and/or the expression cassette or transgene sequence contains fewer open reading frames than its corresponding wild-type sequence. In particular embodiments, the optimized sequence is optimized for increased expression in human cells. The wild-type human polynucleotide sequences encoding the LAMP-2A and LAMP-2C isoforms are set forth in SEQ ID NOs: 29 and 30, respectively. The wild-type sequences of human LAMP-2A and LAMP-2C proteins are set forth in SEQ ID NOs: 34 and 35, respectively. The sequences of the wild-type LAMP-2 isoforms and coding sequences are also publicly available. While the specification describes specific embodiments with respect to LAMP-2B, it is understood that LAMP-2A or LAMP-2C could alternatively be used in each embodiment.

[0067] The coding sequences of wild-type LAMP-2A (SEQ ID NO: 29) and wild-type LAMP-2C (SEQ ID NO: 30) are 100% identical to the coding sequence of wild-type LAMP-2B (SEQ ID NO: 2) across at least nucleotides 1-1080. Accordingly, it will be readily recognized by those in the art that that transgenes, expression cassettes, and vectors disclosed herein can be adapted for expression of these isoforms of LAMP-2 by substituting the 3 end (nucleotides 1081end) of either of LAMP-2A (SEQ ID NO: 29) or wild-type LAMP-2C (SEQ ID NO: 30) in place of nucleotides 1081-1233 of LAMP-2B (e.g., an optimized LAMP-2B of any of SEQ ID NO: 3-5). For example, embodiments of the invention utilize nucleotides 1-1080 of the optimized LAMP-2B gene sequences, SEQ ID NOs: 3-5, which are, respectively, SEQ ID NOs: 31-33.

[0068] In an embodiment, the transgene shares at least 95% identity to a sequence selected from SEQ ID NOs: 31-33. In an embodiment, the transgene shares at least 99% identity to a sequence selected from SEQ ID NOs: 31-33. In an embodiment, the transgene comprises a sequence selected from SEQ ID NOs: 31-33. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 31. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 32. In an embodiment, the transgene shares at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or complete identity to SEQ ID NO: 33. In some cases, the transgene has a polynucleotide sequence that is different from the polynucleotide sequence of a reference sequence, e.g., a native or wild-type LAMP-2B sequence. In some embodiments, the transgene shares at most 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, or 95% identity with a reference sequence. In some embodiments, the reference sequence is SEQ ID NO: 2. For example, SEQ ID NO: 3 shares 78.5% identity to SEQ ID NO: 2.

[0069] In some cases, the transgene has a polynucleotide sequence that is different from the polynucleotide sequence of a reference sequence, e.g., a native or wild-type LAMP-2A sequence. In some embodiments, the transgene shares at most 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, or 95% identity with a reference sequence. In some embodiments, the reference sequence is the wild-type human LAMP-2A sequence set forth in SEQ ID NO: 29.

[0070] In some cases, the transgene has a polynucleotide sequence that is different from the polynucleotide sequence of a reference sequence, e.g., a native or wild-type LAMP-2C sequence. In some embodiments, the transgene shares at most 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, or 95% identity with a reference sequence. In some embodiments, the reference sequence is the wild-type human LAMP-2A sequence set forth in SEQ ID NO: 30.

[0071] In an embodiment, the transgene is codon-optimized for expression in a human host cell. In an embodiment, the transgene coding sequence is modified, or codon optimized to enhance expression by replacing infrequently represented codons with more frequently represented codons. The coding sequence is the portion of the mRNA sequence that encodes the amino acids for translation. During translation, each of 61 trinucleotide codons are translated to one of 20 amino acids, leading to a degeneracy, or redundancy, in the genetic code. However, different cell types, and different animal species, utilize tRNAs (each bearing an anticodon) coding for the same amino acids at different frequencies. When a gene sequence contains codons that are infrequently represented by the corresponding tRNA, the ribosome translation machinery may slow, impeding efficient translation. Expression can be improved via codon optimization for a particular species, where the coding sequence is altered to encode the same protein sequence, but utilizing codons that are highly represented, and/or utilized by highly expressed human proteins (Cid-Arregui et al., 2003; J. Virol. 77: 4928).

[0072] In some embodiments, the coding sequence of the transgene is modified to replace codons infrequently expressed in mammal or in primates with codons frequently expressed in primates. For example, in some embodiments, the transgene encodes a polypeptide having at least 85% sequence identity to a reference polypeptide (e.g. wild-type LAMP-2B; SEQ ID NO: 3)for example, at least 90% sequence identity, at least 95% sequence identity, at least 98% identity, or at least 99% identity to the reference polypeptidewherein at least one codon of the coding sequence has a higher tRNA frequency in humans than the corresponding codon in the sequence disclosed above or herein.

[0073] In an embodiment, the transgene comprises fewer alternative open reading frames than SEQ ID: 2. In an embodiment, the transgene is modified to enhance expression by termination or removal of open reading frames (ORFs) that do not encode the desired transgene. An open reading frame (ORF) is the nucleic acid sequence that follows a start codon and does not contain a stop codon. ORFs may be in the forward or reverse orientation, and may be in frame or out of frame compared with the gene of interest. Such open reading frames have the potential to be expressed in an expression cassette alongside the gene of interest, and could lead to undesired adverse effects. In some embodiments the transgene has been modified to remove open reading frames by further altering codon usage. This may be done by eliminating one or more start codons (ATG) and/or introducing one or more stop codons (TAG, TAA, or TGA) in reverse orientation or out-of-frame to the desired ORF, while preserving the encoded amino acid sequence and, optionally, maintaining highly utilized codons in the gene of interest (i.e., avoiding codons with frequency <20%).

[0074] In some embodiments, the expression cassette comprises at most one, at most two, at most three, at most four, or at most five start codons 5 to the start codon of the transgene. In some embodiments, the expression cassette comprises no start codon 5 to the start codon of the transgene. In some embodiments, one or more ATG codons in the 5 UTR, the promoter, the enhance, the promoter/enhancer element, or other sequences 5 to the start codon of the transgene remain after one or more cryptic start sites are removed. In some embodiments, the expression cassette comprises no cryptic starts sites upstream of transgene to generate erroneous mRNAs.

[0075] In variations of the present disclosure, the transgene coding sequence may be optimized by either codon optimization or removal of non-transgene ORFs or using both techniques. In some cases, one removes or minimizes non-transgene ORFs after codon optimization in order to remove ORFs introduced during codon optimization.

[0076] In an embodiment, the transgene contains fewer CpG sites than SEQ ID: 2. Without being bound by theory, it is believed that the presence of CpG sites in a polynucleotide sequence is associated with the undesirable immunological responses of the host against a viral vector comprising the polynucleotide sequence. In some embodiments, the transgene is designed to reduce the number of CpG sites. Exemplary methods are provides in U.S. Patent Application Publication No. US20020065236A1.

[0077] In an embodiment, the transgene contains fewer cryptic splice sites than SEQ ID: 2. For the optimization, GeneArt software may be used, e.g., to increase the GC content and/or remove cryptic splice sites in order to avoid transcriptional silencing and, therefore, increase transgene expression. Alternatively, any optimization method known in the art may be used. Removal of cryptic splice sites is described, for example, in International Patent Application Publication No. WO2004015106A1.

[0078] Also disclosed herein are expression cassettes and gene therapy vectors encoding LAMP-2B. In certain embodiments, the expression cassettes and gene therapy vectors comprise a codon-optimized or variant LAMP-2B polynucleotide sequence or transgene sequence disclosed herein.

[0079] In particular embodiments, an expression cassette or gene therapy vector encoding LAMP-2B comprises: a consensus optimal Kozak sequence, a full-length polyadenylation (polyA) sequence (or substitution of full-length polyA by a truncated polyA), and minimal or no upstream (i.e. 5) or cryptic start codons (i.e. ATG sites). In some embodiments, the expression cassette comprises no start site 5 to the transgene capable of generating alternative mRNAs. In certain embodiments, the expression cassette or gene therapy vector comprises a sequence encoding LAMP-2B, e.g., a codon-optimized or variant LAMP-2B polynucleotide sequence or transgene sequence disclosed herein.

[0080] In some cases, the expression cassette contains two or more of a first inverted terminal repeat, an enhancer/promoter region, a consensus optimal Kozak sequence, a transgene (e.g., a transgene encoding a LAMP-2B disclosed herein), a 3 untranslated region including a full-length polyA sequence, and a second inverted terminal repeat. In some embodiments, one or both of the inverted terminal repeats (ITRs) are AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, or AAV9 ITRs, or any one ITR known in the art. In some embodiments, the expression cassette comprises exactly two ITRs. In some embodiments, both ITRs are AAV2, AAV5, or AAV9 ITRs. In some embodiments, both ITRs are AAV2 ITRs.

[0081] In an embodiment, the expression cassette comprises a Kozak sequence operatively linked to the transgene. In an embodiment, the Kozak sequence is a consensus optimal Kozak sequence comprising or consisting of SEQ ID NO: 6:

TABLE-US-00003 (SEQIDNO:6) GCCGCCACCATGG.

[0082] In various embodiments, the expression cassette comprises an alternative Kozak sequence operatively linked to the transgene. In an embodiment, the Kozak sequence is an alternative Kozak sequence comprising or consisting of any one of SEQ ID NOs. 14-18:

TABLE-US-00004 (SEQIDNO:14) (gcc)gccRccAUGG; (SEQIDNO:15) AGNNAUGN; (SEQIDNO:16) ANNAUGG; (SEQIDNO:17) ACCAUGG; (SEQIDNO:18) GACACCAUGG.

[0083] In some embodiments, the expression cassette comprises no Kozak sequence.

[0084] In SEQ ID NO: 14, a lower-case letter denotes the most common base at a position where the base can nevertheless vary; an upper-case letter indicate a highly conserved base; indicates adenine or guanine. In SEQ ID NO: 14, the sequence in parentheses (gcc) is optional. In SEQ ID NOs: 15-17, N denotes any base.

[0085] A variety of sequences can be used in place of this consensus optimal Kozak sequence as the translation-initiation site and it is within the skill of those in the art to identify and test other sequences. See Kozak M. An analysis of vertebrate mRNA sequences: intimations of translational control. J. Cell Biol. 115 (4): 887-903 (1991).

[0086] In an embodiment, the expression cassette comprises a full-length polyA sequence operatively linked to the transgene. In an embodiment, the full-length polyA sequence comprises SEQ ID NO: 7:

TABLE-US-00005 (SEQIDNO:7) 1 TGGCTAATAAAGGAAATTTATTTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTC 61 ACTCGGAAGGACATATGGGAGGGCAAATCATTTAAAACATCAGAATGAGTATTTGGTTTA 121 GAGTTTGGCAACATATGCCCATATGCTGGCTGCCATGAACAAAGGTTGGCTATAAAGAGG 181 TCATCAGTATATGAAACAGCCCCCTGCTGTCCATTCCTTATTCCATAGAAAAGCCTTGAC 241 TTGAGGTTAGATTTTTTTTATATTTTGTTTTGTGTTATTTTTTTCTTTAACATCCCTAAA 301 ATTTTCCTTACATGTTTTACTAGCCAGATTTTTCCTCCTCTCCTGACTACTCCCAGTCAT 361 AGCTGTCCCTCTTCTCTTATGGAGATC.

[0087] Various alternative polyA sequences may be used in expression cassettes of the present disclosure, including without limitation, bovine growth hormone polyadenylation signal (bGHpA) (SEQ ID NO: 19), the SV40 early/late polyadenylation signal (SEQ ID NO: 20), and human growth hormone (HGH) polyadenylation signal (SEQ ID NO: 21):

TABLE-US-00006 (SEQIDNO:19) 1 TCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTG 61 ACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCAT 121 TGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAG 181 GATTGGGAGGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTG; (SEQIDNO:20) 1 CAGACATGATAAGATACATTGATGAGTTTGGACAAACCACAACTAGAATGCAGTGAAAAA 61 AATGCTTTATTTGTGAAATTTGTGATGCTATTGCTTTATTTGTAACCATTATAAGCTGCA 121 ATAAACAAGTTAACAACAACAATTGCATTCATTTTATGTTTCAGGTTCAGGGGGAGATGT 181 GGGAGGTTTTTTAAAGCAAGTAAAACCTCTACAAATGTGGTA; (SEQIDNO:21) 1 CTGCCCGGGTGGCATCCCTGTGACCCCTCCCCAGTGCCTCTCCTGGCCCTGGAAGTTGCC 61 ACTCCAGTGCCCACCAGCCTTGTCCTAATAAAATTAAGTTGCATCATTTTGTCTGACTAG 121 GTGTCCTTCTATAATATTATGGGGTGGAGGGGGGTGGTATGGAGCAAGGGGCCCAAGTTG 181 GGAAGAAACCTGTAGGGCCTGC.

[0088] In some embodiments, the expression cassette comprises an active fragment of a polyA sequence. In particular embodiments, the active fragment of the polyA sequence comprises or consists of less than 20 base pair (bp), less than 50 bp, less than 100 bp, or less than 150 bp, e.g., of any of the polyA sequences disclosed herein.

[0089] In some cases, expression of the transgene is increased by ensuring that the expression cassette does not contain competing ORFs. In an embodiment, the expression cassette comprises no start codon within 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, or 500 base pairs 5 of the start codon of the transgene. In some embodiment, the expression cassette comprises no start codon 5 of the start codon of the transgene. In some embodiments, the expression cassette comprises no start site 5 to the transgene capable of generating alternative mRNAs.

[0090] In an embodiment, the expression cassette comprises operatively linked, in the 5 to 3 direction, a first inverted terminal repeat, an enhancer/promoter region, introns, a consensus optimal Kozak sequence, the transgene, a 3 untranslated region including a full-length polyA sequence, and a second inverted terminal repeat, wherein the expression cassette comprises no start site 5 to the transgene capable of generating alternative mRNAs.

[0091] In some embodiments, the enhancer/promoter region comprises, in the 5 to 3 direction: a CMV IE enhancer and a chicken beta-actin promoter. In an embodiment, the enhancer/promoter region comprises a CAG promoter (SEQ ID NO: 22). As used herein CAG promoter refers to a polynucleotide sequence comprising a CMV early enhancer element, a chicken beta-actin promoter, the first exon and first intron of the chicken beta-actin gene, and a splice acceptor from the rabbit beta-globin gene.

TABLE-US-00007 (SEQIDNO:22) 1 CTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTC 61 ATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGAC 121 CGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAA 181 TAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAG 241 TACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGC 301 CCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCT 361 ACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTCC 421 CCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTGTG 481 CAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGG 541 GGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAA 601 AGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGC 661 GGGCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCCGCCTCGCGCC 721 GCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTT 781 CTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGTTTCTTTTCTGTGGCTGC 841 GTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGAGCGGCTCGGGGGGTG 901 CGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGCGCTGCCCGGCGGCTGTG 961 AGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGTGCGCGAGGGGAGCGCGG 1021 CCGGGGGCGGTGCCCCGCGGTGCGGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGG 1081 GTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGGGCGCGTCGGTCGGGCTGCAACCCCCCC 1141 TGCACCCCCCTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGG 1201 GGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCG 1261 GGGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCG 1321 CCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGA 1381 GGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCC 1441 GCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGCG 1501 GGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCT 1561 GTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGC 1621 GTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTAC 1681 AGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTTTGGCAAA.

[0092] In some embodiments, the enhancer/promoter region comprises a ubiquitous promoter. In some embodiments, the enhancer/promoter region comprises a CMV promoter (SEQ. ID NO: 23), an SV40 promoter (SEQ ID NO: 24), a PGK promoter (SEQ ID NO: 25), and/or a human beta-actin promoter (SEQ ID NO: 26). In some embodiments, the enhancer/promoter region comprises a polynucleotide that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with any one of SEQ ID NOs: 23-26:

TABLE-US-00008 (SEQIDNO:23) 1 GTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTT 61 CCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGAC 121 TTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGG 181 TGGGAGGTCTATATAAGCAGAGCT; (SEQIDNO:24) 1 GGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATGCATCTCAATT 61 AGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCA 121 TGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAA 181 CTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAG 241 AGGCCGAGGCCGCCTCGGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAG 301 GCCTAGGCTTTTGCAAA; (SEQIDNO:25) 1 GGGTAGGGGAGGCGCTTTTCCCAAGGCAGTCTGGAGCATGCGCTTTAGCAGCCCCGCTGG 61 GCACTTGGCGCTACACAAGTGGCCTCTGGCCTCGCACACATTCCACATCCACCGGTAGGC 121 GCCAACCGGCTCCGTTCTTTGGTGGCCCCTTCGCGCCACCTTCTACTCCTCCCCTAGTCA 181 GGAAGTTCCCCCCCGCCCCGCAGCTCGCGTCGTGCAGGACGTGACAAATGGAAGTAGCAC 241 GTCTCACTAGTCTCGTGCAGATGGACAGCACCGCTGAGCAATGGAAGCGGGTAGGCCTTT 301 GGGGCAGCGGCCAATAGCAGCTTTGCTCCTTCGCTTTCTGGGCTCAGAGGCTGGGAAGGG 361 GTGGGTCCGGGGGCGGGCTCAGGGGCGGGCTCAGGGGCGGGGCGGGCGCCCGAAGGTCCT 421 CCGGAGGCCCGGCATTCTGCACGCTTCAAAAGCGCACGTCTGCCGCGCTGTTCTCCTCTT 481 CCTCATCTCCGGGCCTTTCG; (SEQIDNO:26) 1 CCTGCAGGGCCCACTAGTTCCATGTCCTTATATGGACTCATCTTTGCCTATTGCGACACA 61 CACTCAATGAACACCTACTACGCGCTGCAAAGAGCCCCGCAGGCCTGAGGTGCCCCCACC 121 TCACCACTCTTCCTATTTTTGTGTAAAAATCCAGCTTCTTGTCACCACCTCCAAGGAGGG 181 GGAGGAGGAGGAAGGCAGGTTCCTCTAGGCTGAGCCGAATGCCCCTCTGTGGTCCCACGC 241 CACTGATCGCTGCATGCCCACCACCTGGGTACACACAGTCTGTGATTCCCGGAGCAGAAC 301 GGACCCTGCCCACCCGGTCTTGTGTGCTACTCAGTGGACAGACCCAAGGCAAGAAAGGGT 361 GACAAGGACAGGGTCTTCCCAGGCTGGCTTTGAGTTCCTAGCACCGCCCCGCCCCCAATC 421 CTCTGTGGCACATGGAGTCTTGGTCCCCAGAGTCCCCCAGCGGCCTCCAGATGGTCTGGG 481 AGGGCAGTTCAGCTGTGGCTGCGCATAGCAGACATACAACGGACGGTGGGCCCAGACCCA 541 GGCTGTGTAGACCCAGCCCCCCCGCCCCGCAGTGCCTAGGTCACCCACTAACGCCCCAGG 601 CCTGGTCTTGGCTGGGCGTGACTGTTACCCTCAAAAGCAGGCAGCTCCAGGGTAAAAGGT 661 GCCCTGCCCTGTAGAGCCCACCTTCCTTCCCAGGGCTGCGGCTGGGTAGGTTTGTAGCCT 721 TCATCACGGGCCACCTCCAGCCACTGGACCGCTGGCCCCTGCCCTGTCCTGGGGAGTGTG 781 GTCCTGCGACTTCTAAGTGGCCGCAAGCCACCTGACTCCCCCAACACCACACTCTACCTC 841 TCAAGCCCAGGTCTCTCCCTAGTGACCCACCCAGCACATTTAGCTAGCTGAGCCCCACAG 901 CCAGAGGTCCTCAGGCCCTGCTTTCAGGGCAGTTGCTCTGAAGTCGGCAAGGGGGAGTGA 961 CTGCCTGGCCACTCCATGCCCTCCAAGAGCTCCTTCTGCAGGAGCGTACAGAACCCAGGG 1021 CCCTGGCACCCGTGCAGACCCTGGCCCACCCCACCTGGGCGCTCAGTGCCCAAGAGATGT 1081 CCACACCTAGGATGTCCCGCGGTGGGTGGGGGGCCCGAGAGACGGGCAGGCCGGGGGCAG 1141 GCCTGGCCATGCGGGGCCGAACCGGGCACTGCCCAGCGTGGGGCGCGGGGGCCACGGCGC 1201 GCGCCCCCAGCCCCCGGGCCCAGCACCCCAAGGCGGCCAACGCCAAAACTCTCCCTCCTC 1261 CTCTTCCTCAATCTCGCTCTCGCTCTTTTTTTTTTTCGCAAAAGGAGGGGAGAGGGGGTA 1321 AAAAAATGCTGCACTGTGCGGCGAAGCCGGTGAGTGAGCGGCGCGGGGCCAATCAGCGTG 1381 CGCCGTTCCGAAAGTTGCCTTTTATGGCTCGAGCGGCCGCGGCGGCGCCCTATAAAACCC 1441 AGCGGCGCGACGCGCCACCACCGCCGAGACCGCGTCCGCCCCGCGAGCACAGAGCCTCGC 1501 CTTTGCCGATCCGCCGCCCGTCCACACCCGCCGCCAGGTAAGCCCGGCCAGCCGACCGGG 1561 GCAGGCGGCTCACGGCCCGGCCGCAGGCGGCCGCGGCCCCTTCGCCCGTGCAGAGCCGCC 1621 GTCTGGGCCGCAGCGGGGGGCGCATGGGGGGGGAACCGGACCGCCGTGGGGGGCGCGGGA 1681 GAAGCCCCTGGGCCTCCGGAGATGGGGGACACCCCACGCCAGTTCGGAGGCGCGAGGCCG 1741 CGCTCGGGAGGCGCGCTCCGGGGGTGCCGCTCTCGGGGCGGGGGCAACCGGCGGGGTCTT 1801 TGTCTGAGCCGGGCTCTTGCCAATGGGGATCGCAGGGTGGGCGCGGCGGAGCCCCCGCCA 1861 GGCCCGGTGGGGGCTGGGGCGCCATTGCGCGTGCGCGCTGGTCCTTTGGGCGCTAACTGC 1921 GTGCGCGCTGGGAATTGGCGCTAATTGCGCGTGCGCGCTGGGACTCAAGGCGCTAACTGC 1981 GCGTGCGTTCTGGGGCCCGGGGTGCCGCGGCCTGGGCTGGGGCGAAGGCGGGCTCGGCCG 2041 GAAGGGGTGGGGTCGCCGCGGCTCCCGGGCGCTTGCGCGCACTTCCTGCCCGAGCCGCTG 2101 GCCGCCCGAGGGTGTGGCCGCTGCGTGCGCGCGCGCCGACCCGGCGCTGTTTGAACCGGG 2161 CGGAGGCGGGGCTGGCGCCCGGTTGGGAGGGGGTTGGGGCCTGGCTTCCTGCCGCGCGCC 2221 GCGGGGACGCCTCCGACCAGTGTTTGCCTTTTATGGTAATAACGCGGCCGGCCCGGCTTC 2281 CTTTGTCCCCAATCTGGGCGCGCGCCGGCGCCCCCTGGCGGCCTAAGGACTCGGCGCGCC 2341 GGAAGTGGCCAGGGCGGGGGCGACCTCGGCTCACAGCGCGCCCGGCTATTCTCGCAGCTC 2401 ACC.

[0093] Further exemplary promoters include, but are not limited to, human Elongation Factor 1 alpha promoter (EFS), SV40 early promoter, mouse mammary tumor virus long terminal repeat (LTR) promoter; adenovirus major late promoter (Ad MLP); a herpes simplex virus (HSV) promoter, an endogenous cellular promoter that is heterologous to the gene of interest, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), a Rous sarcoma virus (RSV) promoter, synthetic promoters, hybrid promoters, and the like

[0094] In some embodiments, the 3 UTR comprises a polynucleotide (WPRE element) that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with SEQ ID NO: 27:

TABLE-US-00009 (SEQIDNO:27) 1 ATTCGAGCATCTTACCGCCATTTATTCCCATATTTGTTCTGTTTTTCTTGATTTGGGTAT 61 ACATTTAAATGTTAATAAAACAAAATGGTGGGGCAATCATTTACATTTTTAGGGATATGT 121 AATTACTAGTTCAGGTGTATTGCCACAAGACAAACATGTTAAGAAACTTTCCCGTTATTT 181 ACGCTCTGTTCCTGTTAATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGATAT 241 TCTTAACTATGTTGCTCCTTTTACGCTGTGTGGATATGCTGCTTTAATGCCTCTGTATCA 301 TGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTC 361 TCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACGTGGCGTGGTGTGCTCTGTGTTTGC 421 TGACGCAACCCCCACTGGCTGGGGCATTGCCACCACCTGTCAACTCCTTTCTGGGACTTT 481 CGCTTTCCCCCTCCCGATCGCCACGGCAGAACTCATCGCCGCCTGCCTTGCCCGCTGCTG 541 GACAGGGGCTAGGTTGCTGGGCACTGATAATTCCGTGGTGTTGTCGGGGAAGGGCC.

[0095] In some embodiment, the expression cassette shares at least 95% identity to a sequence selected from SEQ ID NOs: 8-10. In an embodiment, the expression cassette shares complete identity to a sequence selected from SEQ ID NOs: 8-10, or shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identity to a sequence selected from SEQ ID NOs: 8-10:

TABLE-US-00010 (SEQIDNO:8) 1 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTTT 61 GGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACT 121 AGGGGTTCCTTGTAGTTAATGATTAACCCGCCATGCTACTTATCTACCAGGGTAATGGGG 181 ATCCTCTAGAACTATAGCTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAAT 241 TACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAA 301 TGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGT 361 TCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTA 421 AACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGT 481 CAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCC 541 TACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCAC 601 GTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTAT 661 TTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGG 721 GGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCA 781 GAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAA 841 AAAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTC 901 CGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAG 961 CGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGT 1021 TTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGGGGG 1081 GAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGC 1141 GCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGT 1201 GCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGGCTGCGAGGGGAA 1261 CAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGGGCGCGTCGGT 1321 CGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGG 1381 TGCGGGGCTCCGTACGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCA 1441 GGTGGGGGTGCCGGGCGGGGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCG 1501 CGGCGGCCCCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTT 1561 ATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAA 1621 ATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGG 1681 CAGGAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCC 1741 TCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGC 1801 GGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGC 1861 CTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTT 1921 TGGCAAAGAATTCGAGCGGCCGCCAGCCGCCACCATGGTCTGCTTCAGACTGTTCCCTGT 1981 CCCTGGATCTGGTCTGGTGCTTGTGTGCTTGGTGCTGGGTGCTGTGAGATCCTATGCCCT 2041 TGAGCTGAACCTGACTGACTCAGAAAATGCCACTTGCCTGTATGCCAAGTGGCAGATGAA 2101 CTTCACTGTGAGATATGAGACTACCAACAAGACCTACAAGACTGTGACCATCTCAGACCA 2161 TGGCACTGTCACCTACAATGGATCAATCTGTGGTGATGATCAGAATGGCCCAAAGATAGC 2221 AGTGCAGTTTGGGCCCGGTTTTTCCTGGATTGCTAACTTCACCAAGGCAGCCTCCACCTA 2281 CAGCATTGACTCAGTCAGCTTCAGCTACAACACTGGGGATAACACCACCTTCCCTGACGC 2341 AGAGGACAAGGGAATCCTTACTGTGGACGAACTCCTGGCAATCAGAATCCCCCTTAACGA 2401 CCTGTTCAGATGCAACTCCCTTTCAACCCTTGAAAAGAATGATGTGGTGCAACACTATTG 2461 GGACGTCCTGGTGCAAGCCTTTGTGCAGAATGGGACAGTGAGTACCAACGAGTTCCTCTG 2521 TGACAAGGACAAGACCAGCACTGTGGCCCCCACTATCCACACCACTGTGCCCAGCCCTAC 2581 CACTACCCCCACCCCTAAAGAGAAGCCAGAAGCTGGAACCTACTCAGTCAACAATGGAAA 2641 TGACACATGCCTCCTTGCCACCATGGGACTGCAGCTGAACATCACTCAGGACAAGGTGGC 2701 CTCAGTGATTAACATCAACCCTAACACCACTCATAGCACTGGGAGCTGCAGATCACATAC 2761 AGCTCTGCTGAGGCTCAACTCCTCCACCATCAAGTACCTGGACTTTGTGTTTGCTGTGAA 2821 GAATGAGAACAGGTTCTACCTCAAGGAAGTGAACATTTCCATGTACCTGGTCAATGGTTC 2881 AGTGTTCTCTATTGCCAACAACAATCTGAGCTACTGGGATGCACCCCTGGGATCCTCCTA 2941 CATGTGCAACAAGGAGCAGACTGTGAGTGTGTCAGGTGCTTTTCAGATCAACACTTTTGA 3001 CCTGAGGGTGCAGCCCTTCAATGTGACTCAGGGAAAGTACTCCACTGCACAAGAGTGTTC 3061 CTTGGATGATGACACTATCCTCATCCCCATTATTGTGGGAGCTGGACTGTCAGGATTGAT 3121 TATAGTGATTGTGATTGCTTATGTGATTGGAAGGAGAAAGAGCTATGCTGGCTACCAGAC 3181 CCTGTAAAAGGGCGAATTCCAGCACACGCGTCCTAGGAGCTCGAGTACTACTGGCGGCCG 3241 TTACTAGTGGATCCGCGGTACAAGTAAGCATGCAAGCTTCGAGGACGGGGTGAACTACGC 3301 CTGAATCAAGCTTATCGATAAATTCGAGCATCTTACCGCCATTTATTCCCATATTTGTTC 3361 TGTTTTTCTTGATTTGGGTATACATTTAAATGTTAATAAAACAAAATGGTGGGGCAATCA 3421 TTTACATTTTTAGGGATATGTAATTACTAGTTCAGGTGTATTGCCACAAGACAAACATGT 3481 TAAGAAACTTTCCCGTTATTTACGCTCTGTTCCTGTTAATCAACCTCTGGATTACAAAAT 3541 TTGTGAAAGATTGACTGATATTCTTAACTATGTTGCTCCTTTTACGCTGTGTGGATATGC 3601 TGCTTTAATGCCTCTGTATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTT 3661 GTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACGTGG 3721 CGTGGTGTGCTCTGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCATTGCCACCACCTG 3781 TCAACTCCTTTCTGGGACTTTCGCTTTCCCCCTCCCGATCGCCACGGCAGAACTCATCGC 3841 CGCCTGCCTTGCCCGCTGCTGGACAGGGGCTAGGTTGCTGGGCACTGATAATTCCGTGGT 3901 GTTGTCGGGGAAGGGCCTCGATACCGTCGATATCGATCCTGGCTAATAAAGGAAATTTAT 3961 TTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTCACTCGGAAGGACATATGGGAG 4021 GGCAAATCATTTAAAACATCAGAATGAGTATTTGGTTTAGAGTTTGGCAACATATGCCCA 4081 TATGCTGGCTGCCATGAACAAAGGTTGGCTATAAAGAGGTCATCAGTATATGAAACAGCC 4141 CCCTGCTGTCCATTCCTTATTCCATAGAAAAGCCTTGACTTGAGGTTAGATTTTTTTTAT 4201 ATTTTGTTTTGTGTTATTTTTTTCTTTAACATCCCTAAAATTTTCCTTACATGTTTTACT 4261 AGCCAGATTTTTCCTCCTCTCCTGACTACTCCCAGTCATAGCTGTCCCTCTTCTCTTATG 4321 GAGATCGAAGCAATTCGTTGATCTGAATTTCGACCACCCATAATAGATCTCCCATTACCC 4381 TGGTAGATAAGTAGCATGGCGGGTTAATCATTAACTACAAGGAACCCCTAGTGATGGAGT 4441 TGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCC 4501 GACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAG; (SEQIDNO:9) 1 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTTT 61 GGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACT 121 AGGGGTTCCTTGTAGTTAATGATTAACCCGCCATGCTACTTATCTACCAGGGTAATGGGG 181 ATCCTCTAGAACTATAGCTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAAT 241 TACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAA 301 TGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGT 361 TCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTA 421 AACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGT 481 CAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCC 541 TACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCAC 601 GTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTAT 661 TTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGG 721 GGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCA 781 GAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAA 841 AAAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTC 901 CGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAG 961 CGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGT 1021 TTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGGGGG 1081 GAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGC 1141 GCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGT 1201 GCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGGCTGCGAGGGGAA 1261 CAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGGGCGCGTCGGT 1321 CGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGG 1381 TGCGGGGCTCCGTACGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCA 1441 GGTGGGGGTGCCGGGCGGGGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCG 1501 CGGCGGCCCCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTT 1561 ATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAA 1621 ATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGG 1681 CAGGAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCC 1741 TCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGC 1801 GGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGC 1861 CTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTT 1921 TGGCAAAGAATTCGAGCGGCCGCCAGCCGCCACCATGGTGTGCTTTAGACTGTTTCCTGT 1981 GCCTGGTTCAGGGCTGGTCCTGGTCTGTCTGGTGCTGGGGGCTGTCAGAAGCTATGCCTT 2041 GGAGCTGAACCTCACTGATAGTGAAAATGCCACTTGTCTGTATGCTAAGTGGCAGATGAA 2101 CTTCACTGTGAGATATGAAACCACCAACAAGACTTACAAAACAGTGACCATCTCAGATCA 2161 TGGAACTGTGACCTACAACGGCAGCATTTGTGGAGACGACCAGAACGGACCAAAAATCGC 2221 TGTCCAATTTGGGCCTGGATTCTCCTGGATTGCCAATTTCACTAAAGCTGCCTCCACATA 2281 TTCAATTGACTCAGTGTCCTTCTCCTACAACACTGGGGACAACACTACTTTCCCTGATGC 2341 TGAAGATAAGGGAATCTTGACAGTGGATGAGCTGCTGGCTATCAGGATCCCTTTGAATGA 2401 CCTGTTTAGGTGTAATTCACTGAGCACTCTGGAGAAGAACGACGTGGTGCAGCACTACTG 2461 GGACGTGCTGGTGCAGGCCTTTGTGCAGAACGGCACTGTGTCCACCAACGAATTCCTGTG 2521 TGATAAGGACAAAACTTCCACTGTGGCACCTACAATTCACACTACTGTGCCTTCACCTAC 2581 CACCACTCCAACTCCAAAGGAAAAGCCTGAAGCAGGAACCTACTCTGTGAACAATGGCAA 2641 TGATACCTGTCTGTTGGCCACCATGGGCCTCCAACTGAACATTACTCAGGACAAGGTGGC 2701 CTCAGTGATTAACATTAACCCCAACACTACCCACTCCACTGGCAGCTGTAGATCACACAC 2761 AGCCTTGCTCAGACTGAATAGCAGCACCATCAAGTATTTGGATTTTGTGTTTGCAGTGAA 2821 GAATGAAAACAGGTTCTACCTGAAGGAAGTCAACATCTCAATGTACCTGGTGAACGGCTC 2881 AGTGTTCAGCATTGCCAACAACAACCTCTCCTATTGGGACGCTCCACTGGGGAGCAGCTA 2941 CATGTGTAACAAGGAACAGACTGTGTCAGTGTCAGGAGCCTTCCAGATTAACACCTTTGA 3001 TCTGAGGGTCCAACCCTTTAATGTCACTCAAGGAAAGTATAGCACTGCCCAGGAGTGCTC 3061 CCTGGATGATGACACCATTCTGATTCCAATCATTGTGGGTGCAGGACTTTCTGGGCTTAT 3121 TATTGTGATTGTGATTGCCTATGTGATTGGCAGAAGGAAATCCTATGCAGGGTACCAAAC 3181 TCTGTAAAAGGGCGAATTCCAGCACACGCGTCCTAGGAGCTCGAGTACTACTGGCGGCCG 3241 TTACTAGTGGATCCGCGGTACAAGTAAGCATGCAAGCTTCGAGGACGGGGTGAACTACGC 3301 CTGAATCAAGCTTATCGATAAATTCGAGCATCTTACCGCCATTTATTCCCATATTTGTTC 3361 TGTTTTTCTTGATTTGGGTATACATTTAAATGTTAATAAAACAAAATGGTGGGGCAATCA 3421 TTTACATTTTTAGGGATATGTAATTACTAGTTCAGGTGTATTGCCACAAGACAAACATGT 3481 TAAGAAACTTTCCCGTTATTTACGCTCTGTTCCTGTTAATCAACCTCTGGATTACAAAAT 3541 TTGTGAAAGATTGACTGATATTCTTAACTATGTTGCTCCTTTTACGCTGTGTGGATATGC 3601 TGCTTTAATGCCTCTGTATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTT 3661 GTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACGTGG 3721 CGTGGTGTGCTCTGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCATTGCCACCACCTG 3781 TCAACTCCTTTCTGGGACTTTCGCTTTCCCCCTCCCGATCGCCACGGCAGAACTCATCGC 3841 CGCCTGCCTTGCCCGCTGCTGGACAGGGGCTAGGTTGCTGGGCACTGATAATTCCGTGGT 3901 GTTGTCGGGGAAGGGCCTCGATACCGTCGATATCGATCCTGGCTAATAAAGGAAATTTAT 3961 TTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTCACTCGGAAGGACATATGGGAG 4021 GGCAAATCATTTAAAACATCAGAATGAGTATTTGGTTTAGAGTTTGGCAACATATGCCCA 4081 TATGCTGGCTGCCATGAACAAAGGTTGGCTATAAAGAGGTCATCAGTATATGAAACAGCC 4141 CCCTGCTGTCCATTCCTTATTCCATAGAAAAGCCTTGACTTGAGGTTAGATTTTTTTTAT 4201 ATTTTGTTTTGTGTTATTTTTTTCTTTAACATCCCTAAAATTTTCCTTACATGTTTTACT 4261 AGCCAGATTTTTCCTCCTCTCCTGACTACTCCCAGTCATAGCTGTCCCTCTTCTCTTATG 4321 GAGATCGAAGCAATTCGTTGATCTGAATTTCGACCACCCATAATAGATCTCCCATTACCC 4381 TGGTAGATAAGTAGCATGGCGGGTTAATCATTAACTACAAGGAACCCCTAGTGATGGAGT 4441 TGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCC 4501 GACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAG; and (SEQIDNO:10) 1 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTTT 61 GGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACT 121 AGGGGTTCCTTGTAGTTAATGATTAACCCGCCATGCTACTTATCTACCAGGGTAATGGGG 181 ATCCTCTAGAACTATAGCTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAAT 241 TACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAA 301 TGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGT 361 TCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTA 421 AACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGT 481 CAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCC 541 TACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCAC 601 GTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTAT 661 TTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGG 721 GGCGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCA 781 GAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAA 841 AAAGCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTC 901 CGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAG 961 CGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGT 1021 TTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGGGGG 1081 GAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGC 1141 GCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGT 1201 GCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGGGGGCTGCGAGGGGAA 1261 CAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGGGGTGTGGGCGCGTCGGT 1321 CGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGG 1381 TGCGGGGCTCCGTACGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCA 1441 GGTGGGGGTGCCGGGCGGGGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCG 1501 CGGCGGCCCCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTT 1561 ATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAA 1621 ATCTGGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGG 1681 CAGGAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCC 1741 TCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGC 1801 GGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGC 1861 CTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTT 1921 TGGCAAAGAATTCGAGCGGCCGCCAGCCGCCACCATGGTCTGTTTTAGGCTGTTCCCTGT 1981 CCCTGGTTCAGGACTGGTCTTAGTGTGTCTGGTGCTTGGAGCTGTCAGAAGCTATGCCCT 2041 GGAGCTGAACCTGACTGACTCAGAAAATGCCACTTGCCTGTATGCCAAGTGGCAGATGAA 2101 CTTCACTGTCAGATATGAAACCACCAACAAGACCTATAAGACTGTGACCATCTCAGACCA 2161 TGGCACTGTGACTTACAATGGGTCAATTTGTGGAGATGACCAGAATGGCCCTAAGATAGC 2221 TGTCCAGTTTGGTCCAGGATTCAGCTGGATTGCCAACTTCACCAAGGCAGCCAGCACCTA 2281 CAGCATTGACTCTGTGTCCTTCTCCTACAACACAGGAGACAACACCACTTTCCCTGATGC 2341 AGAGGACAAAGGTATCCTGACTGTGGATGAGTTGCTGGCAATCAGGATCCCACTGAACGA 2401 TCTGTTCAGGTGCAACTCACTGTCCACTCTGGAAAAGAATGATGTGGTGCAGCACTATTG 2461 GGATGTGCTAGTCCAGGCCTTTGTCCAGAATGGGACTGTGTCAACTAATGAGTTCCTGTG 2521 TGACAAGGACAAGACAAGCACTGTAGCCCCCACTATCCATACCACAGTACCTAGCCCCAC 2581 CACTACTCCAACCCCCAAGGAGAAGCCTGAGGCTGGCACCTACTCAGTGAACAATGGGAA 2641 TGACACCTGTTTGCTGGCCACTATGGGACTCCAACTGAACATCACCCAGGACAAAGTGGC 2701 CTCTGTGATCAATATCAATCCCAACACCACCCACAGCACTGGGTCCTGCAGAAGCCACAC 2761 TGCCCTCCTGAGGCTCAACTCATCAACTATCAAGTACTTGGATTTTGTGTTTGCAGTGAA 2821 GAATGAGAACAGATTCTACCTCAAAGAGGTCAACATTTCAATGTACCTGGTGAATGGGAG 2881 TGTGTTCTCCATTGCTAACAACAACCTGAGCTACTGGGATGCCCCTCTGGGCTCCTCATA 2941 CATGTGCAACAAGGAACAGACTGTGAGTGTGTCAGGGGCCTTCCAGATCAACACTTTTGA 3001 CCTGAGAGTGCAGCCCTTTAATGTGACACAGGGAAAGTACAGCACTGCTCAGGAGTGCAG 3061 CCTGGATGATGACACTATCCTGATCCCTATCATTGTGGGGGCAGGCCTGTCTGGACTCAT 3121 TATTGTGATTGTGATTGCCTATGTGATAGGGAGAAGGAAGTCTTATGCTGGATACCAGAC 3181 CCTGTAAAAGGGCGAATTCCAGCACACGCGTCCTAGGAGCTCGAGTACTACTGGCGGCCG 3241 TTACTAGTGGATCCGCGGTACAAGTAAGCATGCAAGCTTCGAGGACGGGGTGAACTACGC 3301 CTGAATCAAGCTTATCGATAAATTCGAGCATCTTACCGCCATTTATTCCCATATTTGTTC 3361 TGTTTTTCTTGATTTGGGTATACATTTAAATGTTAATAAAACAAAATGGTGGGGCAATCA 3421 TTTACATTTTTAGGGATATGTAATTACTAGTTCAGGTGTATTGCCACAAGACAAACATGT 3481 TAAGAAACTTTCCCGTTATTTACGCTCTGTTCCTGTTAATCAACCTCTGGATTACAAAAT 3541 TTGTGAAAGATTGACTGATATTCTTAACTATGTTGCTCCTTTTACGCTGTGTGGATATGC 3601 TGCTTTAATGCCTCTGTATCATGCTATTGCTTCCCGTACGGCTTTCGTTTTCTCCTCCTT 3661 GTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCCGTCAACGTGG 3721 CGTGGTGTGCTCTGTGTTTGCTGACGCAACCCCCACTGGCTGGGGCATTGCCACCACCTG 3781 TCAACTCCTTTCTGGGACTTTCGCTTTCCCCCTCCCGATCGCCACGGCAGAACTCATCGC 3841 CGCCTGCCTTGCCCGCTGCTGGACAGGGGCTAGGTTGCTGGGCACTGATAATTCCGTGGT 3901 GTTGTCGGGGAAGGGCCTCGATACCGTCGATATCGATCCTGGCTAATAAAGGAAATTTAT 3961 TTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTCACTCGGAAGGACATATGGGAG 4021 GGCAAATCATTTAAAACATCAGAATGAGTATTTGGTTTAGAGTTTGGCAACATATGCCCA 4081 TATGCTGGCTGCCATGAACAAAGGTTGGCTATAAAGAGGTCATCAGTATATGAAACAGCC 4141 CCCTGCTGTCCATTCCTTATTCCATAGAAAAGCCTTGACTTGAGGTTAGATTTTTTTTAT 4201 ATTTTGTTTTGTGTTATTTTTTTCTTTAACATCCCTAAAATTTTCCTTACATGTTTTACT 4261 AGCCAGATTTTTCCTCCTCTCCTGACTACTCCCAGTCATAGCTGTCCCTCTTCTCTTATG 4321 GAGATCGAAGCAATTCGTTGATCTGAATTTCGACCACCCATAATAGATCTCCCATTACCC 4381 TGGTAGATAAGTAGCATGGCGGGTTAATCATTAACTACAAGGAACCCCTAGTGATGGAGT 4441 TGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCC 4501 GACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAG.

[0096] In certain embodiments, the expression cassette comprises one or more modifications as compared to a sequence selected from SEQ ID NOs: 8-10, including but not limited to any of the modifications disclosed herein. In particular embodiments, the one or more modifications comprise one or more of: removal of one or more (e.g., all) upstream ATG sequences, replacement of the Kozak sequence with an optimized consensus Kozak sequence or another Kozak sequence, including but not limited to any of those disclosed herein, and/or replacement of the polyadenylation sequence with a full-length polyadenylation sequence or another polyadenylation sequence, including but not limited to any of those disclosed herein. An illustrative configuration of genetic elements within these exemplary expression cassettes is depicted in FIG. 1B.

[0097] In an embodiment, the vector is an adeno-associated virus (AAV) vector. In an embodiment, the expression cassette comprises inverted terminal repeat (ITR) sequences selected from SEQ ID NOs: 11 and 12:

TABLE-US-00011 (SEQIDNO:11) 1 CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTTT 61 GGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACT 121 AGGGGTTCCT; (SEQIDNO:12) 1 AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGG 61 CCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGC 121 GAGCGCGCAG.

[0098] In related embodiments, the disclosure provides gene therapy vectors comprising an expression cassette disclosed herein. Generally, the gene therapy vectors described herein comprise an expression cassette comprising a polynucleotide encoding one or more isoforms of lysosome-associated membrane protein 2 (LAMP-2), and allows for the expression of LAMP-2 to partially or wholly rectify deficient LAMP-2 protein expression levels and/or autophagic flux in a subject in need thereof (e.g., a subject having Danon disease or another disorder characterized by deficient autophagic flux at least in part due to deficient LAMP-2 expression). In particular embodiments, the expression cassette comprises a polynucleotide sequence encoding LAMP-2 disclosed herein, e.g., SEQ ID NOs: 3-5, or a functional variant thereof. In some embodiments, the variant sequence has at least 90%, at least 95%, at least 98%, or at least 99% identity to any of SEQ ID NOs: 3-5. In some embodiments, the variant is a fragment of any of SEQ ID NOs: 3-5, e.g., a fragment having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of the sequence of any of SEQ ID Nos: 3-5. The gene therapy vectors can be viral or non-viral vectors. Illustrative non-viral vectors include, e.g., naked DNA, cationic liposome complexes, cationic polymer complexes, cationic liposome-polymer complexes, and exosomes. Examples of viral vectors include, but are not limited to, adenoviral, retroviral, lentiviral, herpesvirus and adeno-associated virus (AAV) vectors.

[0099] In certain embodiments, the viral vector is an AAV vector. AAV is a 4.7 kb, single stranded DNA virus. Recombinant vectors based on AAV are associated with excellent clinical safety, since wild-type AAV is nonpathogenic and has no etiologic association with any known diseases. In addition, AAV offers the capability for highly efficient gene delivery and sustained transgene expression in numerous tissues. By an AAV vector is meant a vector derived from an adeno-associated virus serotype, including without limitation, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAVrh.10, AAVrh.74, etc. AAV vectors can have one or more of the AAV wild-type genes deleted in whole or part, e.g., the rep and/or cap genes, but retain functional flanking inverted terminal repeat (ITR) sequences. Functional ITR sequences are necessary for the rescue, replication and packaging of the AAV virion. Thus, an AAV vector is defined herein to include at least those sequences required in cis for replication and packaging (e.g., functional ITRs) of the virus. The ITRs need not be the wild-type nucleotide sequences, and may be altered, e.g. by the insertion, deletion or substitution of nucleotides, as long as the sequences provide for functional rescue, replication and packaging. AAV vectors may comprise other modifications, including but not limited to one or more modified capsid protein (e.g., VP1, VP2 and/or VP3). For example, a capsid protein may be modified to alter tropism and/or reduce immunogenicity.

[0100] Recombinant vectors based on AAV are associated with excellent clinical safety, since wild-type AAV is nonpathogenic and has no etiologic association with any known diseases. In addition, AAV offers the capability for highly efficient gene delivery and sustained transgene expression in numerous tissues. Various serotypes of AAV are known, including, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAVrh.10, AAVrh.74, etc. AAV vectors can have one or more of the AAV wild-type genes deleted in whole or part, e.g., the rep and/or cap genes, but retain functional flanking inverted terminal repeat (ITR) sequences. The serotype of a recombinant AAV vector is determined by its capsid. International Patent Publication No. WO2003042397A2 discloses various capsid sequences including those of AAV1, AAV2, AAV3, AAV8, AAV9, and rh10. International Patent Publication No. WO2013078316A1 discloses the polypeptide sequence of the VP1 from AAVrh74. Numerous diverse naturally occurring or genetically modified AAV capsid sequences are known in the art.

[0101] An exemplary, non-limiting capsid is an AAV9 capsid, having the sequence of SEQ ID NO: 28 (or the VP1, VP2, or VP3 fragments thereof). In some embodiments, the AAV vectors of the disclosure comprise capsid proteins that share at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% identity of the entire sequence of SEQ ID NO: 28, or over amino acids 138 to 736 of SEQ ID NO: 28, or over amino acids 203 to 736 of SEQ ID NO: 28.

TABLE-US-00012 (SEQIDNO:28) 1 MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLD 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ 121 AKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTE 181 SVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVI 241 TTSTRTWALPTYNNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFSPRDWQR 301 LINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAH 361 EGCLPPFPADVFMIPQYGYLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENV 421 PFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLKFSVAGPSNMAVQGRNYIP 481 GPSYRQQRVSTTVTQNNNSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGS 541 LIFGKQGTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQG 601 ILPGMVWQDRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPT 661 AFNKDKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGV 721 YSEPRPIGTRYLTRNL.

[0102] AAV expression vectors are constructed using known techniques to at least provide as operatively linked components in the direction of transcription, control elements including a transcriptional initiation region, the DNA of interest (i.e. the LAMP-2 gene) and a transcriptional termination region.

[0103] In some embodiments, the viral vector is an AAV9 vector. In some embodiments, the expression cassette of the viral vector is flanked by AAV2 inverted terminal repeats (ITRs). ITRs used in alternative embodiments of the disclosed vectors include, but are not limited to, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, and AAV9. In some embodiments, the viral vector is an AAV2/9 vector. The notation AAV2/9 refers to an AAV vector have the ITRs of AAV2 and the capsid of AAV9. Other embodiments of the disclosure include without limitation AAV2/9, AAV5/9, AAVrh74, AAV2/rh74, AAV5/9, and AAV5/rh74 vectors. Other ITRs known in the art may be used. Exemplary ITRs (and other AAV components) useful in the vectors of the present disclosure include, without limitation, those described in U.S. Pat. No. 6,936,466B2, U.S. Pat. No. 9,169,494B2, US20050220766A1, US20190022249A1, and U.S. Pat. No. 7,282,199B2, which are each incorporated by reference herein in their entireties.

[0104] In some embodiments, the vector is a retroviral vector, or more specifically, a lentiviral vector. As used herein, the term retrovirus or retroviral refers an RNA virus that reverse transcribes its genomic RNA into a linear double-stranded DNA copy and subsequently covalently integrates its genomic DNA into a host genome. Retrovirus vectors are a common tool for gene delivery (Miller, 2000, Nature. 357: 455-460). Once the virus is integrated into the host genome, it is referred to as a provirus. The provirus serves as a template for RNA polymerase II and directs the expression of RNA molecules encoded by the virus.

[0105] Illustrative retroviruses (family Retroviridae) include, but are not limited to: (1) genus gammaretrovirus, such as, Moloney murine leukemia virus (M-MuLV), Moloney murine sarcoma virus (MoMSV), murine mammary tumor virus (MuMTV), gibbon ape leukemia virus (GaLV), and feline leukemia virus (FLV), (2) genus spumavirus, such as, simian foamy virus, (3) genus lentivirus, such as, human immunodeficiency virus-1 and simian immunodeficiency virus.

[0106] As used herein, the term lentiviral or lentivirus refers to a group (or genus) of complex retroviruses. Illustrative lentiviruses include, but are not limited to: HIV (human immunodeficiency virus; including HIV type 1, and HIV type 2; visna-maedi virus (VMV) virus; the caprine arthritis-encephalitis virus (CAEV); equine infectious anemia virus (EIAV); feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV). In one embodiment, HIV-based vector backbones (i.e., HIV cis-acting sequence elements) are preferred.

[0107] Retroviral vectors, and more particularly, lentiviral vectors, may be used in practicing the present invention. Accordingly, the term retroviral vector, as used herein is meant to include lentiviral vector; and the term retrovirus as used herein is meant to include lentivirus.

[0108] The term viral vector may refer either to a vector or viral particle capable of transferring a nucleic acid into a cell or to the transferred nucleic acid itself. Viral vectors contain structural and/or functional genetic elements that are primarily derived from a virus. The term retroviral vector refers to a viral vector containing structural and functional genetic elements, or portions thereof, that are primarily derived from a retrovirus. The term lentiviral vector refers to a viral vector containing structural and functional genetic elements, or portions thereof, including LTRs that are primarily derived from a lentivirus. The term hybrid refers to a vector, LTR or other nucleic acid containing both retroviral, e.g., lentiviral, sequences and non-lentiviral viral sequences. In one embodiment, a hybrid vector refers to a vector or transfer plasmid comprising retroviral, e.g., lentiviral, sequences for reverse transcription, replication, integration and/or packaging.

[0109] In particular embodiments, the terms lentiviral vector and lentiviral expression vector may be used to refer to lentiviral transfer plasmids and/or infectious lentiviral particles. Where reference is made herein to elements such as cloning sites, promoters, regulatory elements, heterologous nucleic acids, etc., it is to be understood that the sequences of these elements are present in RNA form in the lentiviral particles of the invention and are present in DNA form in the DNA plasmids of the invention.

[0110] According to certain specific embodiments, most or all of the viral vector backbone sequences are derived from a lentivirus, e.g., HIV-1. However, it is to be understood that many different sources of lentiviral sequences can be used, and numerous substitutions and alterations in certain of the lentiviral sequences may be accommodated without impairing the ability of a transfer vector to perform the functions described herein. Moreover, a variety of lentiviral vectors are known in the art, see Naldini et al., (1996a, 1996b, and 1998); Zufferey et al., (1997); Dull et al., 1998, U.S. Pat. Nos. 6,013,516; and 5,994,136, many of which may be adapted to produce a viral vector or transfer plasmid of the present invention.

[0111] The LAMP-2B transgene sequences disclosed herein are, in various embodiments, used in any vector system known in the art or prospectively discovered. The invention is not limited to any particular viral vector described herein, as it is within the skill of those in the art to use a transgene sequence in other vector systems without undue experimentation and with a reasonable expectation of success.

[0112] Gene delivery viral vectors useful in the practice of the present invention can be constructed utilizing methodologies well known in the art of molecular biology. Typically, viral vectors carrying transgenes are assembled from polynucleotides encoding the transgene, suitable regulatory elements and elements necessary for production of viral proteins, which mediate cell transduction. Such recombinant viruses may be produced by techniques known in the art, e.g., by transfecting packaging cells or by transient transfection with helper plasmids or viruses. Typical examples of virus packaging cells include but are not limited to HeLa cells, SF9 cells (optionally with a baculovirus helper vector), 293 cells, etc. A Herpesvirus-based system can be used to produce AAV vectors, as described in US20170218395A1. Detailed protocols for producing such replication-defective recombinant viruses may be found for instance in WO95/14785, WO96/22378, U.S. Pat. Nos. 5,882,877, 6,013,516, 4,861,719, 5,278,056 and WO94/19478, the complete contents of each of which is hereby incorporated by reference.

[0113] The present disclosure also provides pharmaceutical compositions comprising an expression cassette or vector (e.g., gene therapy vector) disclosed herein and one or more pharmaceutically acceptable carriers, diluents or excipients. In particular embodiments, the pharmaceutical composition comprises an AAV vector comprising an expression cassette disclosed herein, e.g., wherein the expression cassette comprises a codon-optimized transgene encoding LAMP-2B, e.g., any of SEQ ID NOs: 3-5 and variants thereof. Provided are pharmaceutical compositions, e.g., for use in preventing or treating a disorder characterized by deficient autophagic flux (e.g., Danon disease) which comprises a therapeutically effective amount of an expression cassette or vector disclosed herein that comprises a nucleic acid sequence of a polynucleotide that encodes one or more isoforms of LAMP-2.

[0114] AAV vectors useful in the practice of the present invention can be packaged into AAV virions (viral particles) using various systems including adenovirus-based and helper-free systems. Standard methods in AAV biology include those described in Kwon and Schaffer. Pharm Res. (2008) 25(3):489-99; Wu et al. Mol. Ther. (2006) 14(3):316-27. Burger et al. Mol. Ther. (2004) 10(2):302-17; Grimm et al. Curr Gene Ther. (2003) 3(4):281-304; Deyle D R, Russell D W. Curr Opin Mol Ther. (2009) 11(4):442-447; McCarty et al. Gene Ther. (2001) 8(16):1248-54; and Duan et al. Mol Ther. (2001) 4(4):383-91. Helper-free systems included those described in U.S. Pat. Nos. 6,004,797; 7,588,772; and 7,094,604;

[0115] The pharmaceutical compositions that contain the expression cassette or vector may be in any form that is suitable for the selected mode of administration, for example, for intraventricular, intramyocardial, intracoronary, intravenous, intra-arterial, intra-renal, intraurethral, epidural or intramuscular administration. The gene therapy vector comprising a polynucleotide encoding one or more LAMP-2 isoforms can be administered, as sole active agent, or in combination with other active agents, in a unit administration form, as a mixture with conventional pharmaceutical supports, to animals and human beings. In some embodiments, the pharmaceutical composition comprises cells transduced ex vivo with any of the gene therapy vectors of the disclosure.

[0116] In some embodiments, the viral vector (e.g. AAV vector), or a pharmaceutical composition comprising that vector, is effective when administered systemically. For example, the viral vectors of the disclosure, in some cases, demonstrate efficacy when administered intravenously to subject (e.g., a primate, such as a non-human primate or a human). In some embodiments, the viral vectors of the disclosure are capable of inducing expression of LAMP-2B in various tissues when administered systemically (e.g., in heart, muscle, and/or lung). In particular embodiments, administration of an AAV9 vector comprising a transgene substantially identical to, or identical to, SEQ ID NO: 3 to a subject intravenously results in detectable expression of LAMP-2B in heart tissue. In some embodiments, expression of LAMP-2B is detectable in one or more, or all, of the left ventricle, the right ventricle, the left atrium, and the right atrium of the heart of the subject. In some embodiments, expression of LAMP-2B is detectable in sub-region 1 and/or sub-region 2 of the left ventricle of the heart of the subject.

[0117] Detectable expression typically refers to transgene expression at least 5%, 10%, 15%, 20% or more compared to a control subject or tissue not treated with the viral vector. In some embodiments, detectable expression means expression at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, or at least 100-fold greater than a no-vector control. Transgene expression can be determined as the increase over expression of the wild-type or endogenous gene in the cell (accounting for the potential that expression of the transgene may influence expression of the endogenous gene). Transgene expression can also be determined by RT-PCR detection of sequences that are present on the transgene mRNA transcript but not on the mRNA transcript of the endogenous gene. For example, the 3 UTR of the transcript may be used to determine the expression of the transgene independent of the expression of the endogenous gene (which may have a different 3 UTR). Expression of the polypeptide encoded by the transgene can be assessed by western blot or enzyme-linked immunosorbent assay (ELISA), as described in the examples that follow, or other methods known in the art. Antibodies cross-reactive to the wild-type and exogenous copies of the protein may be used. In some cases, an antibody specific to the exogenous protein can be identified and used to determine transgene expression. Those of skill in the art can design appropriate detection methodologies taking into account the target cell or tissue. In some cases, expression is measured quantitatively using a standard curve. Standard curves can be generated using purified LAMP-2 protein, by methods described in the examples or known in the art. Alternatively, expression of the transgene can be assessed by quantification of the corresponding mRNA.

[0118] In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 510.sup.14 vg/kg or less, 310.sup.14 vg/kg or less, 210.sup.14 vg/kg or less, 110.sup.14 vg/kg or less, 910.sup.13 vg/kg or less, 810.sup.13 vg/kg or less, 710.sup.13 vg/kg or less, 610.sup.13 vg/kg or less, 510.sup.13 vg/kg or less, 410.sup.13 vg/kg or less, 310.sup.13 vg/kg or less, 210.sup.13 vg/kg or less, or 110.sup.13 vg/kg or less.

[0119] In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 210.sup.13 vg/kg, 210.sup.13 vg/kg to 310.sup.13 vg/kg, 310.sup.13 vg/kg to 410.sup.13 vg/kg, 410.sup.13 vg/kg to 510.sup.13 vg/kg, 510.sup.13 vg/kg to 610.sup.13 vg/kg, 610.sup.13 vg/kg to 710.sup.13 vg/kg, 710.sup.13 vg/kg to 810.sup.13 vg/kg, 810.sup.13 vg/kg to 910.sup.13 vg/kg, 910.sup.13 vg/kg to 110.sup.14 vg/kg, 110.sup.14 vg/kg to 210.sup.14 vg/kg, 210.sup.14 vg/kg to 310.sup.14 vg/kg, or 310.sup.14 vg/kg to 510.sup.14 vg/kg.

[0120] In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 310.sup.13 vg/kg, 310.sup.13 vg/kg to 510.sup.13 vg/kg, 510.sup.13 vg/kg to 710.sup.13 vg/kg, 710.sup.13 vg/kg to 910.sup.13 vg/kg, 910.sup.13 vg/kg to 210.sup.14 vg/kg, or 210.sup.14 vg/kg to 510.sup.14 vg/kg. In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 510.sup.13 vg/kg, 510.sup.13 vg/kg to 910.sup.13 vg/kg, 910.sup.13 vg/kg or to 510.sup.14 vg/kg. In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 910.sup.13 vg/kg, or 910.sup.13 vg/kg or to 510.sup.14 vg/kg.

[0121] In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 510.sup.13 vg/kg, 510.sup.13 vg/kg to 110.sup.14 vg/kg, or 110.sup.14 vg/kg to 510.sup.14 vg/kg.

[0122] In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 510.sup.14 vg/kg. In some embodiments, detectable expression of LAMP-2B in heart tissue occurs at doses, in vector genomes (vg) per kilogram weight of subject (kg), of 110.sup.13 vg/kg to 110.sup.14.

[0123] In various embodiments, the pharmaceutical compositions contain vehicles (e.g., carriers, diluents and excipients) that are pharmaceutically acceptable for a formulation capable of being injected. Exemplary excipients include a poloxamer. Formulation buffers for viral vectors (including AAV) general contains salts to prevent aggregation and other excipients (e.g. poloxamer) to reduce stickiness of the vector. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions. Advantageously, the formulation is stable for storage and use when frozen (e.g. at less than 0 C., about 60 C., or about 72 C.).

[0124] Exemplary methods of treating lysosomal disorders and/or Danon disease are provided in WO 2018/170239 A1, which is incorporated herein in its entirety. The transgenes, expression cassettes, and vectors of the disclosure are useful for both in vivo (e.g. systemic, particularly intravenous use) and also ex vivo use. LAMP-2B transgene and a functional promoter can be used to ex vivo gene-correct patients' autologous hematopoietic stem and progenitor cells (HSPCs), which can then be re-transplanted in the patients to repopulate their bone marrow, which is a reservoir of healthy cells for the rest of the life of the patients. In some embodiments, lentiviral vectors are used for ex vivo gene corrected, but other non-viral or viral vectors may be used in place of a lentiviral vector. The disclosure are envisions allogeneic transplant using donor HSPCs. In some embodiments, the lentiviral vector is a self-inactivating (SIN) lentivirus vector. In some embodiments, the HSPCs are derived from peripheral blood mobilized using, e.g., granulocyte-colony stimulating factor (G-CSF) and/or plerixafor.

[0125] In another aspect, the disclosure provides methods of preventing, mitigating, ameliorating, reducing, inhibiting, eliminating and/or reversing one or more symptoms of Danon disease or another autophagy disorder in a subject in need thereof, comprising administering to the subject a gene therapy vector of the disclosure. The term Danon disease refers to an X-linked dominant skeletal and cardiac muscle disorder with multisystem clinical manifestations. Danon disease mutations lead to an absence of lysosome-associated membrane protein 2 (LAMP-2) protein expression. Major clinical features include skeletal and cardiac myopathy, cardiac conduction abnormalities, cognitive difficulties, and retinal disease. Men are typically affected earlier and more severely than women.

[0126] In an embodiment, the vector is administered via a route selected from the group consisting of parenteral, intravenous, intra-arterial, intracardiac, intracoronary, intramyocardial, intrarenal, intraurethral, epidural, and intramuscular. In an embodiment, the vector is administered multiple times. In an embodiment, the vector is administered by intramuscular injection of the vector. In an embodiment, the vector is administered by injection of the vector into skeletal muscle. In an embodiment, the expression cassette comprises a muscle-specific promoter, optionally a muscle creatine kinase (MCK) promoter or a MCK/SV40 hybrid promoter as described in Takeshita et al. Muscle creatine kinase/SV40 hybrid promoter for muscle-targeted long-term transgene expression. Int J Mol Med. 2007 February; 19(2):309-15. In an embodiment, the vector is administered by intracardiac injection.

[0127] In an embodiment, the vector, e.g., AAV vector, is administered systemically, and more particularly, intravenously. Advantageously, the vector is administered at a dose (in vg per mL, vg/kg body mass, or vg/min/kg) less than the dose required to observe the same response when an original or wild-type LAMP-2B sequence is used. In particular embodiments, the vector is an AAV2/9 vector comprising an expression cassette comprising a polynucleotide encoding LAMP-2B disclosed herein.

[0128] In some embodiments, the disclosure provides a method of expressing LAMP-2B in a subject, comprising systemically administering an adeno-associated viral (AAV) vector to the subject, wherein the AAV vector comprises an expression cassette comprising a transgene sharing at least 95% identity with SEQ ID NO: 3 or is identical to SEQ ID NO: 3, the transgene operatively linked to an enhancer/promoter region, wherein systemic administration of the AAV vector to the subject results in increased expression of LAMP-2B compared to expression of LAMP-2B prior to administration of the AAV vector or expression of LAMP-2B in an untreated control subject. In some embodiments, the AAV vector is an AAV2/9 vector. In particular embodiments, the expression cassette comprises any of the elements disclosed herein. In some embodiment, systemic administration comprises intravenous administration. In some embodiments, the subject is exhibiting symptoms of Danon disease. In some embodiments, the subject suffers from, or is at risk for, Danon disease.

[0129] In some embodiments, the AAV vector is administered at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the AAV vector is administered at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the AAV vector is administered at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the AAV vector is administered at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0130] In some embodiments, the AAV vector is administered at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0131] In some embodiments, the AAV vector is administered at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg 110.sup.13 vg/kg 310.sup.13 vg/kg 510.sup.13 vg/kg 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0132] In some embodiments, the lentiviral vector is administered at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the lentiviral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the lentiviral vector is administered at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0133] In some embodiments, the lentiviral vector is administered at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0134] In some embodiments, the lentiviral vector is administered at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0135] In some embodiments, the viral vector is administered at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the viral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the viral vector is administered at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the viral vector is administered at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the viral vector is administered at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the viral vector is administered at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0136] In some embodiments, the viral vector is administered at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0137] In some embodiments, the viral vector is administered at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0138] In some embodiments, the AAV vector is administered systemically at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered systemically at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the AAV vector is administered systemically at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the AAV vector is administered systemically at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the AAV vector is administered systemically at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0139] In some embodiments, the AAV vector is administered systemically at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0140] In some embodiments, the AAV vector is administered systemically at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0141] In some embodiments, the lentiviral vector is administered systemically at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the lentiviral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the lentiviral vector is administered systemically at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered systemically at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered systemically at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered systemically at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0142] In some embodiments, the lentiviral vector is administered systemically at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0143] In some embodiments, the lentiviral vector is administered systemically at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0144] In some embodiments, the viral vector is administered systemically at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the viral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the viral vector is administered systemically at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the viral vector is administered systemically at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the viral vector is administered systemically at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the viral vector is administered systemically at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0145] In some embodiments, the viral vector is administered systemically at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0146] In some embodiments, the viral vector is administered systemically at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0147] In some embodiments, the AAV vector is administered intravenously at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered intravenously at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the AAV vector is administered intravenously at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the AAV vector is administered intravenously at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the AAV vector is administered intravenously at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0148] In some embodiments, the AAV vector is administered intravenously at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0149] In some embodiments, the AAV vector is administered intravenously at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0150] In some embodiments, the lentiviral vector is administered intravenously at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the lentiviral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the lentiviral vector is administered intravenously at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered intravenously at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered intravenously at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the lentiviral vector is administered intravenously at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0151] In some embodiments, the lentiviral vector is administered intravenously at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0152] In some embodiments, the lentiviral vector is administered intravenously at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0153] In some embodiments, the viral vector is administered intravenously at a dose of between about 110.sup.12 and 510.sup.14 vector genomes (vg) of the viral vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the viral vector is administered intravenously at a dose of between about 110.sup.13 and 510.sup.14 vg/kg. In some embodiments, the viral vector is administered intravenously at a dose of between about 510.sup.13 and 310.sup.14 vg/kg. In some embodiments, the viral vector is administered intravenously at a dose of between about 510.sup.13 and 110.sup.14 vg/kg. In some embodiments, the viral vector is administered intravenously at a dose of less than about 110.sup.12 vg/kg, less than about 310.sup.12 vg/kg, less than about 510.sup.12 vg/kg, less than about 710.sup.12 vg/kg, less than about 110.sup.13 vg/kg, less than about 310.sup.13 vg/kg, less than about 510.sup.13 vg/kg, less than about 710.sup.13 vg/kg, less than about 110.sup.14 vg/kg, less than about 310.sup.14 vg/kg, less than about 510.sup.14 vg/kg, less than about 710.sup.14 vg/kg, less than about 110.sup.15 vg/kg, less than about 310.sup.15 vg/kg, less than about 510.sup.15 vg/kg, or less than about 710.sup.15 vg/kg.

[0154] In some embodiments, the viral vector is administered intravenously at a dose of about 110.sup.12 vg/kg, about 310.sup.12 vg/kg, about 510.sup.12 vg/kg, about 710.sup.12 vg/kg, about 110.sup.13 vg/kg, about 310.sup.13 vg/kg, about 510.sup.13 vg/kg, about 710.sup.13 vg/kg, about 110.sup.14 vg/kg, about 310.sup.14 vg/kg, about 510.sup.14 vg/kg, about 710.sup.14 vg/kg, about 110.sup.15 vg/kg, about 310.sup.15 vg/kg, about 510.sup.15 vg/kg, or about 710.sup.15 vg/kg.

[0155] In some embodiments, the viral vector is administered intravenously at a dose of 110.sup.12 vg/kg, 310.sup.12 vg/kg, 510.sup.12 vg/kg, 710.sup.12 vg/kg, 110.sup.13 vg/kg, 310.sup.13 vg/kg, 510.sup.13 vg/kg, 710.sup.13 vg/kg, 110.sup.14 vg/kg, 310.sup.14 vg/kg, 510.sup.14 vg/kg, 710.sup.14 vg/kg, 110.sup.15 vg/kg, 310.sup.15 vg/kg, 510.sup.15 vg/kg, or 710.sup.15 vg/kg.

[0156] Systemic (or more particularly intravenous) administration in some embodiments results in expression of LAMP-2B polynucleotide as mRNA, in the form of an mRNA expressed from the transgene, in one or more tissues (e.g. heart, muscle, and/or liver) of the subject. In some embodiments, expression of the LAMP-2B polynucleotide as mRNA is increased at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2.0-fold, at least about 2.2-fold, at least about 2.3-fold, at least about 2.4-fold, at least about 2.5-fold, at least about 3-fold, or at least about 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is increased at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2.0-fold, at least 2.2-fold, at least 2.3-fold, at least 2.4-fold, at least 2.5-fold, at least 3-fold, or at least 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is increased 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, 3-fold, or 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector.

[0157] In some embodiments, expression of LAMP-2B polynucleotide as mRNA is increased at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2.0-fold, at least about 2.2-fold, at least about 2.3-fold, at least about 2.4-fold, at least about 2.5-fold, at least about 3-fold, or at least about 4-fold in the muscle compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is increased at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2.0-fold, at least 2.2-fold, at least 2.3-fold, at least 2.4-fold, at least 2.5-fold, at least 3-fold, or at least 4-fold in the muscle compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is increased 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, 3-fold, or 4-fold in the muscle compared to expression in an untreated subject or a subject treated with a control vector.

[0158] In some embodiments, the LAMP-2B transgene is expressed in the heart and not expressed in the liver of the subject. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is observed to be at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2.0-fold, at least about 2.2-fold, at least about 2.3-fold, at least about 2.4-fold, at least about 2.5-fold, at least about 3-fold, or at least about 4-fold in the heart compared to the liver. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is observed to be at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2.0-fold, at least 2.2-fold, at least 2.3-fold, at least 2.4-fold, at least 2.5-fold, at least 3-fold, or at least 4-fold in the heart compared to the liver. In some embodiments, expression of LAMP-2B polynucleotide as mRNA is observed to be 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, 3-fold, or 4-fold in the heart compared to the liver.

[0159] In some embodiments, expression of wild-type or functional LAMP-2B protein is increased at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2.0-fold, at least about 2.2-fold, at least about 2.3-fold, at least about 2.4-fold, at least about 2.5-fold, at least about 3-fold, or at least about 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of wild-type or functional LAMP-2B protein is increased at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2.0-fold, at least 2.2-fold, at least 2.3-fold, at least 2.4-fold, at least 2.5-fold, at least 3-fold, or at least 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector. In some embodiments, expression of wild-type or functional LAMP-2B protein is increased 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, 3-fold, or 4-fold in the heart compared to expression in an untreated subject or a subject treated with a control vector.

[0160] In some embodiments, expression of wild-type or functional LAMP-2B protein is observed to be at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2.0-fold, at least about 2.2-fold, at least about 2.3-fold, or at least 5-fold, in the heart compared to the liver. In some embodiments, expression of wild-type or functional LAMP-2B protein is observed to be at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2.0-fold, at least 2.2-fold, at least 2.3-fold, at least 2.4-fold, at least 2.5-fold, at least 3-fold, or at least 4-fold in the heart compared to the liver. In some embodiments, expression of wild-type or functional LAMP-2B protein is observed to be 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, 3-fold, or 4-fold in the heart compared to the liver.

[0161] In some embodiments, administration of the gene therapy vector results in expression of wild-type or functional LAMP-2B protein in the liver of at most about 1.1-fold, at most about 1.2-fold, at most about 1.3-fold, at most about 1.4-fold, at most about 1.5-fold, at most about 1.6-fold, at most about 1.7-fold, at most about 1.8-fold, at most about 1.9-fold, or at most about 2-fold increased compared to expression in the liver of an untreated subject. In some embodiments, administration of the gene therapy vector results in expression of wild-type or functional LAMP-2B protein in the liver of at most 1.1-fold, at most 1.2-fold, at most 1.3-fold, at most 1.4-fold, at most 1.5-fold, at most 1.6-fold, at most 1.7-fold, at most 1.8-fold, at most 1.9-fold, or at most 2-fold increased compared to expression in the liver of an untreated subject. In some embodiments, administration of the gene therapy vector results in expression of wild-type or functional LAMP-2B protein in the liver of 1.1-fold, 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, or 2-fold increased compared to expression in the liver of an untreated subject.

[0162] In an embodiment, the disclosure provides a method of treating a disease or disorder, optionally Danon disease, in a subject in need thereof, comprising contacting cells with a gene therapy vector according to the present disclosure and administering the cells to the subject. In an embodiment, the cells are stem cells, optionally pluripotent stem cells. In an embodiment, the stem cells are capable of differentiation into cardiac tissue. In an embodiment, the stem cells are capable of differentiation into muscle tissue, e.g., cardiac muscle tissue and/or skeletal muscle tissue. In an embodiment, the stem cells are autologous. In an embodiment, the stem cells are induced pluripotent stem cells (iPSCs).

[0163] In an embodiment, the disease or disorder is an autophagy disorder. In some embodiments, the autophagy disorder is selected from the group consisting of, but not limited to, end-stage heart failure, myocardial infarction, drug toxicities, diabetes, end-stage renal failure, and aging. In an embodiment, the subject is a mammal, e.g., a human. In an embodiment, the subject is exhibiting symptoms of Danon disease or another autophagy disorder. In an embodiment, the subject has been identified as having reduced or non-detectable LAMP-2 expression. In an embodiment, the subject has been identified as having a mutated LAMP-2 gene.

[0164] Subjects/patients amenable to treatment using the methods described herein include, but are not limited to, individuals at risk of a disease or disorder characterized by insufficient autophagic flux (e.g., Danon disease as well as other known disorders of autophagy including, but not limited to, systolic and diastolic heart failure, myocardial infarction, drug toxicities (for example, anthracyclines chloroquine and its derivatives), diabetes, end-stage renal disease, and aging) but not showing symptoms, as well as subjects presently showing symptoms. Such subject may have been identified as having a mutated LAMP-2 gene or as having reduced or non-detectable levels of LAMP-2 expression.

[0165] In some embodiments, the patient is a human. In some embodiments, the patient is a pediatric, adolescent, or adult human. In some embodiments, the patient is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 years old, or more than 20 years old. In some embodiments, the patient is 20 to 50 years old. In some embodiments, the patient is 50 to 65 years old. In some embodiments, the patient is 1 to 5, 2 to 6, 3 to 7, 4 to 8, 5 to 9, 6 to 10, 7 to 11, 8 to 12, 9 to 13, 10 to 14, 11 to 15, 12 to 16, 13 to 17, 14 to 18, 15 to 19, or 16 to 20 years old. In some embodiments, the patient is 5 to 6, 6 to 7, 7 to 8, 8 to 9, 9 to 10, 10 to 11, 11 to 12, 12 to 13, 13 to 14, 14 to 15, 15 to 16, 16 to 17, 17 to 18, 18 to 19, 19 to 20, or 20 to 21 years old. In a particular embodiment, the patient is 15 to 16 years old.

[0166] In some embodiments, the patient is a human male. In some embodiments, the patient is a pediatric, adolescent, or adult human male. In some embodiments, the patient is a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 years old male, or a more than 20 years old male. In some embodiments, the patient is a 20 to 50 years old male. In some embodiments, the patient is a 50 to 65 years old male. In some embodiments, the patient is a 1 to 5, 2 to 6, 3 to 7, 4 to 8, 5 to 9, 6 to 10, 7 to 11, 8 to 12, 9 to 13, 10 to 14, 11 to 15, 12 to 16, 13 to 17, 14 to 18, 15 to 19, or 16 to 20 years old male. In some embodiments, the patient is a 5 to 6, 6 to 7, 7 to 8, 8 to 9, 9 to 10, 10 to 11, 11 to 12, 12 to 13, 13 to 14, 14 to 15, 15 to 16, 16 to 17, 17 to 18, 18 to 19, 19 to 20, or 20 to 21 year old male. In a particular embodiment, the patient is 15 to 16 years old.

[0167] In some embodiments, the patient is a human female. In some embodiments, the patient is a pediatric, adolescent, or adult human female. In some embodiments, the patient is a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 years old female, or a more than 20 years old female. In some embodiments, the patient is a 20 to 50 years old female. In some embodiments, the patient is a 50 to 65 years old female.

[0168] In some embodiments, the subject is exhibiting symptoms of a disease or disorder characterized by insufficient autophagic flux (e.g., Danon disease as well as other known disorders of autophagy including, but not limited to, systolic and diastolic heart failure, myocardial infarction, drug toxicities, diabetes, end-stage renal disease, and aging). The symptoms may be actively manifesting, or may be suppressed or controlled (e.g., by medication) or in remission. The subject may or may not have been diagnosed with the disorder, e.g., by a qualified physician.

Definitions

[0169] The terms lysosome-associated membrane protein 2 and LAMP-2 interchangeably refer to nucleic acids and polypeptide polymorphic variants, alleles, mutants, and interspecies homologs that: (1) have an amino acid sequence that has greater than about 90% amino acid sequence identity, for example, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, preferably over a region of at least about 25, 50, 100, 200, 300, 400, or more amino acids, or over the full-length, to an amino acid sequence encoded by a LAMP-2 nucleic acid (see, e.g., GenBank Accession Nos. NM_002294.2 (isoform A). NM_013995.2 (isoform B), NM_001122606.1 (isoform C)) or to an amino acid sequence of a LAMP-2 polypeptide (see e.g., GenBank Accession Nos. NP_002285.1 (isoform A), NP_054701.1 (isoform B), NP_001116078.1 (isoform C)); (2) bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising an amino acid sequence of a LAMP-2 polypeptide (e.g., LAMP-2 polypeptides described herein); or an amino acid sequence encoded by a LAMP-2 nucleic acid (e.g., LAMP-2 polynucleotides described herein), and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to an anti-sense strand corresponding to a nucleic acid sequence encoding a LAMP-2 protein, and conservatively modified variants thereof; (4) have a nucleic acid sequence that has greater than about 90%, preferably greater than about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher nucleotide sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, 2000 or more nucleotides, or over the full-length, to a LAMP-2 nucleic acid (e.g., LAMP-2 polynucleotides, as described herein, and LAMP-2 polynucleotides that encode LAMP-2 polypeptides, as described herein).

[0170] The terms lysosome-associated membrane protein 2B and LAMP-2B interchangeably refer to nucleic acids and polypeptide polymorphic variants, alleles, mutants, and interspecies homologs that: (1) have an amino acid sequence that has greater than about 90% amino acid sequence identity, for example, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, preferably over a region of at least about 25, 50, 100, 200, 300, 400, or more amino acids, or over the full-length, to an amino acid sequence encoded by a LAMP-2B nucleic acid (see e.g., NM_013995.2) or to an amino acid sequence of a LAMP-2B polypeptide (see e.g., NP_054701.1); (2) bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising an amino acid sequence of a LAMP-2B polypeptide (e.g., LAMP-2B polypeptides described herein); or an amino acid sequence encoded by a LAMP-2B nucleic acid (e.g., LAMP-2B polynucleotides described herein), and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to an anti-sense strand corresponding to a nucleic acid sequence encoding a LAMP-2B protein, and conservatively modified variants thereof; (4) have a nucleic acid sequence that has greater than about 90%, preferably greater than about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher nucleotide sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, 2000 or more nucleotides, or over the full-length, to a LAMP-2B nucleic acid (e.g., LAMP-2B polynucleotides, as described herein, and LAMP-2B polynucleotides that encode LAMP-2B polypeptides, as described herein).

[0171] The term functional variant in respect to a protein (e.g. a LAMP-2B) refers to a polypeptide sequence, or a fragment of a polypeptide sequence having at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, or at least about 80 amino acid resides, that retains one or more functional attributes of the protein. For example, a functional variant of LAMP-2B is a LAMP-2B (as defined herein) that retains one or more functions such as: (1) regulating human cardiomyocyte function (Chi et al. (2019) PNAS USA 116 (2) 556-565); (2) improving metabolic and physiological function in Danon disease (Adler et al. (2019) J Am. College Cardiology S0735-1097(19)31295-1); and/or (3) autophagy (Rowland et al. (2016) J. Cell Sci. (2016) 129, 2135-2143).

[0172] LAMP-2B has a lumenal domain (residues 29-375), a transmembrane domain (residues 376-399), and a cytoplasmic domain (residues 400-410), see UniProt Accession No. P13473. LAMP-2B functions in include chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live (Cuervo et al. Science 273:501-503 (1996), Cuervo et al. J. Cell Sci. 113:4441-4450 (2000), Bandyopadhyay et al. Mol. Cell. Biol. 28:5747-5763 (2008), Li et al. Exp. Cell Res. 327:48-56 (2014), Hubert et al. Biol. Open 5:1516-1529 (2016)). LAMP-2B may target GAPDH and MLLT11 for lysosomal degradation. LAMP-2B may be required for the fusion of autophagosomes with lysosomes during autophagy. It has been suggested that cells that lack LAMP2 express normal levels of VAMPS, but fail to accumulate STX17 on autophagosomes, which is the most likely explanation for the lack of fusion between autophagosomes and lysosomes. LAMP-2B may be required for normal degradation of the contents of autophagosomes. LAMP-2B may be required for efficient MHCII-mediated presentation of exogenous antigens via its function in lysosomal protein degradation; antigenic peptides generated by proteases in the endosomal/lysosomal compartment are captured by nascent MHCII subunits (Crotzer et al. Immunology 131:318-330 (2010)).

[0173] Functional variants of LAMP-2B therefore include fragments of LAMP-2B that are capable of mediating any of the foregoing functions. In some embodiments, the function fragment of LAMP-2B includes one or more of the lumenal, transmembrane, and cytoplasmic domains. In some embodiments, the functional variant of LAMP-2B comprises one or more C-terminal or N-terminal deletions with respect to native LAMP-2B. In some embodiments, the functional variant of LAMP-2B comprises one or more internal deletions with respect to native LAMP-2B.

[0174] The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., share at least about 80% identity, for example, at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identity over a specified region to a reference sequence, e.g., LAMP-2 polynucleotide or polypeptide sequence as described herein, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then said to be substantially identical. This definition also refers to the compliment of a test sequence. Preferably, the identity exists over a region that is at least about 25 amino acids or nucleotides in length, for example, over a region that is 50, 100, 200, 300, 400 amino acids or nucleotides in length, or over the full-length of a reference sequence.

[0175] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. For sequence comparison of nucleic acids and proteins to LAMP-2 nucleic acids and proteins, the BLAST and BLAST 2.0 algorithms and the default parameters are used.

[0176] A comparison window, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Ausubel et al., eds., Current Protocols in Molecular Biology (1995 supplement)). Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., J. Mol. Biol. 215:403-410 (1990) and Altschul et al., Nucleic Acids Res. 25:3389-3402 (1977), respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (on the worldwide web at ncbi.nlm.nih.gov/).

[0177] An indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.

[0178] As used herein, administering refers to local and systemic administration, e.g., including enteral, parenteral, pulmonary, and topical/transdermal administration. Routes of administration for compounds (e.g., polynucleotide encoding one or more LAMP-2 isoforms) that find use in the methods described herein include, e.g., oral (per os (P.O.)) administration, nasal or inhalation administration, administration as a suppository, topical contact, transdermal delivery (e.g., via a transdermal patch), intrathecal (IT) administration, intravenous (iv) administration, intraperitoneal (ip) administration, intramuscular (im) administration, intralesional administration, or subcutaneous (sc) administration, or the implantation of a slow-release device e.g., a mini-osmotic pump, a depot formulation, etc., to a subject. Administration can be by any route including parenteral and transmucosal (e.g., oral, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intraarterial, intrarenal, intraurethral, intracardiac, intracoronary, intramyocardial, intradermal, epidural, subcutaneous, intraperitoneal, intraventricular, iontophoretic and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.

[0179] The terms systemic administration and systemically administered refer to a method of administering a compound or composition to a mammal so that the compound or composition is delivered to sites in the body, including the targeted site of pharmaceutical action, via the circulatory system. Systemic administration includes, but is not limited to, oral, intranasal, rectal and parenteral (e.g., other than through the alimentary tract, such as intramuscular, intravenous, intra-arterial, transdermal and subcutaneous) administration.

[0180] The term co-administering or concurrent administration, when used, for example with respect to the compounds (e.g., LAMP-2 polynucleotides) and/or analogs thereof and another active agent, refers to administration of the compound and/or analogs and the active agent such that both can simultaneously achieve a physiological effect. The two agents, however, need not be administered together. In certain embodiments, administration of one agent can precede administration of the other. Simultaneous physiological effect need not necessarily require presence of both agents in the circulation at the same time. However, in certain embodiments, co-administering typically results in both agents being simultaneously present in the body (e.g., in the plasma) at a significant fraction (e.g., 20% or greater, e.g., 30% or 40% or greater, e.g., 50% or 60% or greater, e.g., 70% or 80% or 90% or greater) of their maximum serum concentration for any given dose.

[0181] The term effective amount or pharmaceutically effective amount refer to the amount and/or dosage, and/or dosage regime of one or more compounds (e.g., gene therapy vectors) necessary to bring about the desired result e.g., increased expression of one or more LAMP-2 isoforms in an amount sufficient to reduce the ultimate severity of a disease characterized by impaired or deficient autophagy (e.g., Danon disease).

[0182] The phrase cause to be administered refers to the actions taken by a medical professional (e.g., a physician), or a person controlling medical care of a subject, that control and/or permit the administration of the agent(s)/compound(s) at issue to the subject. Causing to be administered can involve diagnosis and/or determination of an appropriate therapeutic or prophylactic regimen, and/or prescribing particular agent(s)/compounds for a subject. Such prescribing can include, for example, drafting a prescription form, annotating a medical record, and the like.

[0183] As used herein, the terms treating and treatment refer to delaying the onset of, retarding or reversing the progress of, reducing the severity of, or alleviating or preventing either the disease or condition to which the term applies, or one or more symptoms of such disease or condition. The terms treating and treatment also include preventing, mitigating, ameliorating, reducing, inhibiting, eliminating and/or reversing one or more symptoms of the disease or condition.

[0184] The term mitigating refers to reduction or elimination of one or more symptoms of that pathology or disease, and/or a reduction in the rate or delay of onset or severity of one or more symptoms of that pathology or disease, and/or the prevention of that pathology or disease. In certain embodiments, the reduction or elimination of one or more symptoms of pathology or disease can include, e.g., measurable and sustained increase in the expression levels of one or more isoforms of LAMP-2.

[0185] As used herein, the phrase consisting essentially of refers to the genera or species of active pharmaceutical agents recited in a method or composition, and further can include other agents that, on their own do not have substantial activity for the recited indication or purpose.

[0186] The terms subject, individual, and patient interchangeably refer to a mammal, preferably a human or a non-human primate, but also domesticated mammals (e.g., canine or feline), laboratory mammals (e.g., mouse, rat, rabbit, hamster, guinea pig) and agricultural mammals (e.g., equine, bovine, porcine, ovine). In various embodiments, the subject can be a human (e.g., adult male, adult female, adolescent male, adolescent female, male child, female child).

[0187] The terms gene transfer or gene delivery refer to methods or systems for reliably inserting foreign DNA into host cells. Such methods can result in transient expression of non-integrated transferred DNA, extrachromosomal replication and expression of transferred replicons (e.g. episomes), or integration of transferred genetic material into the genomic DNA of host cells.

[0188] The term vector is used herein to refer to a nucleic acid molecule capable transferring or transporting another nucleic acid molecule. The transferred nucleic acid is generally linked to, e.g., inserted into, the vector nucleic acid molecule. A vector may include sequences that direct autonomous replication or reverse transcription in a cell, or may include sequences sufficient to allow integration into host cell DNA. vectors include gene therapy vectors. As used herein, the term gene therapy vector refers to a vector capable of use in performing gene therapy, e.g., delivering a polynucleotide sequence encoding a therapeutic polypeptide to a subject. Gene therapy vectors may comprise a nucleic acid molecule (transgene) encoding a therapeutically active polypeptide, e.g., a LAMP-2B or other gene useful for replacement gene therapy when introduced into a subject. Useful vectors include, but are not limited to, viral vectors.

[0189] As used herein, the term expression cassette refers to a DNA segment that is capable in an appropriate setting of driving the expression of a polynucleotide (a transgene) encoding a therapeutically active polypeptide (e.g., LAMP-2B) that is incorporated in said expression cassette. When introduced into a host cell, an expression cassette inter alia is capable of directing the cell's machinery to transcribe the transgene into RNA, which is then usually further processed and finally translated into the therapeutically active polypeptide. The expression cassette can be comprised in a gene therapy vector. Generally, the term expression cassette excludes polynucleotide sequences 5 to the 5 ITR and 3 to the 3 ITR.

[0190] All patents, patent publications, and other publications referenced and identified in the present specification are individually and expressly incorporated herein by reference in their entirety for all purposes.

EXAMPLES

Example 1: Enhanced Gene Expression Using Lamp-2B Transgene Variants

[0191] A gene expression cassette depicted in FIG. 2 was constructed in a plasmid-based green fluorescence protein (GFP) reporter system for LAMP-2B transgene expression. The plasmid included a single open reading frame encoding the LAMP-2B transgene, a 2A peptide, and an enhanced green fluorescence protein (eGFP). Post-translational self-cleavage of the 2A peptide resulted in co-expression of LAMP-2B and eGFP in equimolar amounts. A wild-type LAMP-2B coding sequence (SEQ ID NO: 2) and three codon variants of the LAMP-2B coding sequence (codon variants 1, 2 and 3; SEQ ID NOs: 3-5, respectively) were tested as the transgenes. The three codon variants contained a reduced number of CpGs, removal of cryptic sites, and a reduced number of open reading frames as compared to the wild-type LAMP-2B coding sequence.

[0192] Forty wells of a CellBIND 96-well plate (NUNC #3300) were coated with 0.1% gelatin in water (Millipore ES-006-B) for 1 hour at room temperature. Approximately 88,000 induced pluripotent stem cell (iPSC)-derived cardiomyocytes (VWR MSPP-CMC10001) were plated into each well in plating media (VWR # M1001) at 37 C. and 5% carbon dioxide (CO.sub.2). After 4 hours, the media was changed to maintenance media (VWR # M1003) that was pre-equilibrated to 37 C. and 5% CO.sub.2. A transfection mixture was prepared by adding 6 L of transfection reagent (ViaFect Promega # E4982) to 128 L of 0.015 g/L plasmid (wildtype or codon variants 1, 2, or 3) in OptiMEM or OptiMEM+ViaFect only (negative control) and incubated for 10-20 min. 100 L of this transfection mixture was added to 1 mL of maintenance media that was pre-equilibrated to 37 C. and 5% CO.sub.2.

[0193] Approximately 28 hours after initial plating, 100 L of this transfection mixture in maintenance media was added to each well. Approximately 48 hours after adding media with transfection mixture, the cells were imaged and analyzed on an automated confocal microscope (Perkin Elmer Operetta CLS, Harmony version 4.5 software) for GFP positive cells (FIG. 3) and their average fluorescent intensity (FIG. 4). Immunofluorescence images of the cells two or seven days after transfection are shown in FIG. 5 and FIG. 6, respectively.

[0194] FIG. 3 shows that the use of codon variants 1 (CO 1) or 2 (CO 2) resulted in expression of GFP in a significantly higher number of cells (9-fold higher) as compared to the wild-type transgene. Similarly, FIG. 4 showed mean GFP intensity in cells transfected with codon variants 1 (CO 1) and 2 (CO 2) to be 1.5-fold higher than wild-type.

Example 2: Optimized LAMP-2B Gene Therapy Vectors

[0195] Optimized AAV gene therapy vectors are produced by inserting the LAMP-2B optimized variant, CO1 sequence described in Example 1 into the expression cassette of a recombinant AAV vector. The AAV regulatory cassette is modified by removal of upstream cryptic ATG sequence, use of an optimized consensus Kozak sequence, and/or a full-length polyadenylation sequence. The vectors are tested in comparison to control recombinant AAV vectors containing one or more additional ATG sites upstream of the transgene, a non-optimal Kozak sequence, and/or a non-full-length polyadenylation sequence. Vectors are tested in vitro in Danon patient iPSC-derived cardiomyocytes and in a LAMP-2.sup./ knockout mouse model of Danon disease. The optimized AAV gene therapy cassettes and vectors are expected to result in a higher level of expression and/or expression in a higher percentage of cells as compared to the control recombinant AAV vectors.

Example 3: In Vitro Evaluation of AAV9-LAMP-2B.v1.2

[0196] AAV gene therapy cassette and vector were produced by inserting the LAMP-2B variant sequence CO1 (SEQ ID NO: 3) into a recombinant AAV plasmid vector having no cryptic start sites upstream of the transgene, an optimized consensus Kozak sequence, and a full-length polyadenylation (polyA) sequence from rabbit globin (LAMP-2B.v.1.2; expression cassette: SEQ ID NO: 8). LAMP-2B.v1.2 was compared to LAMP-2B v1.0, which is the regulatory cassette having a wild-type LAMP-2B transgene (transgene sequence: SEQ ID NO: 2) without an optimal Kozak sequence and a mini-polyA.

[0197] HEK293 cells were used to generate viral particles with three-plasmid, helper virus-free system was used to generate recombinant AAV particles containing serotype 9 capsid proteins and viral genomes that have AAV2 ITRs flanking the LAMP-2B expression cassette. The expression cassette contains the human codon-optimized LAMP-2B coding sequence (v1.2 or v1.0) driven by an upstream chimeric CAG promoter containing the CMV IE enhancer (CMV IE), the chicken (3-actin (CBA) promoter, and a CBA intron splice donor (FIG. 1A). The expression cassette also includes a downstream WPRE element and is terminated by the rabbit beta-globin polyadenylation signal (RGpA). The HEK293 cells were transiently transfected with the LAMP-2B.v1.2 plasmid vector or the LAMP-2B.v1.0 plasmid vector, a pAAV2/9 packaging plasmid, and pAd-Helper adenovirus helper plasmid.

[0198] CHO-Lec2 cells were seeded in a 24 well plate at 1.210.sup.5 cells/mL in MEM- containing 10% FBS and 1% Normocin. The following day, CHO-Lec2 cells were transduced in serum-free MEM medium with either AAV9-LAMP-2B.v1.0, AAV9-LAMP-2B.v1.2, or the same vector having GFP in place of the LAMP-2B transgene (at MOI of 310.sup.5). Seven days post-transduction, lysates were harvested using the Mammalian Cell Lysis kit (Sigma) and total protein was quantified using the MicroBCA kit per manufacturer's instructions. Proteins were separated by SDS-PAGE, transferred onto nitrocellulose membranes and immunoblotted for LAMP-2B (1:500) and GAPDH (1:10,000). CHO-Lec2 cells transduced with AAV9-optimized LAMP-2B.v1.2 showed increased expression compared to CHO-Lec2 cells transduced with the original AAV9-wild-type LAMP-2B.v1.0 (FIG. 7A). LAMP-2B was not detected in cells transduced with AAV9-GFP vector alone (FIG. 7A).

[0199] LAMP-2B expression was also quantitated in cell lysates by ELISA. Briefly, a 96 well plate was coated with anti-LAMP-2B antibody (clone: H4B4), lysates were added to the wells, and detection was performed using anti-LAMP-2B polyclonal antibody (1:500, Thermo Fisher PA; 5-24575) followed by incubation with HRP-conjugated anti-rabbit antibody (1:3000, Sigma). Transduction with AAV9-optimized LAMP-2B.v1.2 vector resulted in an approximately 7-fold increase in LAMP-2B expression compared to cells transduced with the AAV9-wild-type LAMP-2B.v1.0 (FIG. 7B).

[0200] Cardiomyocytes were derived from iPSCs generated from individuals with Danon disease. Following rhythmic contraction and selection for purity, Danon disease cardiomyocytes were transduced with various viral genome copies (vg) of AAV9-Luc (negative control), AAV9-wild-type LAMP-2B.v1.0 or AAV9-optimized LAMP-2B.v1.2. Ten days post-transduction, transduced cardiomyocytes were fixed with 4% paraformaldehyde, permeabilized, blocked for 30 min in 5% IgG-free BSA and incubated for 1 hour with either mouse anti-human LAMP-2B antibody (1:25, clone: H4B4) or rabbit anti--actinin antibody (1:200, # A7811, Sigma). Cells were washed with 1PBS to remove residual unbound primary antibody and then subjected to the appropriate anti-mouse AlexaFluor tagged secondary antibody and 200 ng/mL DAPI for 60 minutes at room temperature. The wells were then washed with PBS prior to imaging. Human LAMP-2B expression was expressed at a higher level in cardiomyocytes transduced with low titer (1.5610.sup.8 vg/well) AAV9-optimized LAMP-2B.v1.2 vector compared to cardiomyocytes transduced with the highest titer (8.4510.sup.10 vg/well) of AAV9-wild-type LAMP-2B.v1.0 (FIG. 8A and FIG. 8B).

[0201] Western blot analyses were performed on the transduced Danon disease cardiomyocytes. AAV9-optimized LAMP-2B.v1.2 at 0.98310.sup.9 vg/well showed significant expression of LAMP-2B protein compared to no detection of LAMP-2B protein in cells transduced with either AAV9-wild-type LAM2B.v1.0 (1.34710.sup.9 vg/well) or AAV9-Luc (1.16710.sup.9 vg/well) vectors (FIG. 8C). Collectively, these results demonstrate that the optimized AAV9-LAMP-2B.v1.2 vector mediates human LAMP-2B expression in Danon disease cardiomyocytes at a significantly higher level than the original AAV9-wild-type LAMP-2B.v1.0 vector.

Example 4: In Vivo Evaluation of AAV9-LAMP-2B.v1.2 in Mouse Model of Danon Disease

[0202] LAMP-2-deficient mice were intravenously injected with 110.sup.13 vg/kg of AAV9 viral vectors containing original human LAMP-2B (AAV9-LAMP-2B.v1.0), optimized human LAMP-2B (AAV9-LAMP-2B.v1.2, codon variant 1SEQ ID NO: 3) or vehicle alone. Six weeks post-treatment, mice were sacrificed and heart tissue was collected for analysis of LAMP-2B expression.

Methods

[0203] For quantitative analyses of vector copy number, total DNA was isolated from frozen tissues using the DNeasy Blood and Tissue kit according to manufacturer's guidelines. DNA concentration and integrity was assessed spectrophotometrically. qPCR was performed to calculate viral genome copies per g of DNA using TaqPath ProAmp Master Mix (Applied Biosystems) with forward (5-ATCATGCTATTGCTTCCCGTA-3; SEQ ID NO: 36) and reverse (5-GGGCCACAACTCCTCATAAA-3; SEQ ID NO: 37) primers and a probe (5-CCTCCTTGTATAAATCCTGGTTGCTGTCT-3; SEQ ID NO: 38) for the WPRE gene. RNase P was used as an endogenous control (Thermofisher, #4403328). A standard curve was generated using a linearized plasmid that contained the vector genome (WPRE) used for virus production. Quantification of DNA per sample was calculated using TaqMan copy number reference assay and was represented as vector copy number per diploid nucleus (VCN/Diploid Nucleus).

[0204] RNA was extracted and purified from heart using RNeasy Fibrous Tissue Mini kit according to the manufacturer's protocol. RNA concentration and integrity were assessed spectrophotometrically. RNA was reverse-transcribed using iScript cDNA Synthesis kit and cDNA was used as a template for quantitative real-time (qRT)-PCR. qRT-PCR was performed on cDNA using TaqPath ProAmp Master Mix with forward (5-ATCATGCTATTGCTTCCCGTA-3; SEQ ID NO: 36) and reverse (5-GGGCCACAACTCCTCATAAA-3; SEQ ID NO: 37) primers and a probe (5-CCTCCTTGTATAAATCCTGGTTGCTGTCT-3; SEQ ID NO: 38) for the WPRE gene.

[0205] For protein extraction, tissues were flash-frozen and pulverized, and the subsequent tissue powder was digested in protein lysis buffer (100 mM Tris, 300 mM NaCl, 20 mM EDTA, 2% NP-40, 0.2% SDS) containing protease and phosphatase inhibitor cocktails. Partial protein lysates were passed through a glass tissue grinder and sonicated with 3 bursts of 5 second on ice, with 10 seconds intervals in between at 30 amplitude microns power. Samples were centrifuged for 15 min at 12000 rpm and then the supernatant was collected. Concentration of protein in samples was determined by Lowry assay. Proteins (20 g/sample) were separated using 10-20% SDS-PAGE and transferred to PVDF membranes by rapid dry transfer technique. Membranes were then blocked in 5% milk (non-fat dry milk solubilized in PBS containing 0.1% Tween-20) for 1 h, and incubated with anti-human LAMP-2B (1:100, H4B4), anti-mouse LAMP-2B (1:100) or anti-GAPDH (1:1000, #32233, Santa Cruz) antibodies overnight at 4 C. Membranes were washed and then incubated with the appropriate HRP-conjugated secondary antibodies (1:10,000) for 1 hour at room temperature. The blots were developed using WesternBright Sirius substrates followed by imaging on a BioRad gel imager.

[0206] For immunofluorescence analyses, tissues were cryoprotected in 30% sucrose/PBS at 4 C., embedded in optimal cutting temperature (OCT) mounting media and then tissue was cut to 8-10 m thickness on a standard cryotome. Cryosections were then fixed with 4% PFA for 5 min, permeabilized with 0.2% Triton-X for 5 min and blocked with 1% BSA, 3% serum, 1% cold water fish gelatin in PBS for 30 minutes. The sections were incubated with mouse anti-human LAMP-2B antibody (1:50, H4B4) directly conjugated to Alexa Fluor 647 and rabbit anti-dystrophin antibody overnight at 4 C. The slides were then incubated with anti-rabbit Alexa Fluor 488 secondary antibody and DAPI (1:2000, # D9542, Sigma) for 30 min at room temperature. Slides were then imaged using an Olympus FluoView FV1000 confocal microscope. Scan speed, off set, voltage, and gain were kept constant during the acquisition of all images on a given day.

Results

[0207] Quantitative PCR was performed on cardiac tissue of AAV9-treated LAMP-2-deficient mice. Although similar viral copy numbers were observed in cardiac tissue of mice treated with wild-type and optimized LAMP-2B containing vector (FIG. 9A), transcription of AAV9-optimized LAMP-2B.v1.2 was increased nearly 7-fold compared to the AAV9-wild-type LAMP-2B.v1.0 (FIG. 9B). Despite similar transduction of v1.0 and v1.2 viral vectors in cardiac tissue, induction of human LAMP-2B mRNA expression was significantly enhanced using v1.2.

[0208] LAMP-2-deficient mice intravenously injected with AAV9-optimized LAMP-2B.v1.2 vector also showed significantly higher levels of human LAMP-2B protein in cardiac tissue compared to LAMP2-deficient mice treated with AAV9-wild-type LAMP-2B.v1.0 or the vehicle control (FIG. 9C). Similar results were achieved with immunofluorescence staining: human LAMP-2B was highly induced in cardiac tissue of LAMP-2-deficient mice treated with AAV9-optimized LAMP-2B.v1.2 (FIG. 9D). Collectively, these data show that viral transduction using the AAV9-optimized LAMP-2B.v1.2 vector leads to increased expression of human LAMP-2B protein in cardiac tissue in vivo compared to AAV9-wild-type LAMP-2B.v1.0 at the same dose.

Example 4: In Vivo Evaluation of AAV9-LAMP-2B.v1.2 in Non-Human Primates

[0209] Non-human primates were intravenously injected with 110.sup.13 vg/kg of either the AAV9 viral vector containing codon variant LAMP-2B (v1.2, codon variant 1SEQ ID NO: 3) described in Example 2, or vehicle control. Eight weeks post-treatment, the non-human primates were humanely sacrificed, and heart, muscle, liver and brain tissue was collected for analysis of LAMP-2B expression.

Methods

[0210] For quantitative analyses of vector copy number, total DNA was isolated from frozen tissues using the Qiagen DNeasy kit according to manufacturer's guidelines. DNA concentration and integrity were assessed spectrophotometrically. Quantitative PCR on isolated DNA was performed using TaqMan Universal Master Mix II (Applied Biosystems) with forward (5-ATCATGCTATTGCTTCCCGTA-3; SEQ ID NO: 36) and reverse (5-GGGCCACAACTCCTCATAAA-3; SEQ ID NO: 37) primers and a probe (5-CCTCCTTGTATAAATCCTGGTTGCTGTCT-3; SEQ ID NO: 38) for the WPRE gene. RNaseP was used as an endogenous control (#4403328, ThermoFisher). A standard curve was generated using a linearized plasmid that contained the vector genome used for virus production. Quantification of DNA per sample was calculated using the TaqMan copy number reference assay and was represented as vector copy number per diploid nucleus (VCN/Diploid Nucleus).

[0211] RNA was extracted and purified from heart and skeletal muscle using the RNeasy Fibrous Tissue Mini kit (Qiagen) and from liver and brain using the RNeasy Lipid Tissue kit (Qiagen) according to manufacturer's protocol. RNA concentration and integrity was assessed using the NanoDrop spectrophotometer. RNA was reverse-transcribed using SuperScript IV VILO master mix (ThermoFisher) and cDNA was used as a template for quantitative real-time (qRT)-PCR. qRT-PCR was performed on cDNA using TaqMan Universal Master Mix II with forward (5-ATCATGCTATTGCTTCCCGTA-3; SEQ ID NO: 36) and reverse (5-GGGCCACAACTCCTCATAAA-3; SEQ ID NO: 37) and a probe (5-CCTCCTTGTATAAATCCTGGTTGCTGTCT-3; SEQ ID NO: 38) of the WPRE gene. Human HPRT-1 was used as an endogenous control. A standard curve was generated using a linearized plasmid that contained the vector genome used for virus production.

[0212] For semi-quantitative analysis of mRNA using RNAScope technology, cardiac tissue was fixed in 10% neutral buffered formalin, embedded in paraffin and sectioned. Transgene mRNA was detected using WPRE-03 probe (#518628, ACD) with RNAscope 2.5 LS RED. Cells with greater than 1 dot were considered positive and the percentage of positive cells were binned into five categories: 0%, 1-25%, 26-50%, 51-75% or 100%.

[0213] For western blot analyses, 125 mg of cardiac tissue was homogenized in 500 L of lysis buffer using the Next Advance Bullet System. Protein concentration was determined using the BCA kit (ThermoFisher) and proteins (50 g/sample) were separated using SDS-PAGE and then transferred to nitrocellulose membranes. Membranes were then probed with mouse anti-human LAMP2 (1:100), washed and then incubated with HRP-conjugated anti-mouse antibody. The blots were developed using ECL substrate and the BioRad ChemiDoc MP system.

[0214] For the LAMP-2B ELISA, protein extraction was performed as described above. A plate was coated with mouse anti-LAMP2 antibody (clone: H4B4, # NBP2-22217, Novus Biologicals), 100 g of tissue lysate was added to each well, and detection was performed using anti-LAMP2 polyclonal antibody (# AF6228, R&D Systems) followed by incubation with HRP-conjugated donkey anti-goat antibody (# AP180P, Millipore).

Results

[0215] Quantitative PCR was performed on various tissues of AAV9-treated primates. Viral copy numbers were increased in heart, muscle and liver tissue of primates injected with AAV9-LAMP-2B.v1.2 vector at 110.sup.13 vg/kg compared to vehicle control (FIG. 10A). Vector genomes were detected in all cardiac chambers examined, including the left and right ventricles and left and right atriums (FIG. 10B). Vector mRNA was detected at significant levels in the heart, skeletal muscle and liver tissue of treated primates compared to the untreated vehicle control (FIG. 10C and FIG. 10D). In situ RNA analysis showed approximately 25-75% of heart and liver tissue expressing vector mRNA (FIG. 10E and FIG. 10F). These data demonstrate that systemic administration of 110.sup.13 vg/kg AAV9-optimized LAMP-2B.v1.2 to a primate results in efficient transduction and expression in heart tissue in vivo.

[0216] Western blot analyses showed that primates systemically treated with LAMP-2B.v1.2 at 110.sup.13 vg/kg showed increased human LAMP-2B protein in the left and right ventricles and left atrium of the heart compared to an untreated control (FIG. 10G and FIG. 10H). ELISA also showed that human LAMP-2B protein was increased in the left ventricle and atrium of the heart, as well as skeletal muscle tissue of primates treated with AAV9-LAMP-2B.v1.2 vector compared to an untreated control (FIG. 10I and FIG. 10J). Vector transduction using AAV9.LAMP-2B.v1.2 leads to expression of human LAMP-2B protein in cardiac tissue of primates in vivo.