Synthetic methylotrophs
10640746 ยท 2020-05-05
Assignee
Inventors
- Eleftherios T. Papoutsakis (Newark, DE, US)
- William Brian Whitaker (Wilmington, DE, US)
- Robert Kyle Bennett (Elkton, MD, US)
Cpc classification
C12N1/32
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides a non-naturally occurring microbe capable of growing in a medium comprising methanol, comprising a heterologous polynucleotide encoding a heterologous methanol dehydrogenase (MDH) derived from a Corynebacterium organism (Cor), wherein the MDH is expressed in the microbe, and wherein the MDH exhibits a Km of no more than 3 mM for methanol. Also provided are uses of the non-naturally occurring microbe for oxidizing methanol and producing a metabolite as well as the preparation of the non-naturally occurring microbe.
Claims
1. A non-naturally occurring microbe capable of growing in a medium comprising methanol, comprising a heterologous polynucleotide encoding a heterologous methanol dehydrogenase (MDH) from a Corynebacterium organism (Cor), wherein the microbe expresses the heterologous MDH and one or more heterologous ribulose monophosphate (RuMP) pathway enzymes, wherein the heterologous MDH consists of the amino acid sequence of SEQ ID NO: 1, wherein the one or more RuMP pathway enzymes comprise heterologous 3-hexulose-6-phosphate synthase (HPS) and heterologous 3-hexulose-6-phosphate isomerase (PHI), and wherein the non-naturally occurring microbe is E. coli.
2. The non-naturally occurring microbe of claim 1, wherein the Cor is selected from the group consisting of Corynebacterium glutamicum, Corynebacterium sp., Corynebacterium crudilactis, Corynebacterium deserti, Corynebacterium lubricantis, Corynebacterium callunae, Corynebacterium stationis, Corynebacterium casei, Corynebacterium ammoniagenes, Corynebacterium amycolatum, Corynebacterium sp. HMSC064E07, Corynebacterium lactis, Corynebacterium sp. HMSC077G07, Corynebacterium sp. HMSC074C05, Corynebacterium humireducens, Corynebacterium resistens, Corynebacterium vitaeruminis, Corynebacterium durum, Corynebacterium ulcerans, Corynebacterium ulcerans FRC11, Corynebacterium ulcerans NCTC 12077, Corynebacterium ulcerans FRC58, Corynebacterium efficiens, Corynebacterium ulcerans 0102, Corynebacterium terpenotabidum, Corynebacterium lipophiloflavum, Corynebacterium diphtheria, Corynebacterium sp. HMSC034A01, Corynebacterium sp. HMSC034B08, Corynebacterium sp. HMSC05H05, Corynebacterium mustelae, Corynebacterium sp. HMSC04H06, Corynebacterium pseudotuberculosis, Corynebacterium sp. HMSC070H05, Corynebacterium sp. HMSC29G08, Corynebacterium sp. HMSC11D10, Corynebacterium kutscheri, Corynebacterium freiburgense, Corynebacterium pseudotuberculosis FRC41, Corynebacterium sp. HMSC067D03, Corynebacterium sp. HMSC036E10, Corynebacterium jeddahense, Corynebacterium ciconiae, Corynebacterium coyleae, Corynebacterium sputi, Corynebacterium tuscaniense, Corynebacterium sp. HMSC074A01, Corynebacterium variabile, Corynebacterium nuruki, Corynebacterium testudinoris, Corynebacterium striatum, Corynebacterium pseudodiphtheriticum, Corynebacterium sp. EPI-003-04-2554_SCH2473622, Corynebacterium sp. HMSC06C06, Corynebacterium sp. SN15, Corynebacterium propinquum, Corynebacterium sp. KPL1818, Corynebacterium sp. KPL1824, Corynebacterium timonense, Corynebacterium sp. KPL1824, Cryobacterium flavum, Cryobacterium luteum, Cryobacterium levicorallinum, Arthrobacter sp. 162MFSha1.1, Rothia sp. ND6WE1A, and Arthrobacter sp. Soil761.
3. The non-naturally occurring microbe of claim 1, wherein the Cor is a Corynebacterium glutamicum (Cgl).
4. The non-naturally occurring microbe of claim 1, wherein the methanol contributes to at least 40% of the carbon source for the non-naturally occurring microbe.
5. The non-naturally occurring microbe of claim 1, wherein the expression of the one or more RuMP pathway enzymes is under control of a formaldehyde responsive promoter.
6. The non-naturally occurring microbe of claim 1, further expressing one or more heterologous pentose-phosphate pathway (PPP) enzymes.
7. The non-naturally occurring microbe of claim 6, wherein the expression of the one or more heterologous PPP enzymes is under control of a formaldehyde responsive promoter.
8. The non-naturally occurring microbe of claim 6, wherein the one or more heterologous PPP enzymes comprise heterologous phosphofructokinase (PFK), heterologous fructose bisphosphate aldolase (FBA), heterologous transketolase (TKT), heterologous fructose/sedoheptulose biphosphatase (GLPX), heterologous transaldolase (TAL), heterologous ribose-5-phosphate isomerase (RPI) and heterologous ribulose phosphate epimerase (RPE).
9. The non-naturally occurring microbe of claim 1, wherein the non-naturally occurring microbe comprises a deletion of a frmRAB operon.
10. A method for oxidizing methanol, comprising growing the non-naturally occurring microbe of claim 1 in a medium comprising methanol, whereby the methanol is oxidized.
11. The method of claim 10, further comprising producing a metabolite.
12. The method of claim 11, wherein the metabolite is n-butanol.
13. The method of claim 11, wherein the metabolite is selected from the group consisting of 4-carbon chemicals, diacids, 3-carbon chemicals, higher carboxylic acids, alcohols of higher carboxylic acids, polyhydroxyalkanoates, and specialty chemicals.
14. The method of claim 13, wherein the 4-carbon chemicals are selected from the group consisting of butyrate, n-butanol, i-butanol, 2-butanol, 2,3-butanediol, and 1,4-butanediol.
15. The method of claim 13, wherein the diacids are selected from the group consisting of oxalic, malonic, succinic, glutaric, adipic, pimelic, phthalic, isophthalic, and terephthalic.
16. The method of claim 13, wherein the 3-carbon chemicals are selected from the group consisting of propanol, propanediol, lactate, and acrylate.
17. The method of claim 13, wherein the higher carboxylic acids are selected from the group consisting of pentanoic acids and hexanoic acids.
18. The method of claim 13, wherein the specialty chemicals are selected artemisinin, vanillin, anthocyanins and resveratrol.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION OF THE INVENTION
(14) The present invention relates to engineering Escherichia coli (E. coli) or other microbes that do not naturally grow on or metabolize methanol to become methylotrophic, that is, capable of using methanol for growth as a sole substrate or co-substrate together with various carbohydrates or other carbon and energy substrates. The resulting non-naturally occurring or recombinant microbes are capable of using the reduction energy from methanol utilization to fix CO.sub.2, and produce liquid fuel and chemicals. This technology integrates all critical components required for achieving the overall goal of cost-efficient biofuel production starting from methanol (but ultimately CH.sub.4) while at the same time minimizing CO.sub.2 release.
(15) WO 2015/108777 A1 describes methanol (MeOH) utilization in FIG. 1 and Module 1 in FIG. 2 and CO.sub.2 fixation in Module 2 in FIG. 2, which may take place simultaneously to produce various chemicals and fuel molecules, for example, n-butanol (n-BuOH) from acetyl-CoA or pyruvate. The reduction energy contained in MeOH, which is more reduced than certain sugars, e.g., glucose (see reaction 1 of FIG. 2 of WO 2015/108777 A1) may be conserved under anaerobic growth conditions and used to produce various oxygenated molecules such as BuOH and at the same time fix CO.sub.2. To achieve this, genes/enzymes for the 3 modules, i.e., MeOH utilization, CO.sub.2 fixation, and product formation (e.g., n-BuOH formation) (FIG. 2 of WO 2015/108777 A1), are assembled in a microbe. Each of these goals may be carried out efficiently, and assessed for effectiveness of outcomes by different methods, for example, in terms of rates of MeOH and CO.sub.2 utilization, carbon fluxes to pyruvate or acetyl-CoA, and the engineered pathway to produce the desirable product such as n-BuOH (FIG. 2 of WO 2015/108777 A1).
(16) The present invention provides an improved approach to simultaneously use MeOH and CO.sub.2, especially under normal growing conditions (e.g., temperature) for microbes such as E. coli, to produce n-butanol (n-BuOH) or other chemicals starting with acetyl-CoA, pyruvate, or other intermediate metabolites (or chemicals) of the glycolysis pathway or pentose phosphate pathway, including but not limited to D-xylulose-5-phosphate, D-glyceraldehyde-3-phosphate and/or glycerone. This may be achieved by leveraging genes from methylotrophs for MeOH utilization (Module 1), and various genes from acetogens and other organisms for CO.sub.2 fixation (Module 2). Methylotrophic strains may be engineered by combining these two modules with n-BuOH production (Module 3) to produce a chemical or biofuel. Exemplary chemicals include 2, 3, 4, 5 and 6 carbon alcohols, carboxylic acids, ketones, aldehydes and diacids.
(17) Methanol may be used as a carbon source by conversion to formaldehyde (HCHO) by a MeOH dehydrogenase (MDH). HCHO may then be converted to hexulose-6-phosphate, using ribulose-5-phosphate, by a 3-hexulose-6-phosphate synthase (HPS). 3-Hexulose-6-phosphate isomerase (PHI) may convert the hexulose-6-phosphate to fructose-6-phosphate, which may then be used for generation of pyruvate and subsequently acetyl-CoA that may be the starting chemical to feed carbon skeletons into various synthetic pathways to produce various oxychemicals in, for example, the n-BuOH producing pathway (FIG. 2 of WO 2015/108777 A1).
(18) E. coli or the other microbes may be engineered to utilize MeOH as a carbon and energy source by expressing a MeOH dehydrogenase (MDH) and enzymes from the methylotrophic ribulose monophosphate (RuMP) pathway (e.g., HPS and PHI, FIG. 2 of WO 2015/108777). Expression of additional pentose-phosphate pathway (PPP) enzymes as an additional inventive step and strategies including suitable expression promoters may be used to enable or enhance the expression of the corresponding genes in cells when exposed to methanol and/or formaldehyde as substrates.
(19) Significantly, the present invention provides additional steps to make possible the recycling of all or most evolved CO.sub.2 from the decarboxylation of pyruvate to acetyl-CoA (FIG. 2 of WO 2015/108777 A1) aiming to minimize CO.sub.2 formation. This can be executed for other biological systems independent of MeOH utilization as long as the cells uses a carbon substrate that generates sufficient electrons available for CO.sub.2 fixation and also as long as the cells can incorporate formaldehyde into metabolic intermediates. The engineered methylotrophic E. coli or other microbes may be generated for high pathway energy efficiency, yield, and kinetics.
(20) The terms protein and polypeptide are used herein interchangeably, and refer to a polymer of amino acid residues with no limitation with respect to the minimum length of the polymer. Preferably, the protein or polypeptide has at least 20 amino acids. The definition includes both full-length proteins and fragments thereof, as well as modifications thereof (e.g., glycosylation, phosphorylation, deletions, additions and substitutions). The protein may be an enzyme involved in a biological pathway.
(21) The term polynucleotide used herein refers to a polymer of nucleotide residues with no limitation with respect to the minimum length of the polymer. Preferably, the polynucleotide has at least 60 nucleotides. The polynucleotide may be a DNA, cDNA or RNA molecule. A polynucleotide may comprise a gene encoding a desirable protein (e.g., an enzyme), optionally under control of an inducible promoter.
(22) The term variant of a protein or polynucleotide used herein refers to a polypeptide having an amino acid or nucleic acid sequence that is the same as the amino acid or nucleic acid sequence of the protein or polynucleotide except having at least one amino acid or nucleic acid modified, for example, deleted, inserted, or replaced, respectively. A variant of a protein or polynucleotide may have an amino acid or nucleic acid sequence at least about 80%, 90%, 95%, or 99%, preferably at least about 90%, more preferably at least about 95%, identical to the corresponding amino acid sequence or nucleic acid of the protein or polynucleotide.
(23) The term derived from used herein refers to the origin or source, and may include naturally occurring (i.e., native) and non-naturally occurring (i.e., recombinant) microorganisms or molecules, or variants thereof. For example, a protein derived from a microbe (e.g., a bacterium) may be identical to the corresponding native protein or a variant thereof in the microbe, for example, having an amino acid sequence at least about 70%, 80%, 90%, 95%, or 99% identical to the corresponding native protein. A gene derived from a microbe (e.g., a bacterium) may be identical to the corresponding native gene or a variant thereof in the microbe, for example, having a nucleic acid sequence at least about 80%, 90%, 95%, or 99% identical to the corresponding native gene.
(24) The term Km of an enzyme for a substrate refers to the substrate concentration that permits the enzyme to achieve half of the maximum velocity (V max) of an enzymatic reaction on the substrate by the enzyme. The Km value of an enzyme may vary depending on the nature of the substrate or the temperature of the enzymatic reaction.
(25) The present invention provides a non-naturally occurring (i.e., recombinant or synthetic) microbe capable of growing in a medium comprising methanol. The microbe comprises a heterologous polynucleotide that encodes a heterologous methanol dehydrogenase (MDH), which is derived from a Corynebacterium organism (Cor). The MDH is expressed in the microbe. The MDH exhibits a low Km for methanol.
(26) The methanol in the medium may contribute to a significant percentage of the carbon source for the non-naturally occurring microbe. The term a significant percentage of the carbon source used herein refers to that the methanol contributes to at least about 40%, 48%, 50%, 60%, 66%, 70%, 80%, 90%, 95%, 99%, or 100% of the carbon source for the non-naturally occurring microbe. Preferably, the methanol may contribute to at least about 40% of the carbon source. Methanol could be also the sole carbon source, i.e., contributing 100% of the carbon source, for the non-naturally occurring microbe. The medium may comprise methanol at a low concentration (e.g., 500, 60 or 20 mM).
(27) The term microbe used herein refers to a single cell organism. Examples of microbes include bacteria, archaea, and fungi.
(28) The non-naturally occurring microbe of the present invention may be derived from a microbe selected from the group consisting of facultative aerobic organisms, facultative anaerobic organisms, and anaerobic organisms. In particular, the non-naturally occurring microbe may be derived from a microbe in phyla Proteobacteria, Firmicutes, Actinobacteria, Cyanobacteria, Chloribi, and Deinococcus-Thermus. For example, the non-naturally occurring microbe may be derived from Escherichia, Bacillus, Clostridium, Enterobacter, Klebsiella, Enterobacteria, Mannheimia, Pseudomonas, Acinetobacter, Shewanella, Ralstonia, Geobacter, Zymomonas, Acetobacter, Geobacillus, Lactococcus, Streptococcus, Lactobacillus, Corynebacterium, Streptomyces, Propionibacterium, Synechocystis, Synechococcus, and other Cyanobacteria, Chlorobi, or Deinococcus. Preferably, the non-naturally occurring microbe of the present invention is E. coli.
(29) The term methylotrophic microbe or methylotroph used herein refers to a microbe capable of utilizing reduced one carbon compounds, such as methane and methanol, as sole growth and energy sources.
(30) The term non-methylotrophic microbe or non-methylotroph used herein refers to a microbe incapable of utilizing reduced one carbon compounds, such as methane and methanol, as sole growth and energy sources.
(31) The heterologous methanol dehydrogenase (MDH) is an enzyme capable of converting methanol to formaldehyde (HCHO). The MDH of the present invention is derived from a Corynebacterium organism (Cor) and is also referred to herein as Cor MDH. Cor MDHs provide for a better, more effective non-naturally occurring methylotroph. The Cor MDH may exhibit a Km of no more than 3, 1 or 0.1 mM for methanol at, for example, a temperature in a range from about 30 C. to about 37 C., preferably at about 30 C. The Cor MDH may exhibit a Km of at least 30, 35, 50 or 100 mM for butanol at, for example, a temperature in a range from about 30 C. to about 37 C., preferably at about 30 C.
(32) The Cor may be selected from the group consisting of Corynebacterium glutamicum, Corynebacterium sp., Corynebacterium crudilactis, Corynebacterium deserti, Corynebacterium lubricantis, Corynebacterium callunae, Corynebacterium stationis, Corynebacterium casei, Corynebacterium ammoniagenes, Corynebacterium amycolatum, Corynebacterium sp. HMSC064E07, Corynebacterium lactis, Corynebacterium sp. HMSC077G07, Corynebacterium sp. HMSC074C05, Corynebacterium humireducens, Corynebacterium resistens, Corynebacterium vitaeruminis, Corynebacterium durum, Corynebacterium ulcerans, Corynebacterium ulcerans FRC11, Corynebacterium ulcerans NCTC 12077, Corynebacterium ulcerans FRC58, Corynebacterium efficiens, Corynebacterium ulcerans 0102, Corynebacterium terpenotabidum, Corynebacterium lipophiloflavum, Corynebacterium diphtheria, Corynebacterium sp. HMSC034A01, Corynebacterium sp. HMSC034B08, Corynebacterium sp. HMSC05H05, Corynebacterium mustelae, Corynebacterium sp. HMSC04H06, Corynebacterium pseudotuberculosis, Corynebacterium sp. HMSC070H05, Corynebacterium sp. HMSC29G08, Corynebacterium sp. HMSC11D10, Corynebacterium kutscheri, Corynebacterium freiburgense, Corynebacterium pseudotuberculosis FRC41, Corynebacterium sp. HMSC067D03, Corynebacterium sp. HMSC036E10, Corynebacterium jeddahense, Corynebacterium ciconiae, Corynebacterium coyleae, Corynebacterium sputi, Corynebacterium tuscaniense, Corynebacterium sp. HMSC074A01, Corynebacterium variabile, Corynebacterium nuruki, Corynebacterium testudinoris, Corynebacterium striatum, Corynebacterium pseudodiphtheriticum, Corynebacterium sp. EPI-003-04-2554_SCH2473622, Corynebacterium sp. HMSC06C06, Corynebacterium sp. SN15, Corynebacterium propinquum, Corynebacterium sp. KPL1818, Corynebacterium sp. KPL1824, Corynebacterium timonense, Corynebacterium sp. KPL1824, Oyobacterium flavum, Oyobacterium luteum, Cryobacterium levicorallinum, Arthrobacter sp. 162MFSha1.1, Rothia sp. ND6WE1A, and Arthrobacter sp. Soil761. For example, the Cor may be Corynebacterium glutamicum (Cgl), Corynebacterium lubricantis (C. lubricantis), Corynebacterium casei (C. casei) or Corynebacterium lactis (C. lactis).
(33) In one embodiment, the Cor MDH is alcohol dehydrogenase A (AdhA) of Cgl R (CgAdhA) (GenBank Accession No. BAF55711.1) having the following amino acid sequence (SEQ ID NO: 1):
(34) TABLE-US-00001 MTTAAPQEFTAAVVEKFGHEVTVKDIDLPKPGPNQALVKVLTSGICHTDL HALEGDWPVKPEPPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSAC GTCEYCITGRETQCNEAEYGGYTQNGSFGQYMLVDTRYAARIPDGVDYLE AAPILCAGVTVYKALKVSETRPGQFMVISGVGGLGHIAVQYAAAMGMRVI AVDIADDKLELARKHGAEFTVNARNEDPGEAVQKYTNGGAHGVLVTAVHE AAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD LAEALDFFARGLIKPTVSECSLDEVNDVLDRMRNGKIDGRVAIRY.
(35) In another embodiment, the Cor MDH comprises an amino acid sequence at least about 70, 80, 90, 95 or 99% identical to SEQ ID NO: 1.
(36) The expression of the heterologous MDH may be under control of a constitutive or an inducible promoter, for example, a formaldehyde responsive promoter, a methanol inducible promoter, a lactose inducible promoter, or a temperature or pH responsive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically.
(37) The non-naturally occurring microbe of the present invention may further express one or more heterologous ribulose monophosphate (RuMP) pathway enzymes. The term ribulose monophosphate (RuMP) pathway as used herein refers to a formaldehyde assimilation pathway in a microbe, which fixes formaldehyde produced via methanol oxidation to the central metabolite ribulose-5-phosphate. Exemplary RuMP pathway enzymes include 3-hexulose-6-phosphate synthase (HPS), and 3-hexulose-6-phosphate isomerase (PHI). The heterologous RuMP pathway enzymes may be derived from any microbe, for example, M. gastri, B. brevis, B. subtilis, B. methanolicus, Methylobacillus flagellatus, or Methylomonas str. L3, or other obligate or facultative aerobic or anaerobic methylotrophs. Preferably, the RuMP pathway enzymes may be derived from the same microbe. The RuMP pathway enzymes may be expressed as a fusion protein. For example, the heterologous HPS and the heterologous PHI may be expressed as a fusion protein. The expression of any one of the heterologous RuMP pathway enzymes may be under control of a constitutive or an inducible promoter, for example, a formaldehyde responsive promoter, a lactose inducible promoter, or temperature sensitive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. In some preferred embodiments, the non-naturally occurring microbe expresses heterologous Cor MDH, heterologous HPS, and heterologous PHI.
(38) The non-naturally occurring microbe of the present invention may further express one or more heterologous pentose-phosphate pathway (PPP) enzymes. The term pentose-phosphate pathway (PPP) as used herein refers to a cyclic metabolic pathway which functions to regenerate the ribulose-5-phosphate used by the RuMP pathway. Exemplary PPP enzymes include phosphofructokinase (PFK), fructose bisphosphate aldolase (FBA), transketolase (TKT), fructose/sedoheptulose biphosphatase (GLPX), ribulose phosphate epimerase (RPE), ribose-5-phosphate isomerase (RPI) and transaldolase (TAL). The heterologous PPP enzymes (e.g., PFK, FBA, TKT, GLPX, RPE, RPI, and TAL) may be derived from any microbe, for example, any bacterium, archaeon, fungus or even animal cells as long as the genes have been optimized for expression in the host organism as is now well practiced by those skilled in the art. Preferably, the heterologous PPP enzymes are derived from the same microbe. Some or all of the PPP pathway enzymes may be expressed as a fusion protein. The expression of any one of the heterologous PPP enzymes may be under control of a constitutive or an inducible promoter, for example, a formaldehyde or methanol responsive promoter, a lactose inducible promoter, or a temperature or pH responsive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. In some preferred embodiments, the non-naturally occurring microbe expresses heterologous Cor MDH, heterologous HPS, heterologous PHI, heterologous PFK, heterologous FBA, heterologous TKT, heterologous GLPX, heterologous TAL, heterologous RPI, and heterologous RPE.
(39) The non-naturally occurring microbe of the present invention may further comprise a deletion of the frmRAB operon.
(40) The non-naturally occurring microbe of the present invention may further express heterologous cyclic formaldehyde dissimilation enzymes. Exemplary cyclic formaldehyde dissimilation enzymes include glucose-6-phosphate isomerase (PGI), glucose-6-phosphate-1-dehydrogenase (ZWF), 6-phosphogluconolactonase (PGL), and 6-phosphogluconate dehydrogenase (GND). The non-naturally occurring microbe of the present invention may contain a deletion of the phosphogluconate dehydratase gene (EDD). The heterologous cyclic formaldehyde dissimilation enzymes may be derived from any microbe. Some or all of the cyclic formaldehyde dissimilation enzymes may be expressed as a fusion protein. The expression of any one of the heterologous cyclic formaldehyde dissimilation enzymes may be under control of a constitutive or an inducible promoter, for example, a formaldehyde responsive promoter, a lactose inducible promoter, or temperature sensitive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. In some preferred embodiments, the non-naturally occurring microbe expresses heterologous Cor MDH, heterologous HPS, heterologous PHI, heterologous PFK, heterologous FBA, heterologous TKT, heterologous GLPX, heterologous TAL, heterologous RPI, heterologous RPE, heterologous PGI, heterologous ZWF, heterologous PGL, and heterologous GND.
(41) The non-naturally occurring microbe of the present invention may further express heterologous CO.sub.2 fixation pathway enzymes. The term CO.sub.2 fixation pathway as used herein refers to the ability of a microbe to utilize CO2 or it salts such as various mono and bicarbonate salts. Exemplary CO.sub.2 fixation pathway enzymes include carbonic anhydrase (CA), formate dehydrogenase (FDH), formaldehyde dehydrogenase (FLD); the enzymes of the reductive tricarboxylic acid cycle such as ATP citrate lyase (ACL), 2-oxoglutarate: ferredoxin oxidoreductase (OGOR), isocitrate dehydrogenase (ICDH), and fumarate reductase (FR); the enzymes of the glycine cleavage system such as aminomethyltransferase (AMT), dehydrolipoyl dehydrogenase (LPDH), glycine dehydrogenase (GDH); and the enzymes of the non-oxidative glycolysis pathway including fructose phosphoketolase, xylose phosphoketolase, transaldolase, transketolase, fructose 1,2-bisphosphate aldolase, fructose 1,6-bisphosphatase, ribulose-5-phosphate epimerase, ribose-5-phosphate isomerase, and trios phosphate isomerase.
(42) The heterologous CO.sub.2 fixation pathway enzymes such as carbonic anhydrase (CA) (EC 4.2.1.1), formate dehydrogenase (FDH) (EC 1.2.1.43 or EC1.2.1.2) and formaldehyde dehydrogenase (FLD) (EC 1.1.1.284) may be derived from several microbes (or host cells), for example, E. coli, acetogenic bacteria, various yeasts or even animal cells. Some or all of the heterologous CO.sub.2 fixation pathway enzymes may be expressed as a fusion protein. The expression of any one of the heterologous CO.sub.2 fixation pathway enzymes may be under control of a constitutive or an inducible promoter, for example, a formaldehyde responsive promoter, a lactose inducible promoter, or temperature sensitive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. In some preferred embodiments, the non-naturally occurring microbe expresses heterologous Cor MDH, heterologous HPS, heterologous PHI, heterologous PFK, heterologous FBA, heterologous TKT, heterologous GLPX, heterologous RPE, heterologous RPI, heterologous TAL, heterologous PGI, heterologous ZWF, heterologous PGL, heterologous GND, heterologous CA, heterologous FDH, and heterologous FLD.
(43) The non-naturally occurring microbe of the present invention may further express heterologous dihydroxyacetone synthase (DHAS, EC=2.2.1.3), which is also known as formaldehyde transketolase or glycerone synthase. Additionally, the non-naturally occurring microbe may further express heterologous dihydroxyacetone kinase (DAK, EC=2.7.1.29), which is also known as glycerone kinase. The DHAS and DAK may be derived from any microbe, for example, any methylotrophic yeast or from the bacterium Mycobacterium sp. JC1. The expression of any one of the heterologous DHAS and heterologous DAK enzymes may be under control of a constitutive or an inducible promoter, for example, a formaldehyde responsive promoter, a lactose inducible promoter, or temperature sensitive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically In some preferred embodiments, the non-naturally occurring microbe expresses heterologous Cor MDH, heterologous HPS, heterologous PHI, heterologous PFK, heterologous FBA, heterologous TKT, heterologous GLPX, heterologous TAL, heterologous RPI, heterologous RPE, heterologous PGI, heterologous ZWF, heterologous PGL, heterologous GND heterologous CA, heterologous FDH, heterologous FLD, heterologous DHAS, and heterologous DAK.
(44) The present invention provides a method for oxidizing methanol. The method comprises growing a non-naturally occurring microbe of the present invention in a medium comprising methanol.
(45) The present invention also provides a method for producing a metabolite. The method comprises growing a non-naturally occurring microbe of the present invention in a medium comprising methanol.
(46) According to the method for oxidizing methanol or the method for producing a metabolite, the non-naturally occurring microbe may be grown at a temperature of at least about 30 C. or about 37 C. In one embodiment, the non-naturally occurring microbe may be grown at a temperature in a range of about 30 C. to about 37 C. In another embodiment, the non-naturally occurring microbe may be grown at a temperature of about 30 C. In yet another embodiment, the non-naturally occurring microbe may be grown at a temperature of about 37 C.
(47) According to the method for oxidizing methanol or the method for producing a metabolite, the methanol may contribute to a significant percentage of the carbon source for the non-naturally occurring microbe. The methanol may contribute to at least about 40%, 48%, 50%, 60%, 66%, 70%, 80%, 90%, 95%, 99%, or 100% of the carbon source for the non-naturally occurring microbe. Preferably, the methanol may contribute to at least about 40% of the carbon source. More preferably, the methanol is the sole carbon source, i.e., contributing 100% of the carbon source, for non-naturally occurring microbe.
(48) According to the method for oxidizing methanol or the method for producing a metabolite, the medium may further comprise other carbon source, for example, fermentable mono, di, oligo or polysaccharides. Exemplary fermentable monosaccharides include glucose, xylose, mannose, arabinose, rhamnose, and ribose. Fermentable di- or oligosaccharides may be sucrose, lactose, maltose, cellobiose, short polymers of these mono- or di-saccharides, or long polymers of saccharides, for example, cellulose and xylan. The other carbon source may contribute to no more than about 40%, preferably no more than about 30%, more preferably no more than about 20%, most preferably no more than about 10% of the carbon source for the non-naturally occurring microbe.
(49) The metabolite may be selected from the group consisting of 4-carbon chemicals, diacids, 3-carbon chemicals, higher carboxylic acids, alcohols of higher carboxylic acids, polyhydroxyalkanoates, and specialty chemicals. The 4-carbon chemicals may be selected from the group consisting of butyrate, n-butanol, i-butanol, 2-butanol, 2,3-butanediol, and 1,4-butanediol. The diacids may be selected from the group consisting of oxalic, malonic, succinic, glutaric, adipic, pimelic, pthalic, isopthalic, and terephtlalic. The 3-carbon chemicals may be selected from the group consisting of propanol, propanediol, lactate, and acrylate. The higher carboxylic acids may be selected from the group consisting of pentanoic acids and hexanoic acids. Preferably, the metabolite is n-butanol. The specialty chemicals may include artemisinin, vanillin, anthocyanins, resveratrol, et cetera.
(50) According to the method for producing a metabolite, at least about 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%, preferably at least about 80%, of the carbon in the metabolite is derived from the methanol. In some embodiments, the metabolite is an amino acid or tricarboxylic acid (TCA) intermediate having at one or multiple carbon positions of the chemical up to the fourth position derived from the methanol. The present method may produce a desirable metabolite at about 50-100 mg.
(51) The growing conditions for the non-naturally occurring microbe may be modified to improve the metabolite production, methanol oxidization or methanol utilization. For example, the non-naturally occurring microbe may be grown anaerobically, or at a temperature of at least about 30 C. or 37 C., for example, at about 30 C., 37 C., 40 C., 45 C. or 50 C., or in a range from about 30 C. to about 37 C.
(52) A gene encoding a heterologous enzyme, for example, MDH, the RuMP pathway enzymes (e.g., HPS and PHI), the PPP pathway enzymes (e.g., PFK, FBA, TKT, TAL, GLPX, RPI, and RPE), the cyclic formaldehyde dissimilation enzymes (e.g., PGI, ZWF, PGL, and GND), the CO.sub.2 fixation pathway enzymes (e.g., CA, FDH, FLD, reductive tricarboxylic acid cycle enzymes such as ACL, OGOR, ICDH, and FR, glycine cleavage system enzymes such as AMT, LPDH, GDH, non-oxidative glycolysis pathway enzymes such as fructose phosphoketolase, xylose phosphoketolase, transaldolase, transketolase, fructose 1,2-bisphosphate aldolase, fructose 1,6-bisphosphatase, ribulose-5-phosphate epimerase, ribose-5-phosphate isomerase, and trios phosphate isomerase, DHAS, and DAK, may be modified to improve metabolite production, methanol oxidization or methanol utilization. The gene may be engineered to be under control of an inducible promoter, for example, a formaldehyde or methanol responsive promoter, a lactose inducible promoter, or a temperature or pH responsive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. The gene may also be engineered to modify the corresponding enzyme (e.g., MDH) to improve the enzyme's substrate specificity and optimal temperature in the non-naturally occurring microbe.
(53) The method for producing a metabolite may further comprise fixing CO.sub.2. The medium may be modified by containing higher levels of methanol which is more reduced than a sugar (e.g., glucose) such that more electrons may be generated under the conditions the non-naturally occurring microbe is grown. Other media modifications may also enable an enhanced availability of electrons in the cells. Such additives would be reducing agents or dyes (such as Methyl Viologen (MV) and other viologens). Such electrons may enable the non-naturally occurring microbe to grow on the medium while fixing CO.sub.2. According to this method, CO.sub.2 release may be reduced by at least about 20%, preferably by at least about 30-50%, more preferably up to about 75%.
(54) A method for making a non-naturally occurring microbe capable of growing in a medium comprising methanol is provided. The preparation method comprises expressing a heterologous methanol dehydrogenase (MDH) in a non-methylotrophic microbe. The MDH is derived from a Corynebacterium organism (Cor). The non-methylotrophic microbe comprises a heterologous polynucleotide encoding the MDH. The MDH exhibits a low Km for methanol, for example, no more than about 3, 1 or 0.1 mM at, for example, a temperature in a range from about 30 C. to about 37 C., preferably at about 30 C. The methanol may contribute to a significant percentage (e.g., at least about 40%, 48%, 50%, 60%, 66%, 70%, 80%, 90%, 95%, 99%, or 100%) of the carbon source for the non-naturally occurring microbe.
(55) The preparation method may further comprise expressing one or more heterologous ribulose monophosphate (RuMP) pathway enzymes in the non-methylotrophic microbe. The RuMP pathway enzymes may include 3-hexulose-6-phosphate synthase (HPS), 3-hexulose-6-phosphate isomerase (PHI).
(56) The preparation method may further comprise expressing one or more heterologous pentose-phosphate pathway (PPP) enzymes in the non-methylotrophic microbe. The PPP enzymes may include phosphofructokinase (PFK), fructose bisphosphate aldolase (FBA), transketolase (TKT), transaldolase (TAL) fructose/sedoheptulose biphosphatase (GLPX), ribulose phosphate epimerase (RPE), and ribose-5-phosate isomerase (RPI).
(57) The preparation method may further comprise expressing one or more heterologous cyclic formaldehyde dissimilation enzymes in the non-methylotrophic microbe. The enzymes may include glucose-6-phosphate isomerase (PGI), glucose-6-phosphate-1-dehydrogenase (ZWF), 6-phosphogluconolactonase (PGL), and 6-phosphogluconate dehydrogenase (GND). The non-naturally occurring microbe of the present invention may contain a deletion of the phosphogluconate dehydratase gene (EDD).
(58) The preparation method may further comprise expressing one or more heterologous CO.sub.2 fixation pathway enzymes in the non-methylotrophic microbe. The heterologous CO.sub.2 fixation pathway enzymes may include carbonic anhydrase (CA), formate dehydrogenase (FDH), formaldehyde dehydrogenase (FLD; the enzymes of the reductive tricarboxylic acid cycle such as ATP citrate lyase (ACL), 2-oxoglutarate: ferredoxin oxidoreductase (OGOR), isocitrate dehydrogenase (ICDH), and fumarate reductase (FR); the enzymes of the glycine cleavage system such as aminomethyltransferase (AMT), dehydrolipoyl dehydrogenase (LPDH), glycine dehydrogenase (GDH); and the enzymes of the non-oxidative glycolysis pathway including fructose phosphoketolase, xylose phosphoketolase, transaldolase, transketolase, fructose 1,2-bisphosphate aldolase, fructose 1,6-bisphosphatase, ribulose-5-phosphate epimerase, ribose-5-phosphate isomerase, and trios phosphate isomerase.
(59) The preparation method may further comprise expressing one or more heterologous dihydroxyacetone synthase (DHAS, EC=2.2.1.3) in the non-methylotrophic microbe. DHAS is also known as formaldehyde transketolase or glycerone synthase. The non-methylotrophic microbe may further express heterologous dihydroxyacetone kinase (DAK, EC=2.7.1.29). DAK is also known as glycerone kinase.
(60) The preparation method may further comprise introducing into the non-methylotrophic microbe a gene encoding any of the heterologous enzymes selected from the group consisting of the heterologous MDH, the heterologous RuMP pathway enzymes (e.g., HPS and PHI), the heterologous PPP enzymes (e.g., PFK, FBA, TKT, GLPX, TAL, RPI and RPE), the heterologous cyclic formaldehyde dissimilation pathway (PGI, ZWF, PGL, GND), the heterologous CO.sub.2 fixation pathway enzymes (e.g., CA, FDH, FLD, reductive tricarboxylic acid cycle enzymes such as ACL, OGOR, ICDH, and FR, glycine cleavage system enzymes such as AMT, LPDH, GDH, non-oxidative glycolysis pathway enzymes such as fructose phosphoketolase, xylose phosphoketolase, transaldolase, transketolase, fructose 1,2-bisphosphate aldolase, fructose 1,6-bisphosphatase, ribulose-5-phosphate epimerase, ribose-5-phosphate isomerase, and trios phosphate isomerase), heterologous DHAS, and heterologous DAK. The gene may be expressed transiently in the non-methylotrophic microbe. The gene may be integrated into the genome of the non-methylotrophic microbe. The gene may be under control of an inducible promoter, for example, a formaldehyde or methanol responsive promoter, a lactose inducible promoter, or temperature or pH responsive promoter. These promoters may be derived from a host cell (native) or exogenously, for example, the T7 phage promoter. These genes may also be under the control of non-DNA regulatory elements such as small RNA, antisense RNA, sensing RNA, temperature sensitive RNA or any combination thereof. The translation of these genes may be initiated with a range of ribosomal binding sites of varying strength. These genes may be borne on plasmids, fosmids, bacterial artificial chromosomes or be integrated into the host chromosome. These genes may be configured monocistronically or polycistronically. The non-naturally occurring microbe may also contain deletions of the fmrRAB operon and the edd gene.
(61) The term about as used herein when referring to a measurable value such as an amount, a percentage, and the like, is meant to encompass variations of 20% or 10%, more preferably 5%, even more preferably 1%, and still more preferably 0.1% from the specified value, as such variations are appropriate.
Example 1. Cgl-MDH Form a Unique Group of Methanol Dehydrogenases (MDHs) Distinct from Previously Characterized MDHs
(62) Corynebacterium glutamicum (Cgl) is a mesophilic Gram positive bacterium that possesses the ability to oxidize, but not assimilate methanol. Blast analysis using the Cgl R AdhA as template revealed the existence of 150 homologues that share at least 60 identity on the amino acid level (Table 1). Phylogenic analysis of these genes revealed that the Cgl-MDH genes are unrelated to the Bacillus methanolicus (Bme) MDHs and also form a unique grouping compared with the Bacillus stearothermophilus (Bst) MDH genes (
Example 2. Optimized Methanol Utilization in One or Sequential Bioreactors with Optimized Temperature for Optimal MDH Activity
(63) Thermodynamic calculations show a positive change in reduction potential and negative change in reaction Gibbs free energy when calculated using estimated physiological conditions (Table 2). This suggests that MeOH oxidation via NAD-dependent MDH enzymes becomes more favorable at higher temperatures, i.e., the optimal growth temperature of 45-55 C. of these thermophilic Bacillus methylotrophs. Specifically, the change in the reaction Gibbs free energy (.sub.rG) decreases from 1.0 to 2.9 kJ/mol as the temperature increases from 37 to 55 C., suggesting a more favorable reaction at higher temperatures. This further demonstrates that MeOH oxidation via NAD-dependent MDH enzymes is plausible under the physiological growth conditions of mesophiles such as E. coli. As MeOH oxidation via NAD-dependent MDH enzymes is favorable only to a small extent under physiological conditions compared with the other methanol oxidation systems, the immediate consumption of HCHO via an assimilation pathway will increase the favorability of MeOH oxidation. For example, at 37 C., when the concentration of HCHO is lowered from 0.17 to 0.017 mM, the change in the reaction Gibbs free energy decreases from 1.0 to 7.0 kJ/mol while the equilibrium constant shifts from 0.925 to 8.5, thus becoming much more favorable. Therefore, increased methanol oxidation within synthetic methylotrophic organisms may be achieved by keeping the intracellular HCHO concentration at very low levels, likely through its immediate consumption via a HCHO assimilation pathway.
(64) Importantly, the aforementioned and cloned Cgl-family MDHs, are sourced from organisms that are natively mesophilic and are typically cultivated at 30 C. As demonstrated in
Example 3. Cgl-Family MDH Exhibit Greater Specificity Towards Methanol than Higher Order Alcohols
(65) We have performed in vivo MDH activity assays comparing the Cgl MDH with the previously described Bst MDH for substrate specificity. Cells were suspended in minimal media containing either 500 mM MeOH only, or a mixture of 500 mM MeOH and 50 mM n-BuOH. MDH activity was assessed by measuring formaldehyde (HCHO) production over time (
Example 4. Growth on Methanol and Biomass Labeling from .SUP.13.C Methanol of an E. coli Strain Carrying Plasmid pETM6PtacCgl_MDH/Bm_RuMP
(66) Growth dynamics of recombinant Escherichia coli expressing Corynebacterium glutamicum R (Cgl R) alcohol dehydrogenase A (AdhA), Bacillus methanolicus MGA3 (Bme) hexulose phosphate synthase (HPS) and Bacillus methanolicus MGA3 (Bme) hexulose phosphate isomerase (PHI). Cells were grown in minimal media containing 1 gram per liter of yeast extract and supplemented with methanol as a co-substrate. As illustrated in
Example 5. Cloning the Complete Ribulose Monophosphate (RuMP) Pathway in E. coli
(67) Given the previous data, it appears that in order for E. coli to be able to utilize methanol without stimulation additional carbon sources, it must be able to regenerate ribulose-5-phosphate (Ru5P) in order to utilize the RuMP pathway. To achieve this goal, we were inspired by the methylotrophic organism Bacillus methanolicus, which utilizes the RuMP pathway for growth on MeOH. In this organism, growth on MeOH is plasmid dependent, as these organisms harbor a plasmid that carries an mdh gene as well as five homologues of the pentose phosphate pathway genes (pfk, phosphofructokinase; fba, fructose bisphosphate aldolase; tkt, transketolase; glpX, fructose/sedoheptulose biphosphatase; rpe, ribulose phosphate epimerase). When the strain is cured of the plasmid, it loses the ability to grow on methanol. This has been shown to be due to the loss of the five PPP homologues instead of loss of the MDH. Thus, we hypothesize that expression of the five genes from B. methanolicus in E. coli along with expression of MDH, HPS, and PHI will allow for the cells to regenerate ribulose-5-phosphate and thus grow utilizing methanol as the sole carbon and energy source. To that end, we had the five genes from synthesized and optimized for expression in E. coli. We integrated the five heterologous genes into the chromosome of E. coli in two operons; one operon contained rpe and tkt and the other operon contained fba, glpX and pfk. Cells were grown in minimal media containing 1 gram per liter of yeast extract and supplemented with methanol as a co-substrate. As illustrated in
(68) 5.a. Genes for Metabolic Engineering to Enable E. coli to Grow Effectively on MeOH
(69) Methanol will be used as a carbon source by conversion to HCHO by a MeOH dehydrogenase (MDH). HCHO will then be converted to hexulose-6-phosphate, using ribulose-5-phosphate, by a hexulose phosphate synthase (HPS). Hexulose phosphate isomerase (PHI) will convert the hexulose-6-phosphate to fructose-6-phosphate, which can then be used for pyruvate generation that can be fed into the n-BuOH producing pathway (FIG. 2 of WO 2015/108777). There is strong experimental evidence supporting functionality of these genes, individually, in E. coli.
(70) While we have previously demonstrated the MDH from Bacillus stearothermophilus can effectively oxidize methanol in recombinant E. coli, we anticipate issues with this enzyme will arise during the production of butanol. We have observed that the presence of butanol significantly decreases the ability of this enzyme to oxidize methanol. Therefore, we aim to employ MDH belonging the aforementioned Cgl-family. We have demonstrated these enzymes to be active in E. coli and also exhibit reduced sensitivity to the presence of butanol. Additionally, we propose protein engineering to increase the V max of these enymzes for MeOH, which we hypothesize will increase the rate of methanol oxidation/assimilation.
(71) The next two enzymes, HPS and PHI, have also been successfully cloned into E. coli. Cell extracts of E. coli containing an expression plasmid with the Bacillus subtilis hps and phi genes were used to show good activity for these enzymes. Furthermore, .sup.13C NMR demonstrated that HCHO was incorporated into hexulose-6-phosphate and fructose-6-phosphate. In addition, the hps and phi cluster from B. brevis S1 was cloned into E. coli to demonstrate good HPS and PHI activities. More recently, a gene coding for an HPS-PHI fusion from Mycobacterium gastri MB19 was expressed in E. coli and cells were able to metabolize HCHO added to the culture and continue growing. We have also included the Methylococcus capsulatus MCA2738 gene that is annotated to have HPS and PHI activities, as another option to investigate. Combined, these data strongly suggest that expression of MDH, HPS and PHI expression in E. coli is feasible and can facilitate the formation of F6P from MeOH through HCHO via the RuMP pathway. We will first express these genes alone, test in vitro activities, choose the genes that lead to the two highest activities and then express these genes combinatorially aiming to identify at least 2 combinations of the 3 genes that give the best growth on MeOH prior to pursuing Tasks 3 and 4. Effectiveness is assessed by the rate of growth on MeOH and final densities (by optical density (OD) measurements), as well as rates of MeOH utilization (by GC and/or HPLC). We will also examine metabolites (acetate, ethanol, higher carboxylic acids; by HPLC) that will likely be produced anaerobically until we engineer this module into the n-BuOH producing strain. Strategies for expressing these genes are discussed below. The Gibson assembly method enables quick plasmid construction for screening to identify the best genes and the best combinations.
(72) 5.b. Integrate Optimized Modules 1, 2 and 3 (FIG. 2 of WO 2015/108777) to Achieve Effective MeOH Utilization, CO2 Fixation and n-BuOH Formation.
(73) The assembled Modules 1 and 2 (FIG. 2 of WO 2015/108777) will be optimized to achieve high rates of MeOH and CO.sub.2 utilization and n-BuOH formation. The goal is to integrate and further optimize these pathways by combing the best of these into a single strain that does not produce BuOH and later after some testing, into a BuOH producing strain. We will then employ chemical mutagenesis and strain evolution to achieve better growth on MeOH, CO.sub.2 fixation and n-BuOH production. BuOH producing strain contains several gene deletions aiming to enhance the electron availability for BuOH production under anaerobic conditions. The strain then expresses a clostridial pathway for n-BuOH, with the genes expressed from co-existing plasmids. With the additional genes (FIG. 2 of WO 2015/108777) that will be needed here, we will need to integrate several of the genes from Modules 1 and 3 (FIG. 2 of WO 2015/108777) and possibly from the BuOH-formation pathway into the chromosome. What will be integrated will be based on mRNA expression levels that we will measure by qRT-PCR. We have employed chromosomal integrations of multiple genes into the E. coli genome using the lambda-red system, so we will use these methods for chromosomal integration of genes. Strains that combine all 3 modules (FIG. 2 of WO 2015/108777) will be tested for growth on MeOH, CO.sub.2 fixation and BuOH production. A few of the best performing strains will be evolved through chemical mutagenesis and fast transfer for faster growth on MeOH anaerobically under a CO.sub.2 and also H.sub.2 atmosphere (3 atm) is serum vials used to grow acetogens on gas mixtures of CO.sub.2/CO/H.sub.2. The CO.sub.2 and H.sub.2 pressure is to stimulate CO.sub.2 uptake under a reducing environment and is meant to simulate the large-scale process where a large CO.sub.2 pressure will be built during the anaerobic fermentation. A few of the best performing strains with gene integrations and accumulated mutations will be sequenced by the new PacBio technology. The goal will be to examine the mutations that improve the phenotype.
Example 6. Bioenergetic and Pathway Analysis
(74) 6.a. Conversion of Methanol to Acetyl-CoA and Butanol
(75) We will engineer E. coli cells to utilize MeOH as a carbon and energy source in an engineered RuMP pathway. To meet ARPA-E yield and energy efficiency we will use CO.sub.2 recycling by Schemes 1 or 2 (or 3 if necessary) (FIG. 2 of WO 2015/108777). In Scheme 1, CO.sub.2 is reduced to formate and then HCHO (rxn 2 of FIG. 2 of WO 2015/108777) that can be assimilated through the RuMP pathway. Scheme 2 utilizes the rTCA cycle. Backup Scheme 3 uses the glycine cleavage pathway via the glycine synthase. While Schemes 2 and 3 are not as ATP efficient (see rxn 3 of FIG. 2 of WO 2015/108777) as Scheme 1, ATP hydrolysis improves the overall thermodynamic outlook of CO.sub.2 fixation. Maximum theoretical yields were calculated per ARPA-E instructions for the engineered RuMP pathway with CO.sub.2 recycling through either Scheme 1, 2 or 3 (Table 4). In both cases (Scheme 1; Scheme 2 or 3), the calculated yields outperform the energy efficiency and carbon yield metrics of >64% and >67%, respectively, even if we assume that 80% (our target) of theoretically possible CO.sub.2 is fixed (in fact ca. 67% of the theoretically possible CO.sub.2 fixation would suffice).
(76) 6.b. The Rate of Product Formation
(77) For producing n-BuOH, we will employ the recently reported system, which produces ca. 30 g/L n-BuOH, but at a rate <1 g/gCDW/h. To meet the latter rate, we will need to optimize all 3 modules (FIG. 2 of WO 2015/108777). We will first aim to achieve fluxes to acetyl-CoA that supports high fluxes of product formation for products synthesized through Acetyl-CoA. Then, we will assess the bottlenecks in Module 3 (BuOH synthesis) by relating flux data to mRNA levels of key genes to examine if gene expression of certain genes is limiting the flux. Based on flux data, mRNA data and enzyme assays, we will identify the steps that limit the overall rate, and will use an iterative optimization process to achieve the most efficient strain and process.
(78) TABLE-US-00002 TABLE 1 Organisms containing NAD.sup.+-dependent MDHs with similar identity to Corynebacterium glutamicum R (Cgl R) alcohol dehydrogenase A (AdhA). Methanol Dehydrogenase [Organism] Identity zinc-dependent alcohol dehydrogenase [Corynebacterium glutamicum] 100% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 99% alcohol dehydrogenase [Corynebacterium glutamicum] 99% alcohol dehydrogenase AdhP [Corynebacterium glutamicum] 99% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 99% Zn-dependent alcohol dehydrogenase [Corynebacterium glutamicum] 98% MULTISPECIES: alcohol dehydrogenase [Corynebacterium] 99% zinc-dependent alcohol dehydrogenase [Corynebacterium glutamicum] 99% zinc-dependent alcohol dehydrogenase [Corynebacterium glutamicum] 98% zinc-dependent alcohol dehydrogenase [Corynebacterium glutamicum] 98% zinc-dependent alcohol dehydrogenase [Corynebacterium crudilactis] 96% zinc-dependent alcohol dehydrogenase [Corynebacterium deserti] 97% zinc-dependent alcohol dehydrogenase [Corynebacterium lubricantis] 90% zinc-dependent alcohol dehydrogenase [Corynebacterium callunae] 91% zinc-dependent alcohol dehydrogenase [Corynebacterium stationis] 90% zinc-dependent alcohol dehydrogenase [Corynebacterium casei] 88% zinc-dependent alcohol dehydrogenase [Corynebacterium ammoniagenes] 87% alcohol dehydrogenase [Corynebacterium stationis] 87% zinc-dependent alcohol dehydrogenase [Corynebacterium casei] 87% zinc-dependent alcohol dehydrogenase [Corynebacterium amycolatum] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC064E07] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium lactis] 81% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 81% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 81% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC077G07] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC074C05] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium humireducens] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium resistens] 80% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium vitaeruminis] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium durum] 78% Alcohol dehydrogenase GroES-like protein [Corynebacterium ulcerans] 78% Alcohol dehydrogenase GroES-like protein [Corynebacterium ulcerans FRC11] 78% Alcohol dehydrogenase GroES-like protein [Corynebacterium ulcerans] 78% alcohol dehydrogenase [Corynebacterium ulcerans NCTC 12077] 78% Alcohol dehydrogenase GroES-like protein [Corynebacterium ulcerans] 78% Alcohol dehydrogenase GroES-like protein [Corynebacterium ulcerans FRC58] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium ulcerans] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium ulcerans] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium ulcerans] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium efficiens] 79% alcohol dehydrogenase [Corynebacterium ulcerans 0102] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium terpenotabidum] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium lipophiloflavum] 79% zinc-dependent alcohol dehydrogenase [Corynebacterium diphtheriae] 81% zinc-dependent alcohol dehydrogenase [Corynebacterium diphtheriae] 81% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC034A01] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC034B08] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC05H05] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium mustelae] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC04H06] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium pseudotuberculosis] 76% alcohol dehydrogenase AdhP [Corynebacterium diphtheriae] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC070H05] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC29G08] 76% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium diphtheriae] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium pseudotuberculosis] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC11D10] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium diphtheriae] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium kutscheri] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium diphtheriae] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium freiburgense] 77% alcohol dehydrogenase [Corynebacterium pseudotuberculosis FRC41] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC067D03] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC036E10] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium jeddahense] 75% zinc-dependent alcohol dehydrogenase [Corynebacterium ciconiae] 79% alcohol dehydrogenase, propanol-preferring [Corynebacterium coyleae] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sputi] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium pseudotuberculosis] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium tuscaniense] 76% alcohol dehydrogenase AdhP [Corynebacterium diphtheriae] 80% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC074A01] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium variabile] 78% alcohol dehydrogenase AdhP [Corynebacterium pseudotuberculosis] 75% zinc-dependent alcohol dehydrogenase [Corynebacterium nuruki] 78% zinc-dependent alcohol dehydrogenase [Corynebacterium testudinoris] 77% Alcohol dehydrogenase [Corynebacterium striatum] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium pseudodiphtheriticum] 76% MULTISPECIES: alcohol dehydrogenase [Corynebacterium] 77% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 77% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. EPI-003-04- 76% 2554_SCH2473622] zinc-dependent alcohol dehydrogenase [Corynebacterium sp. HMSC06C06] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. SN15] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium pseudodiphtheriticum] 76% zinc-dependent alcohol dehydrogenase [Corynebacterium propinquum] 73% MULTISPECIES: zinc-dependent alcohol dehydrogenase [Corynebacterium] 73% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. KPL1818] 73% hypothetical protein HMPREF1267_01835 [Corynebacterium sp. KPL1824] 74% zinc-dependent alcohol dehydrogenase [Corynebacterium timonense] 73% zinc-dependent alcohol dehydrogenase [Corynebacterium sp. KPL1824] 73% alcohol dehydrogenase, propanol-preferring [Cryobacterium flavum] 70% alcohol dehydrogenase, propanol-preferring [Cryobacterium luteum] 71% alcohol dehydrogenase, propanol-preferring [Cryobacterium levicorallinum] 69% zinc-dependent alcohol dehydrogenase [Arthrobacter sp. 162MFSha1.1] 71% zinc-dependent alcohol dehydrogenase [Rothia sp. ND6WE1A] 68% alcohol dehydrogenase [Arthrobacter sp. Soil761] 71%
(79) TABLE-US-00003 TABLE 2 Reaction Gibbs energies (.sub.rG), equilibrium constants (K.sub.eq), and change in reduction potential () for MeOH redox reactions calculated through eQuilibrator software. Standard conditions were 25 C., 1 bar, pH 7.0, 0.1 M ionic strength, and 1 mM species concentrations. Physiological conditions were the indicated temperatures, 1 bar, pH 7.6, 0.1 M ionic strength, 1250 mM MeOH, 0.17 mM HCHO, 2.6 mM NAD, 0.083 mM NADH. Data were calculated from the following equations: .sub.rG = n(23,064), where n represents the number of electrons transferred,
(80) TABLE-US-00004 TABLE 3 MDH in vitro enzyme kinetics. Km (mM) Vmax (mol/min .Math. mg) MeOH EtOH n-PrOH n-BuOH MeOH EtOH n-PrOH n-BuOH Cgl AdhA 3 6.8 7.5 35 0.7 7.8 7.7 8.9 Bst Mdh 20 0.08 0.02 0.01 2.1 Bme Mdh3 200 0.07 2 3.5 2.3
(81) TABLE-US-00005 TABLE 4 Bioenergetic and pathway analysis. CO.sub.2 fixation Scheme 1 Scheme 2 or 3 CH.sub.4 Act. Scheme* I II III.sup.# IV I II III.sup.# IV Methane 100.0 100.0 100.0 100.0 100.0 100.0 100.0 100.0 CO.sub.2 0.0 16.7 33.3 33.3 0.0 16.7 33.3 0.0 NAD(P)H 0.0 0.0 0.0 0.0 0.0 0.0 0.0 100.0 ATP 50.0 41.7 33.3 66.7 0.0 16.7 33.3 0.0 Butanol 25.0 20.8 16.7 33.3 25.0 20.8 16.7 25.0 Energy Efficiency 77% 64% 51% 102% 77% 64% 51% 77% Carbon Yield 100% 83% 67% 133% 100% 83% 67% 100% *See FIG. 1 of WO 2015/108777 and text for CH.sub.4 activation schemes.
*See FIG. 1 of WO 2015/108777 and text for CH.sub.4 activation schemes.
(82) All documents, books, manuals, papers, patents, published patent applications, guides, abstracts, and/or other references cited herein are incorporated by reference in their entirety. Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with the true scope and spirit of the invention being indicated by the following claims.