VARIANT THIOESTERASES AND METHODS OF USE
20200131544 ยท 2020-04-30
Inventors
- David Davis (South San Francisco, CA)
- Scott Franklin (Woodside, CA)
- Jeffrey L. Moseley (Redwood City, CA)
- Riyaz Bhat (South San Francisco, CA)
Cpc classification
C12P7/6463
CHEMISTRY; METALLURGY
C12N15/8247
CHEMISTRY; METALLURGY
International classification
C12P7/64
CHEMISTRY; METALLURGY
C12N15/82
CHEMISTRY; METALLURGY
Abstract
The present invention relates to variant thioesterases and their use in plants, e.g., to increase enzymatic activity and to promote increased production of mid-chain length fatty acids (e.g., 8 to 14 carbons) and at desired ratios. Further disclosed herein are methods of manufacturing renewable chemicals through the manufacture of novel triglyceride oils followed by chemical modification of the oils. Oils containing fatty acid chain lengths of C8, C10, C12 or C14 are also disclosed and are useful as feedstocks in the methods described herein.
Claims
1.-12. (canceled)
13. An oleaginous microalgal cell expressing a non-natural FATB enzyme, wherein the non-natural FATB enzyme has at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 45 and compared to a parent FATB enzyme comprises the amino acid substitutions A at the position corresponding to position 171 of SEQ ID NO: 45 (V193), and A or V at the position corresponding to position 86 of SEQ ID NO: 45 (G108), and wherein expression of the non-natural FATB enzyme increases C18:0 fatty acids in the fatty acid profile of the oil produced by the cell relative to a corresponding cell expressing the parent FATB enzyme.
14. The oleaginous microalgal cell expressing a non-natural protein according to claim 13, further wherein the non-natural protein comprises A or V at the position corresponding to position 89 of SEQ ID NO: 45 (S111).
15. The oleaginous microalgal cell expressing a non-natural protein according to claim 13, further wherein the non-natural protein comprises A at the position corresponding to position 89 of SEQ ID NO: 45 (S111).
16. An oleaginous microalgal cell expressing a non-natural FATB enzyme, wherein the non-natural FATB enzyme has at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 45 and compared to a parent FATB enzyme comprises the amino acid substitutions A at the position corresponding to position 171 of SEQ ID NO: 45 (V193), and A at the position corresponding to position 86 of SEQ ID NO: 45 (G108), and wherein expression of the non-natural FATB enzyme increases C18:0 fatty acids in the fatty acid profile of the oil produced by the cell relative to a corresponding cell expressing the parent FATB enzyme.
17. The oleaginous microalgal cell expressing a non-natural protein according to claim 16, further wherein the non-natural protein comprises A or V at the position corresponding to position 89 of SEQ ID NO: 45 (S111).
18. The oleaginous microalgal cell expressing a non-natural protein according to claim 17, wherein the non-natural protein comprises A at the position corresponding to position 89 of SEQ ID NO: 45 (S111).
19. The oleaginous microalgal cell according to claim 13, wherein the oleaginous microalgal cell is a Prototheca cell.
20. The oleaginous microalgal cell according to claim 19, wherein the cell is a Prototheca moriformis cell.
21. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 13; and isolating the oil.
22. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 14; and isolating the oil.
23. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 15; and isolating the oil.
24. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 16; and isolating the oil.
25. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 17; and isolating the oil.
26. A method for producing a triglyceride oil, the method comprising cultivating an oleaginous microalgal cell according to claim 18; and isolating the oil.
27. An oil obtainable in the method of claim 21, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
28. An oil obtainable in the method of claim 22, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
29. An oil obtainable in the method of claim 23, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
30. An oil obtainable in the method of claim 24, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
31. An oil obtainable in the method of claim 25, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
32. An oil obtainable in the method of claim 26, wherein the fatty acid profile of the oil is increased in C18:0 fatty acids relative to an oil produced by a corresponding cell expressing the parent FATB enzyme.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0043]
[0044]
[0045]
DETAILED DESCRIPTION
Introduction
[0046] In illustrative embodiments, variant FATB acyl-ACP thioesterases described herein allow for control over acyl-ACP thioesterase substrate specificity. As a result, host cells expressing the acyl-ACP thioesterases produce oils with altered fatty acid profiles. In certain embodiments host cells expressing the variant acyl-ACP thioesterases produce triglyceride-rich cell oils with fatty acid profiles characterized by elevated mid chain fatty acids such as C8:0, C10:0, C12:0, and C14:0 fatty acids. A specific embodiment includes providing a FATB acyl-ACP thioesterase gene, mutating the gene so as to alter the amino acids in the gene product at the positions corresponding to H163 and/or L186 of the reference Cuphea hookeriana FATB2 gene (SEQ ID NO: 1). Optionally, the H163 and/or L186 mutant is combined with a mutation at M228.
[0047] As described in more detail in Example 1, by expressing such variant FATB2 genes, stably integrated in the nucleus of oleaginous plastidic cells, we produced strains that exceeded wildtype ChFATB2 expressing control strains in terms of C8:0, C8:10 or the sum of C8:0 and C10:0 production, including strains that produced oils with fatty acid profiles where the C8 and C10 production exceed 9, 11, 14, or 18% of the profile. In the latter case, the C8+C10 (i.e., the sum of C8:0 and C10:0 production in the fatty acid profile as determined by FAME-GC with FID detection) level was more than doubled relative to the approximately 8% C8+C10 of the wildtype ChFATb2 strain. Specific variants with improved C8+C10 production include those with P, K, or A at the 186 position; Y or F at the 163 position, or combinations thereof such as 186P/163Y, 186P/163F, 186K/163Y, 186K/163F, 186A/163Y or 186A/163F. Of the double mutants, we found that the H163Y/L186P variant produced an oil having particularly high concentrations of C8+C10. Using single or double variants, the C8:0 fatty acid profile percentages can be increased by 50, 60, 70, 80, 100% or more relative to a control strain expressing wildtype ChFATB2; e.g. to more than 2, 2.5, 3, or 3.5% of the fatty acid profile vs. 1.5% for the control (see Example 1).
[0048] The double mutants listed above can also be combined with a third mutation corresponding to 230 of Cuphea palustris FATB1. For many FATB genes such as Cuphea hookeriana FATB2 and Cuphea avigera FATB1, this residue corresponds to residue 228. For example, an M228K mutation in Cuphea hookeriana FATB2 expressed in an oleaginous eukaryotic microalga increased the C8/C10 ratio in the fatty acid profile of the oil from about 0.25 to about 1.0. Mutations at this position to Iso, Val, Phe, and Leu, Ala, or Thr in combination with the single or double mutants at positions 186 and 163 discussed above, can also be advantageous.
[0049] Although Cuphea hookeriana FATB2 was used as a model system, the methods of making the above-discussed mutations, methods of expressing these in an oleaginous cell, and methods of producing oil with these variants can be applied to any acyl-ACP thioesterase gene, including those having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 1, or the fragment of SEQ ID NO: 1 lacking the transit peptide.
[0050] Although these variant genes were discovered using a eukaryotic microalgal expression system, the genes are more generally useful in ways that are known in the art, including their expression in higher plants to produced altered triglyceride oils. When incorporated into an oleaginous cell (e.g., of an oilseed plant, algae (e.g., microalgae)) the variant thioesterases can alter the fatty acid profiles of the cell to produce novel or more economical high-value commercial products.
[0051] The single, double or triple mutants can be used to produce an oil with a high ratio of C8:0 to C10:0 fatty acids. For example, the C8/10 ratio can be equal to or greater than 0.3, 0.5, 0.7, 0.9, 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, or 3.0.
[0052] The embodiments also encompass the residual biomass from such cells after oil extraction, oleochemicals, fuels and food products made from the oils and methods of cultivating the cells. In varying embodiments, the cells are microalgal cells, including heterotrophic or obligate heterotrophic cells, and cells classified as Chlorophyta, Trebouxiophyceae, Chlorellales, Chlorellaceae, or Chlorophyceae. The cells can also be plant cells or cells of macroalgae. Host cells having a type II fatty acid synthesis pathway are preferred. Although the examples given below use the Trebouxiophyte Prototheca moriformis as a host cell, the genes, constructs and methods disclosed may also find use in oilseed crops. Methods for introducing these genes into such crops such as soybean, corn, rapeseed, safflower, sunflower and others are known in the art; see, for example, U.S. Pat. Nos. 6,331,664, 5,512,482, 5,455,167, 5,667,997. Examples of oleochemicals include surfactants and solvents made from fatty acids or oils.
[0053] Accordingly, in an embodiment, provided is a non-natural protein, an isolated gene encoding the non-natural protein, an expression cassette expressing the non-natural protein, or a host cell comprising the expression cassette, wherein the non-natural protein has at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 1 and comprises Y or F at the position corresponding to position 163 of SEQ ID NO: 1 and/or P, K, or A at the position corresponding to position 186 of SEQ ID NO: 1, and optionally K at the position corresponding to position 228 of SEQ ID NO: 1.
[0054] In a related embodiment, there is a method for producing a triglyceride oil. The method includes expressing, in a host cell, the protein of mentioned immediately above, or a protein comprising at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity one of SEQ ID NOs: 3-8 that has Y or F at the position corresponding to position 163 of SEQ ID NO: 1 and/or P, K, or A at the position corresponding to position 186 of SEQ ID NO: 1, and optionally K at the position corresponding to position 228 of SEQ ID NO: 1. The method further includes cultivating the host cell and isolating the oil.
[0055] In another embodiment, provided is a method for increasing the C8 and/or C10 fatty acids in a fatty acid profile of an oil produced by an optionally oleaginous host cell. The method includes, providing a parent gene encoding a FATB enzyme, mutating the gene to so as to have Y or F at the position corresponding to position 163 of SEQ ID NO: 1 and/or P, K, or A at the position corresponding to position 186 of SEQ ID NO: 1, and optionally K at the position corresponding to position 228 of SEQ ID NO: 1. The method further includes expressing the mutated gene in the host cell and producing the oil. The fatty acid profile of the oil is thereby increased in C8 and/or C10 fatty acids relative to the parent gene. Optionally, the gene encoding the FATB enzyme encodes a protein with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 1, 13 or 14.
[0056] As detailed in Example 3, compared to prior art work in E. Coli, the discovery of the advantage of using Ala, or Thr at position 230 of Cpal FATB1 (SEQ ID NO: 13) of in terms of C8+C10 production and/or increased C8/C10 ratio, is new and unexpected. These novel mutations are useful alone, in combination with a mutation at position 163 including the C8-favoring mutations disclosed herein, in combination with a mutation at position 186 including the C8-favoring mutations disclosed herein, or in combination with a double mutation at positions 163 and 186 including the C8-favoring mutations disclosed herein. Accordingly, in an embodiment, there is a non-natural protein, an isolated gene encoding the non-natural protein, an expression cassette expressing the non-natural protein, or a host cell comprising the expression cassette, wherein the non-natural protein has at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 13 and A or K at the position corresponding to position 230 of SEQ ID NO: 13. A method for producing an oil includes expressing, in a host cell, the non-natural proteins described herein, cultivating the cell, and isolating the oil.
Variant Acyl-ACP Thioesterases
[0057] The variant TEs can be used in genetic constructs and genetically engineered oleaginous cells (e.g., plants, algae, microalgae) with one or more exogenous genes to produce fatty acids, acylglycerides, or derivatives thereof. For example, microalgae or oilseed crops that would naturally, or through genetic modification, produce high levels of lipids can be engineered (or further engineered) to express an exogenous variant fatty acyl-ACP thioesterase, which can facilitate the cleavage of fatty acids from acyl carrier protein (ACP) during fatty acid synthesis. The fatty acids synthesized may be incorporated into acyl glycerides including triacylglycerides (TAGs, triglycerides). The TAGs can be recovered or, through further enzymatic processing within the cell, or in vitro, yield other useful compounds.
[0058] In an embodiment, the variant fatty acyl-ACP thioesterases are designed based on the desired specificity for a growing (during fatty acid synthesis) fatty acyl group having a particular carbon chain length. A specificity domain is selected based on its preference for a particular fatty acyl ACP substrate and/or for its ability to influence, increase and/or promote the production of fatty acids of a desired carbon chain length. Generally, the variant fatty acyl-ACP thioesterases have preferential substrate specificity for mid-chain ACP-fatty acyl substrates (e.g., to liberate C8, C10, C12, and/or C14 fatty acids). In varying embodiments, the specificity domain in the N-terminus of the acyl-ACP thioesterase is heterologous (e.g., due to point mutations and/or domain swapping) to the C-terminal catalytic domain. In certain embodiments, the fatty acid chain length substrate specificity and/or preference of the specificity domain and the catalytic domain is the same or within 1-2 carbons. For example, in varying embodiments, the variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprises:
Codon-Optimization for Expression
[0059] DNA encoding a polypeptide to be expressed in a microorganism, e.g., a variant acyl-ACP thioesterase and selectable marker can be codon-optimized cDNA. Methods of recoding genes for expression in microalgae are described in U.S. Pat. No. 7,135,290. Additional information for codon optimization is available, e.g., at the Codon Usage Database at kazusa.or.jp/codon/. The table for Prototheca preferred codon usage is also provided in U.S. Patent Publ. No. 2012/0283460, Table 1 of which is hereby incorporated herein by reference.
Expression and Targeting to Plastids
[0060] Proteins expressed in the nuclear genome of Prototheca can be targeted to the plastid using plastid targeting signals. Plastid targeting sequences endogenous to Chlorella are known, such as genes in the Chlorella nuclear genome that encode proteins that are targeted to the plastid; see for example GenBank Accession numbers AY646197 and AF499684, and in one embodiment, such control sequences are used in the vectors described herein, e.g., to target expression of a protein to a Prototheca plastid.
[0061] The Examples below describe the use of algal plastid targeting sequences to target heterologous proteins to the correct compartment in the host cell. cDNA libraries were made using Prototheca moriformis and Chlorella protothecodies cells and are described in the Examples of U.S. Patent Publ. No. 2012/0283460 and in PCT Application No. PCT/US2009/066142. Amino acid sequences of the algal plastid targeting sequences identified from the cDNA libraries useful plastid targeting of recombinantly expressed variant acyl-ACP thioesterases are provided in U.S. Patent Publ. No. 2012/0283460 and herein. In varying embodiments, the plastid transit peptide comprises an amino acid sequence selected from the group consisting of
TABLE-US-00001 (SEQIDNO:58) MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRA, (SEQIDNO:59) SGPRRPARPLPVR, (SEQIDNO:60) SGPRRPARPLPVRAAIASEVPVATTSPR, (SEQIDNO:61) RPARPLPVRGRA, (SEQIDNO:62) RPARPLPVRAAIASEVPVATTSPR, (SEQIDNO:63) RCGDLRRSAGSGPRRPARPLPVRGRA, (SEQIDNO:64) RCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPR, (SEQIDNO:65) PARPLPVR, (SEQIDNO:66) PARPLPVRAAIASEVPVATTSPR, (SEQIDNO:67) RRPARPLPVR, and (SEQIDNO:68) RRPARPLPVRAAIASEVPVATTSPR.
[0062] Where novel FATB variants are disclosed here, it will be understood that a variety of heterologous plastid transit peptides can be used. In other words, the non-targeting peptide domain is more highly conserved. Accordingly, embodiments described herein feature the novel FATB enzymatic domain with or without a plastid targeting sequence. For example, where a percent identity to a novel FATB gene is given herein, the same identity can be applied (where specified) to the same sequence absent the targeting peptide. A substitute targeting peptide can optionally be used in connection with such a sequence.
Host CellsOil- or Lipid-Producing Microorganisms
[0063] Any species of organism that produces suitable lipid and/or hydrocarbon can be used, although microorganisms that naturally produce high levels of suitable lipid and/or hydrocarbon are preferred. Production of hydrocarbons by microorganisms is reviewed by Metzger et al. Appl Microbiol Biotechnol (2005) 66: 486-496 and A Look Back at the U.S. Department of Energy's Aquatic Species Program: Biodiesel from Algae, NREUTP-580-24190, John Sheehan, Terri Dunahay, John Benemann and Paul Roessler (1998).
[0064] Considerations for the selection of microorganisms include, in addition to production of suitable lipids or hydrocarbons for production of oils, fuels, and oleochemicals: (1) high lipid content as a percentage of cell weight; (2) ease of growth; (3) ease of genetic engineering; and (4) ease of biomass processing. In particular embodiments, the wild-type or genetically engineered microorganism yields cells that are at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70% or more lipid. Preferred organisms grow heterotrophically (on sugars in the absence of light) or can be engineered to do so using, for example, methods disclosed herein. The ease of transformation and availability of selectable markers and promoters, constitutive or inducible, that are functional in the microorganism affect the ease of genetic engineering. Processing considerations can include, for example, the availability of effective means for lysing the cells.
[0065] A. Algae
[0066] In one embodiment, the microorganism is a microalgae. Nonlimiting examples of microalgae that can be used for expression of variant acyl-ACP thioestesterases include, e.g., Achnanthes orientalis, Agmenellum, Amphiprora hyaline, Amphora coffeiformis, Amphora coffeiformis linea, Amphora coffeiformis punctata, Amphora coffeiformis taylori, Amphora coffeiformis tenuis, Amphora delicatissima, Amphora delicatissima capitata, Amphora sp., Anabaena, Ankistrodesmus, Ankistrodesmus falcatus, Boekelovia hooglandii, Borodinella sp., Botryococcus braunii, Botryococcus sudeticus, Bracteococcus minor, Bracteococcus medionucleatus, Carteria, Chaetoceros gracilis, Chaetoceros muelleri, Chaetoceros muelleri subsalsum, Chaetoceros sp., Chlorella anitrata, Chlorella Antarctica, Chlorella aureoviridis, Chlorella candida, Chlorella capsulate, Chlorella desiccate, Chlorella ellipsoidea, Chlorella emersonii, Chlorella fusca, Chlorella fusca var. vacuolata, Chlorella glucotropha, Chlorella infusionum, Chlorella infusionum var. actophila, Chlorella infusionum var. auxenophila, Chlorella kessleri, Chlorella lobophora (strain SAG 37.88), Chlorella luteoviridis, Chlorella luteoviridis var. aureoviridis, Chlorella luteoviridis var. lutescens, Chlorella miniata, Chlorella minutissima, Chlorella mutabilis, Chlorella nocturna, Chlorella ovalis, Chlorella parva, Chlorella photophila, Chlorella pringsheimii, Chlorella protothecoides (including any of UTEX strains 1806, 411, 264, 256, 255, 250, 249, 31, 29, 25), Chlorella protothecoides var. acidicola, Chlorella regularis, Chlorella regularis var. minima, Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella saccharophila, Chlorella saccharophila var. ellipsoidea, Chlorella salina, Chlorella simplex, Chlorella sorokiniana, Chlorella sp., Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii, Chlorella vulgaris, Chlorella vulgaris f. tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris var. vulgaris f. tertia, Chlorella vulgaris var. vulgaris f. viridis, Chlorella xanthella, Chlorella zofingiensis, Chlorella trebouxioides, Chlorella vulgaris, Chlorococcum infusionum, Chlorococcum sp., Chlorogonium, Chroomonas sp., Chrysosphaera sp., Cricosphaera sp., Crypthecodinium cohnii, Cryptomonas sp., Cyclotella cryptica, Cyclotella meneghiniana, Cyclotella sp., Dunaliella sp., Dunaliella bardawil, Dunaliella bioculata, Dunaliella granulate, Dunaliella maritime, Dunaliella minuta, Dunaliella parva, Dunaliella peircei, Dunaliella primolecta, Dunaliella salina, Dunaliella terricola, Dunaliella tertiolecta, Dunaliella viridis, Dunaliella tertiolecta, Eremosphaera viridis, Eremosphaera sp., Ellipsoidon sp., Euglena, Franceia sp., Fragilaria crotonensis, Fragilaria sp., Gleocapsa sp., Gloeothamnion sp., Hymenomonas sp., Isochrysis aff galbana, Isochrysis galbana, Lepocinclis, Micractinium, Micractinium (UTEX LB 2614), Monoraphidium minutum, Monoraphidium sp., Nannochloris sp., Nannochloropsis salina, Nannochloropsis sp., Navicula acceptata, Navicula biskanterae, Navicula pseudotenelloides, Navicula pelliculosa, Navicula saprophila, Navicula sp., Nephrochloris sp., Nephroselmis sp., Nitschia communis, Nitzschia alexandrina, Nitzschia communis, Nitzschia dissipata, Nitzschia frustulum, Nitzschia hantzschiana, Nitzschia inconspicua, Nitzschia intermedia, Nitzschia microcephala, Nitzschia pusilla, Nitzschia pusilla elliptica, Nitzschia pusilla monoensis, Nitzschia quadrangular, Nitzschia sp., Ochromonas sp., Oocystis parva, Oocystis pusilla, Oocystis sp., Oscillatoria limnetica, Oscillatoria sp., Oscillatoria subbrevis, ParaChlorella kessleri, Pascheria acidophila, Pavlova sp., Phagus, Phormidium, Platymonas sp., Pleurochrysis carterae, Pleurochrysis dentate, Pleurochrysis sp., Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, Prototheca zopfii, PseudoChlorella aquatica, Pyramimonas sp., Pyrobotrys, Rhodococcus opacus, Sarcinoid chrysophyte, Scenedesmus armatus, Schizochytrium, Spirogyra, Spirulina platensis, Stichococcus sp., Synechococcus sp., Tetraedron, Tetraselmis sp., Tetraselmis suecica, Thalassiosira weissflogii, and Viridiella fridericiana.
[0067] Illustrative host cells feature oleaginous cells that produce altered fatty acid profiles and/or altered regiospecific distribution of fatty acids in glycerolipids, and products produced from the cells. Examples of oleaginous cells include microbial cells having a type II lipid biosynthesis pathway, including plastidic oleaginous cells such as those of oleaginous algae. Specific examples of cells include heterotrophic or obligate eukaryotic heterotophic microalgae of the phylum Chlorpophya, the class Trebouxiophytae, the order Chlorellales, or the family Chlorellacae. Examples of oleaginous microalgae are provided in Published PCT Patent Applications WO2008/151149, WO2010/06032, WO2011/150410, and WO2011/150411, including species of Chlorella and Prototheca, a genus comprising obligate heterotrophs. The oleaginous cells can be, for example, capable of producing 25%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, or about 90% oil by cell weight, +5%. The above mentioned publications also disclose methods for cultivating such cells and extracting oil, especially from microalgal cells; such methods are applicable to the cells disclosed herein. In any of the embodiments described herein, the cells can be heterotrophic cells comprising an exogenous invertase gene so as to allow the cells to produce oil from a sucrose feedstock.
[0068] Illustrative embodiments of host cells include recombinant oleaginous cells expressing one or more exogenous genes encoding fatty acid biosynthesis enzymes. As a result, some embodiments feature cell oils never before obtainable in a cell oil. In some cases, the cell oils were not obtainable from a non-plant or non-seed oil, or not obtainable at all.
[0069] The oleaginous cells produce a storage oil, which may be stored in storage vesicles of the cell. A raw cell oil may be obtained from the cells by disrupting the cells and isolating the oil. The oils produced may be refined, bleached and deodorized (RBD) as known in the art or as described in WO2010/120939. The raw or RBD oils may be used in a variety of food, chemical, and industrial products or processes. After recovery of the oil, a valuable residual biomass remains. Uses for the residual biomass include the production of paper, plastics, absorbents, adsorbents, as animal feed, for human nutrition, or for fertilizer.
[0070] Where a fatty acid profile of a triglyceride cell oil is given, it will be understood that this refers to a nonfractionated sample of the storage oil extracted from the cell analyzed under conditions in which phospholipids have been removed or with an analysis method that is substantially insensitive to the fatty acids of the phospholipids (e.g. using chromatography and mass spectrometry). Because the cells are oleaginous, in some cases the storage oil will constitute the bulk of all the TAGs in the cell.
[0071] In varying embodiments, the host cell is a plastidic cell, e.g., a heterotrophic microalgae of the phylum Chlorpophya, the class Trebouxiophytae, the order Chlorellales, or the family Chlorellacae. In varying embodiments, the cell is oleaginous and capable of accumulating at least 40% oil by dry cell weight. The cell can be an obligate heterotroph, such as a species of Prototheca, including Prototheca moriformis or Prototheca zopfii. The nucleic acid encoding the variant acyl-ACP TEs described herein can also be expressed in autotrophic algae or plants. Optionally, the cell is capable of using sucrose to produce oil and a recombinant invertase gene may be introduced to allow metabolism of sucrose, as described in PCT Publications WO2008/151149, WO2010/06032, WO2011/150410, WO2011/150411, and international patent application PCT/US12/23696. The invertase may be codon optimized and integrated into a chromosome of the cell, as may all of the genes mentioned here. Codon usage for different algal and plant species of interest is known in the art and can be found, e.g., on the internet at the Codon Usage Database at kazusa.or.jp/codon/.
[0072] The polynucleotides encoding the variant acyl-ACP TEs described herein further can be expressed in a wide variety of plant host cells. Of particular interest are plant cells of plants involved in the production of vegetable oils for edible and industrial uses, including e.g., temperate oilseed crops. Plants of interest include, but are not limited to, grapeseed (Canola and High Erucic Acid varieties), sunflower, safflower, cotton, Cuphea, soybean, peanut, coconut and oil palms, and corn. See, U.S. Pat. Nos. 5,850,022; 5,723,761; 5,639,790; 5,807,893; 5,455,167; 5,654,495; 5,512,482; 5,298,421; 5,667,997; and U.S. Pat. Nos. 5,344,771; 5,304,481.
Oils with Non-Naturally Occurring Fatty Acid Profiles
[0073] Oils disclosed herein are distinct from other naturally occurring oils that are high in mid-chain fatty acids, such as palm oil, palm kernel oil, and coconut oil. For example, levels of contaminants such as carotenoids are far higher in palm oil and palm kernel oil than in the oils described herein. Palm and palm kernel oils in particular contain alpha and beta carotenes and lycopene in much higher amounts than is in the oils described herein. In addition, over 20 different carotenoids are found in palm and palm kernel oil, whereas the Examples demonstrate that the oils described herein contain very few carotenoids species and very low levels. In addition, the levels of vitamin E compounds such as tocotrienols are far higher in palm, palm kernel, and coconut oil than in the oils described herein.
[0074] Generally, Prototheca strains have very little or no fatty acids with the chain length C8-C14. For example, Prototheca strains Prototheca moriformis (UTEX 1435), Prototheca krugani (UTEX 329), Prototheca stagnora (UTEX 1442) and Prototheca zopfii (UTEX 1438) produce no (or undetectable amounts) C8 fatty acids, between 0-0.01% C10 fatty acids, between 0.03-2.1% C12 fatty acids and between 1.0-1.7% C14 fatty acids.
[0075] In some cases, the oleaginous cells (e.g., Prototheca strains) containing a transgene encoding a variant fatty acyl-ACP thioesterase has a fatty acid profile characterized by 5-10%, 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, or 90-99% C8, C10, C12, or C14 fatty acids. In other cases, the Prototheca strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrates of chain length C12 and C14 and produces fatty acids of the chain length C12 and the chain length C14 at a ratio of 1:1+/20%.
[0076] In some instances, keeping the transgenic Prototheca strains under constant and high selective pressure to retain exogenous genes is advantageous due to the increase in the desired fatty acid of a specific chain length. High levels of exogenous gene retention can also be achieved by inserting exogenous genes into the nuclear chromosomes of the cells using homologous recombination vectors and methods disclosed herein. Recombinant cells containing exogenous genes integrated into nuclear chromosomes are also contemplated.
[0077] Microalgal oil can also include other constituents produced by the microalgae, or incorporated into the microalgal oil from the culture medium. These other constituents can be present in varying amount depending on the culture conditions used to culture the microalgae, the species of microalgae, the extraction method used to recover microalgal oil from the biomass and other factors that may affect microalgal oil composition. Non-limiting examples of such constituents include carotenoids, present from 0.1-0.4 micrograms/ml, chlorophyll present from 0-0.02 milligrams/kilogram of oil, gamma tocopherol present from 0.4-0.6 milligrams/100 grams of oil, and total tocotrienols present from 0.2-0.5 milligrams/gram of oil.
[0078] The other constituents can include, without limitation, phospholipids, tocopherols, tocotrienols, carotenoids (e.g., alpha-carotene, beta-carotene, lycopene, etc.), xanthophylls (e.g., lutein, zeaxanthin, alpha-cryptoxanthin and beta-crytoxanthin), and various organic or inorganic compounds.
[0079] In some cases, the oil extracted from Prototheca species comprises no more than 0.02 mg/kg chlorophyll. In some cases, the oil extracted fromPrototheca species comprises no more than 0.4 mcg/ml total carotenoids. In some cases the Prototheca oil comprises between 0.40-0.60 milligrams of gamma tocopherol per 100 grams of oil. In other cases, the Prototheca oil comprises between 0.2-0.5 milligrams of total tocotrienols per gram of oil.
[0080] Oils produced from host cells expressing a variant acyl-ACP thioesterase will have an isotopic profile that distinguishes it, e.g., from blended oils from other sources. The stable carbon isotope value 13C is an expression of the ratio of 13C/12C relative to a standard (e.g. PDB, carbonite of fossil skeleton of Belemnite americana from Peedee formation of South Carolina). The stable carbon isotope value 13C (0/00) of the oils can be related to the 13C value of the feedstock used. In some embodiments the oils are derived from oleaginous organisms heterotrophically grown on sugar derived from a C4 plant such as corn or sugarcane. In some embodiments, the 13C (0/00) of the oil is from 10 to 17 0/00 or from 13 to 16 0/00.
[0081] In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a specificity domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana), and a catalytic domain from a C12-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea wrightii or Umbellularia californica) produces an oil comprising at least about 10% C12:0 fatty acids, and at least about 10% C14:0 fatty acids.
[0082] In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a modified specificity domain of a first acyl-ACP thioesterase having one or both His163.fwdarw.Tyr or Leu186.fwdarw.Pro substitutions (or at positions corresponding to His163.fwdarw.Tyr or Leu186.fwdarw.Pro of SEQ ID NO:61), and a catalytic domain of a second acyl-ACP thioesterase produces an oil comprising at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C8:0 fatty acids or at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C10:0 fatty acids or a C8:0/C10:0 ratio that is at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more. As appropriate, the specificity domain can be derived from a C8:0-, C10:0- or a C12:0-preferring acyl-ACP thioesterase and independently the catalytic domain can be derived from a C8:0-, C10:0- or a C12:0-preferring acyl-ACP thioesterase. The specificity domain and the catalytic domain can be from the same or different acyl-ACP thioesterases. In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a modified specificity domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana having one or both His163.fwdarw.Tyr or Leu186.fwdarw.Pro substitutions), and a catalytic domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana) produces an oil comprising at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C8:0 fatty acids or at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C10:0 fatty acids or a C8:0/C10:0 ratio that is at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more.
[0083] In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a specificity domain from a C14-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cinnamomum camphorum), and a catalytic domain from a C12-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea wrightii or Umbellularia californica) produces an oil comprising C12:0 fatty acids and C14:0 fatty acid at an approximate 1:1 ratio; e.g, a ratio of 1:1+/20%.
[0084] Further, host cells expressing a variant acyl-ACP thioesterase comprising 5 or more amino acid residues extending from the C-terminus of a linker domain positioned N-terminal to the hydrophobic domain, produce an oil comprising relatively elevated mid-chain length fatty acids (e.g., C8:0, C10:0, C12:0, C14:0) in comparison to host cells expressing the same acyl-ACP thioesterase without a linker domain. In varying embodiments, host cells expressing a variant acyl-ACP thioesterase comprising 5 or more amino acid residues extending from the C-terminus of a linker domain positioned N-terminal to the hydrophobic domain, produce an oil comprising mid-chain length fatty acids increased by at least 1-fold, 2-fold, 3-fold, or more, in comparison to host cells expressing the same acyl-ACP thioesterase without a linker domain.
[0085] In a specific embodiment, a recombinant cell comprises nucleic acids operable to express a product of an exogenous gene encoding a variant acyl-ACP thioesterase exogenous gene encoding an active acyl-ACP thioesterase that catalyzes the cleavage of mid-chain fatty acids from ACP. As a result, in one embodiment, the oil produced can be characterized by a fatty acid profile elevated in C8, C10, C12, and/or C14 fatty acids and reduced in C16, C18, and C18:1 fatty acids as a result of expression of the recombinant nucleic acids. In varying embodiments, the increase in C8, C10, C12, and/or C14 fatty acids is greater than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, from 75-85%, from 70-90%, from 90-200%, from 200-300%, from 300-400%, from 400-500%, or greater than 500%.
[0086] In some embodiments, an additional genetic modification to increase the level of mid-chain fatty acids in the cell or oil of the cell includes the expression of an exogenous lysophosphatidic acid acyltransferase gene encoding an active lysophosphatidic acid acyltransferase (LPAAT) that catalyzes the transfer of a mid-chain fatty-acyl group to the sn-2 position of a substituted acylglyceroester. In a specific related embodiment, both an exogenous acyl-ACP thioesterase and LPAAT are stably expressed in the cell. As a result of introducing recombinant nucleic acids into an oleaginous cell (and especially into a plastidic microbial cell) an exogenous mid-chain-specific thioesterase and an exogenous LPAAT that catalyzes the transfer of a mid-chain fatty-acyl group to the sn-2 position of a substituted acylglyceroester, the cell can be made to increase the percent of a particular mid-chain fatty acid in the triacylglycerides (TAGs) that it produces by 10, 20 30, 40, 50, 60, 70, 80, 90-fold, or more. Introduction of the exogenous LPAAT can increase mid-chain fatty acids at the sn-2 position by 1, 2, 3, 4 fold or more compared to introducing an exogenous mid-chain preferring acyl-ACP thioesterase alone. In an embodiment, the mid-chain fatty acid is greater than 30, 40, 50 60, 70, 80, or 90% of the TAG fatty acids produced by the cell. In various embodiments, the mid-chain fatty acid is capric, caprylic, lauric, myristic, and/or palmitic.
[0087] In varying embodiments, the gene encoding an lysophosphatidic acid acyltransferase (LPAAT) is selected from the group consisting of Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. AEE85783), Brassica juncea 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. ABQ42862), Brassica juncea 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. ABM92334), Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. CAB09138), Chlamydomonas reinhardtii lysophosphatidic acid acyltransferase (GenBank Accession No. EDP02300), Cocos nucifera lysophosphatidic acid acyltransferase (GenBank Acc. No. AAC49119), Limnanthes alba lysophosphatidic acid acyltransferase (GenBank Accession No. EDP02300), Limnanthes douglasii 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) (GenBank Accession No. CAA88620), Limnanthes douglasii acyl-CoA: sn-1-acylglycerol-3-phosphate acyltransferase (GenBank Accession No. ABD62751), Limnanthes douglasii 1-acylglycerol-3-phosphate O-acyltransferase (GenBank Accession No. CAA58239), Ricinus communis 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. EEF39377).
[0088] Alternately, or in addition to expression of an exogenous LPAAT, the cell may comprise recombinant nucleic acids that are operable to express an exogenous KASI or KASIV enzyme and optionally to decrease or eliminate the activity of a KASII, which is particularly advantageous when a mid-chain-preferring acyl-ACP thioesterase is expressed. Engineering of Prototheca cells to overexpress KASI and/or KASIV enzymes in conjunction with a mid-chain preferring acyl-ACP thioesterase can generate strains in which production of C10-C12 fatty acids is at least about 40% of total fatty acids, e.g., at least about 45%, 50%, 55%, 60% or more, of total fatty acids. Mid-chain production can also be increased by suppressing the activity of KASI and/or KASII (e.g., using a knockout or knockdown). Chromosomal knockout of different alleles of Prototheca moriformis (UTEX 1435) KASI in conjunction with overexpression of a mid-chain preferring acyl-ACP thioesterase can achieve fatty acid profiles that are at least about 60% C10-C14 fatty acids, e.g., at least about 65%, 70%, 75%, 80%, 85% or more C10-C14 fatty acids. Elevated mid-chain fatty acids can also be achieved as a result of expression of KASI RNA hairpin polynucleotides. In addition to any of these modifications, unsaturated or polyunsaturated fatty acid production can be suppressed (e.g., by knockout or knockdown) of a SAD or FAD enzyme.
[0089] In an embodiment, one of the above described high mid-chain producing cells is further engineered to produce a low polyunsaturated oil by knocking out or knocking down one or more fatty acyl desaturases. Accordingly, the oil produced has high stability.
[0090] The high mid-chain oils or fatty acids derived from hydrolysis of these oils may be particularly useful in food, fuel and oleochemical applications including the production of lubricants and surfactants. For example, fatty acids derived from the cells can be esterified, cracked, reduced to an aldehyde or alcohol, aminated, sulfated, sulfonated, or subjected to other chemical process known in the art.
[0091] The invention, having been described in detail above, is exemplified in the following examples, which are offered to illustrate, but not to limit, the claimed invention.
EXAMPLES
[0092] The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1: Mutagenesis of Cuphea hookeriana FATB2
[0093] We modified the activity and specificity of a FATB2 thioesterase originally isolated from Cuphea hookeriana (Ch FATB2, accession U39834), using site directed mutagenesis of H163 and L186 within the enzymatic core (H163 and L186 within Ch FATB2.).
[0094] For the above examples, an expression construct was used that targeted the FATB variants and selection markers to the Thi4 (thiamine biosynthesis) locus. An antibiotic resistance gene was used to select for resistance to G418 antibiotic. The UAPA promoter was used to drive FATB. The construct is exemplifided in SEQ ID NO: 9.
[0095] As disclosed in PCT/US2014/013676 we discovered that grafting the Cuphea avigera FATB1 (Ca FATB1) N-terminal specificity domain (
[0096] The His at position 163 within the Ch FATB2 (
[0097] Thirty-eight individual Ch FATB2 variants were generated and their effect on C8:0 and C10:0 fatty acid accumulation was quantified. Transformants with C8-C10 sum within 3 standard deviations above the wild-type Ch FATB2 control(D3598) were classified as positive and those within 3 standard deviations below were scored as negative. See Table 1. The remaining transformants were classified as neutral. As shown in Table 1, Prototheca moriformis transformed with six of the Ch FATB2 mutants (D3570, D3573, D3582, D3584, D3588, and D3599) accumulated C8:0-C10:0 fatty acids within 3 standard above transformants expressing the wild type Ch FATB2 (D3598) control.
TABLE-US-00002 TABLE 1 Analysis of FATB varaiants for C8-C14 fatty acid productionin P. moriformis.* Ch FABT2 variant C8:0 C10:0 C12:0 C14:0 C8-C10sum D3565-186V average 1.82 6.86 0.20 1.64 8.68 STDEV 0.28 0.76 0.02 0.05 1.04 D3566-186Y average 1.94 7.17 0.22 1.72 9.11 STDEV 0.45 1.11 0.03 0.08 1.56 D3567-186W (negative) average 0.78 3.98 0.16 1.66 4.76 STDEV 0.06 0.20 0.05 0.02 0.26 D3568-186T average 1.78 7.00 0.21 1.61 8.78 STDEV 0.38 0.89 0.02 0.06 1.27 D3569-186S average 1.85 7.05 0.20 1.61 8.9 STDEV 0.32 0.75 0.02 0.06 1.07 D3570-186P (positive) average 2.86 8.68 0.25 1.65 11.54 STDEV 0.25 0.61 0.02 0.05 0.86 D3571-186F average 1.46 5.98 0.19 1.62 7.44 STDEV 0.32 0.78 0.02 0.06 1.1 D3572-186M average 1.48 6.13 0.18 1.59 7.61 STDEV 0.23 0.46 0.01 0.03 0.69 D3573-186K(positive) average 2.62 8.74 0.23 1.54 11.36 STDEV 0.66 1.33 0.03 0.05 1.99 D3574-186I average 1.56 6.35 0.18 1.63 7.91 STDEV 0.26 0.55 0.01 0.04 0.81 D3575-186H average 1.97 7.38 0.19 1.60 9.35 STDEV 0.29 0.58 0.01 0.03 0.87 D3576-186G average 1.41 5.83 0.18 1.70 7.24 STDEV 0.25 0.69 0.02 0.07 0.94 D3577-186E average 2.14 7.91 0.21 1.68 10.05 STDEV 0.54 1.29 0.03 0.08 1.83 D3578-186Q average 2.07 7.69 0.20 1.61 9.76 STDEV 0.46 0.96 0.02 0.06 1.42 D3579-186C average 0.95 4.77 0.16 1.60 5.72 STDEV 0.07 0.23 0.01 0.03 0.3 D3580-186N average 2.25 7.93 0.21 1.55 10.18 STDEV 0.33 0.79 0.02 0.04 1.12 D3581-186R average 2.21 7.74 0.22 1.63 9.95 STDEV 0.73 1.90 0.04 0.07 2.63 D3582-186A(positive) average 2.39 8.74 0.23 1.58 11.13 STDEV 0.78 1.94 0.04 0.06 2.72 D3603-186D average 1.91 7.02 0.19 1.54 8.93 STDEV 0.41 1.14 0.02 0.05 1.55 D3583-163V(negative) average 0.00 0.12 0.03 1.89 0.12 STDEV 0.00 0.07 0.04 0.21 0.07 D3584-163Y(positive) average 3.71 10.52 0.30 1.61 14.23 STDEV 0.92 1.75 0.04 0.04 2.67 D3585-163W average 1.11 4.88 0.18 1.67 5.99 STDEV 0.12 0.28 0.01 0.04 0.4 D3586-163T(negative) average 0.00 0.01 0.01 1.78 0.01 STDEV 0.00 0.03 0.02 0.13 0.03 D3587-163P(negative) average 0.00 0.01 0.01 1.84 0.01 STDEV 0.00 0.03 0.03 0.14 0.03 D3588-163F(positive) average 3.79 10.82 0.31 1.59 14.61 STDEV 0.54 0.77 0.01 0.03 1.31 D3589-163K(negative) average 0.00 0.01 0.06 1.79 0.01 STDEV 0.00 0.02 0.01 0.07 0.02 D3590-163L average 1.95 7.49 0.20 1.66 9.44 STDEV 0.38 1.15 0.03 0.08 1.53 D3591-163I(negative) average 0.06 0.70 0.07 1.74 0.76 STDEV 0.02 0.15 0.01 0.11 0.17 D3592-163G(negative) average 0.00 0.01 0.06 1.81 0.01 STDEV 0.00 0.02 0.01 0.03 0.02 D3593-163E(negative) average 0.00 0.02 0.06 1.99 0.02 STDEV 0.01 0.05 0.02 0.20 0.06 D3594-163Q(negative) average 0.06 0.69 0.07 1.74 0.75 STDEV 0.05 0.36 0.01 0.06 0.41 D3595-163C(negative) average 0.00 0.02 0.01 1.80 0.02 STDEV 0.00 0.05 0.02 0.17 0.05 D3596-163R(negative) average 0.00 0.01 0.01 1.92 0.01 STDEV 0.00 0.04 0.02 0.36 0.04 D3597-163A(negative) average 0.00 0.00 0.01 1.72 0 STDEV 0.00 0.00 0.03 0.14 0 D3600-163S12 (negative) average 0.00 0.00 0.02 1.74 0 STDEV 0.00 0.00 0.03 0.12 0 D3601-163M(negative) average 0.02 0.76 0.02 1.75 0.78 STDEV 0.05 0.16 0.04 0.15 0.21 D3602-163N(negative) average 0.00 0.00 0.01 1.74 0 STDEV 0.00 0.00 0.02 0.07 0 D3609-163D(negative) average 0.00 0.00 0.01 1.80 0 STDEV 0.00 0.00 0.02 0.15 0 D3598- wild type average 1.52 6.55 0.19 1.60 8.07 Ch FATB2 STDEV 0.19 0.62 0.02 0.11 0.81 D3599- H163Y, average 5.77 12.50 0.39 1.73 18.27 L186P(positive) STDEV 0.63 0.99 0.03 0.05 1.62 *12 transformants were screened per mutant. The length of lipid production unde low lintrogen conditions was 3 days.
[0098] In summary, we have shown that it is possible to increase activity and shift profile specificity within C8-C10 specific FATB thioesterases derived from Cuphea hookeriana by using site directed mutagenesis of H163 and L186 within the N-terminal specificity domain. We found cells expressing variants that exceeded the parent ChFATB2 sequence in terms of sum of C8:0+C10:0 prodiction including strains that produced oils with fatty acid profiles where the C8 and C10 production exceed 9, 11, 14, of the profile.
Example 2: Identification of Double Mutants in FATB
[0099] Based on the demonstrated ability to modify the activity and specificity of a FATB2 thioesterase originally isolated from Cuphea hookeriana (Ch FATB2, accession U39834), using site directed mutagenesis of H163 and L186 a second round of mutagenesis was initiated. Six constructs combining the positive mutations from Rdl (C8+C10 within 3 standard deviations above the wild-type Ch FATB2 control (D3598)) were generated (Table 2).
TABLE-US-00003 TABLE 2 Beneficial Mutations Constructs 1) 163Tyr 186Lys 2) 163Tyr 186Ala 3) 163Phe 186Pro 4) 163Phe 186Lys 5) 163Phe 186Ala
[0100] For the above examples, an expression construct was used that targeted the FATB variants and selection markers to the Thi4 (thiamine biosynthesis) locus. An antibiotic resistance gene was used to select for resistance to G418 antibiotic. The UAPA promoter was used to drive FATB. The construct is exemplifided in SEQ ID NO: 9.
[0101] Five individual Ch FATB2 variants were generated and their effect on C8:0 and C10:0 fatty acid accumulation was quantified. Transformants with C8-C10 sum within 3 standard deviations above the wild-type Ch FATB2 control (D3598) were classified as positive (Table 3) and those within 3 standard deviations below were scored as negative (Table 3). The remaining transformants were classified as neutral. As shown in Table 3, Prototheca moriformis transformed with three of the Ch FATB2 mutants (D3875, D3876, and D3885) accumulated C8:0-C10:0 fatty acids within 3 standard above transformants expressing the wild type Ch FATB2 (D3598) control.
TABLE-US-00004 TABLE 3 Ch FABT2 variant C8:0 C10:0 C12:0 C14:0 C8-C10sum D3875-163F, 186A average 4.66 12.40 0.34 1.61 19.02 (positive) STDEV 1.27 2.39 0.05 0.19 3.73 D3876-163F,186K average 5.25 13.12 0.36 1.55 20.28 (positive) STDEV 1.19 2.05 0.05 0.03 3.31 D3877-163F, 186P average 0.00 0.00 0.00 1.90 1.90 (negative) STDEV 0.00 0.00 0.00 0.28 0.28 D3884-163Y, 186A average 4.29 11.69 0.32 1.52 17.81 STDEV 0.58 1.06 0.03 0.04 1.69 D3885-163Y, 186K average 5.39 13.14 0.36 1.49 20.38 (positive) STDEV 1.31 2.18 0.05 0.03 3.52 D3598- wild type average 1.14 5.72 0.15 1.56 8.57 Ch FATB2 STDEV 0.27 0.77 0.06 0.05 1.12 D3599- H163Y, average 5.65 12.91 0.39 1.74 20.69 L186P STDEV 1.29 2.06 0.06 0.02 3.42
Example 3: Mutations at FATB Position 230
[0102] In the example below, we demonstrate the ability to modify the activity and specificity of three FATB thioesterases originally isolated from Cuphea hookeriana (Ch FATB2, Uniprot accession U39834), Cuphea palustris (Cpal FATB1, Uniprot accession Q39554, SEQ ID NO: 13) and Cuphea avigera FATB1 (Ca FATB1 accession R4J2L6, SEQ ID NO: 14) using site directed mutagenesis of a conserved Met within the enzymatic core (M230 within Cpal FATB1).
[0103] It has recently been reported that substitution of the conserved M230 within the Cpal FATB1 with Iso, Val, Phe or Leu will increase the enzymatic activity of this thioesterase. Because these results were obtained using E. coli, we performed a similar screen to see if the results could be reproduced when expressed in Prototheca moriformis microalgae. The wild-type and thirteen Cpal FATB1 M230 mutants were generated and their effect on C8:0 fatty acid accumulation quantified. As shown in Table 4, Prototheca moriformis transformed with six of the Cpal FATB1 M230 mutants (D3206, D3208, D3211, D3212, D3214, and D3215) exhibited fatty acid profiles that were similar to the non-transformed S6165 host algal strain which likely is due to the mutation inactivating the Cpal FATB1 enzyme. In contrast, Prototheca moriformis transfomants expressing one of the remaining seven Cpal FATB1 M230 mutants accumulated C8:0 fatty acids to varying degrees above the non-transformed S6165 host. D3213 (M230P) was less effective than the wild-type Cpal FATB1 transformants (D3004), while D3207 (M230L) exhibited the same C8:0 fatty acid levels as the wild-type Cpal FATB1. D3210 (M230A), D3216 (M230T), and D3217 (M230F) all accumulated 1-1.5% more C8:0 than the wild-type D3004. Finally, D3132 (M2301) and D3209 (M230V) exhibited a 4 fold increase in C8:0 levels compared to the D3004 wild-type. While these results share some similarity with the published data derived from expression in E. coli, there are some notable exceptions. For example, unlike in E. coli, substitution of M230 with Leu did not improve C8:0 fatty acid accumulation compared to the wild-type Cpal FATB1. In addition, replacing the M230 with an Ala or Thr increased C8:0 accumulation relative to the wild-type Cpal FATB1, which was not expected based on the E. coli based screen.
TABLE-US-00005 TABLE 4 Impact on fatty acid profiles upon expression of the wild-type Cpal FATB1 or the indicated mutant within the P. moriformis algal strain S6165. Transformant C8:0 C10:0 C12:0 C14:0 Wild-type Cpal FATB1 - average 3.67 0.52 0.21 1.43 D3004 median 2.98 0.44 0.19 1.45 M230I - D3132 average 13.04 1.66 0.40 1.13 median 12.13 1.53 0.37 1.15 M230K - D3206 average 0.01 0.01 0.06 1.46 median 0.00 0.00 0.06 1.45 M230L - D3207 average 3.32 0.44 0.55 1.54 median 3.45 0.44 0.56 1.53 M230G - D3208 average 0.05 0.01 0.07 1.58 median 0.07 0.00 0.07 1.58 M230V - D3209 average 14.13 1.96 0.81 1.36 median 14.31 1.97 0.80 1.36 M230A - D3210 average 4.06 0.35 0.47 1.82 median 3.92 0.34 0.45 1.80 M230R - D3211 average 0.00 0.02 0.06 1.43 median 0.00 0.00 0.06 1.44 M230H - D3212 average 0.00 0.05 0.10 1.49 median 0.00 0.05 0.09 1.47 M230P - D3213 average 1.78 0.54 1.24 2.85 median 1.65 0.52 1.20 2.77 M230D - D3214 average 0.00 0.03 0.05 1.50 median 0.00 0.03 0.05 1.50 M230E - D3215 average 0.00 0.00 0.05 1.49 median 0.00 0.00 0.05 1.46 M230T - D3216 average 5.83 0.57 0.39 1.48 median 5.77 0.57 0.40 1.52 M230F - D3217 average 5.75 0.97 0.93 1.78 median 5.24 0.91 0.89 1.77 S6165 parent 0 0 0 1.50 Data shown is the average and median of 12-24 individual transformants for each Cpal FATB1 expression construct.
[0104] Due to the discrepancies in outcome between the E. coli and P. moriformis expression, we explored the consequence of generating mutants at the parallel position within C8-C10 specific FATB thioesterases derived from C. hookeriana (Ch FATB2) and C. avigera (Ca FATB1).
[0105] In summary, we have shown that the conclusions drawn from the e. coli expression screen only partially agrees with our data derived from expressing the Cpal FATB1 mutants in our P. moriformis platform. In addition, the phenotypes observed upon substitution of the same amino acid position within the Ch FATB2 and Ca FATB1 are not what would have been expected based on the original e. coli expression screen. Our results demonstrate that the expression platform and the thioesterase influence the outcome of a mutagenesis study.
Example 4
[0106] In addition to the results shown in Table 3 we discovered that Prototheca moriformis transfomants expressing Ch FATB2 H163Y, L186P, and 230K (D3599) mutants exhibited a shift in fatty acid profile specificity relative to the best Ch FATB2 mutant (D3599). Therefore an additional set of mutants were generated to alter the activity and specificity of Ch FATB2, Table 5. The 228K mutation corresponds to position 230 of Cuphea palustris FATB1 (SEQ ID NO: 13). Residue 230 of Cupheapalustris FATB1 corresponds to M228 in the Cuphea hookeriana FATB2 and Cuphea avigera FATB1.
TABLE-US-00006 TABLE 5 Beneficial Mutations Constructs 1) 163Tyr 186Pro 228Lys 2) 163Tyr 186Lys 228Lys 3) 163Tyr 186Ala 228Lys 4) 163Phe 186Pro 228Lys 5) 163Phe 186Lys 228Lys 6) 163Phe 186Ala 228Lys
[0107] Five individual Ch FATB2 variants were generated and their effect on C8:0 and C10:0 fatty acid accumulation was quantified.
TABLE-US-00007 TABLE 6 Ch FABT2 variant C8:0 C10:0 C12:0 C14:0 C8-C10sum D3886-163F, average 3.72 2.33 0.20 1.80 8.05 186A, 228K STDEV 1.06 0.46 0.03 0.10 1.64 D3887-163F, average 5.16 2.97 0.25 1.88 10.25 186K, 228K STDEV 1.34 0.61 0.04 0.12 2.11 D3888-163F, average 4.57 2.72 0.18 1.85 9.32 186P, 228K STDEV 1.42 0.71 0.06 0.07 2.24 D3895-163Y, average 4.17 2.51 0.20 1.84 8.71 186A, 228K STDEV 1.72 0.93 0.07 0.10 2.80 D3896-163Y, average 4.35 2.70 0.22 1.80 9.06 186K, 228K STDEV 0.73 0.28 0.02 0.07 1.08 D3598- wild type average 1.14 5.72 0.15 1.56 8.57 Ch FATB2 STDEV 0.27 0.77 0.06 0.05 1.12 D3519- H163Y, average 6.27 3.57 0.22 1.89 11.94 L186P, 228K STDEV 2.10 0.86 0.05 0.08 3.07
Example 5
[0108] In the example below, we demonstrate the ability to modify the activity and specificity of a FATA thioesterase originally isolated from Garcinia mangostana (GmFATA, accession 004792), using site directed mutagenesis targeting six amino acid positions within the enzyme. The rational for targeting three of the amino acids (G108, S111, V193) was based on research published by Facciotti, et al., Nat Biotechnol. (1999) 17(6):593-7. The remaining three amino acids (L91, G96, T156) were targeted based on research performed at Solazyme with other thioesterases.
[0109] To test the impact of each mutation on the activity of the GmFATA, the wild-type and mutant genes were cloned into a vector enabling expression within the P. moriformis strain S3150. Table 7 summarizes the results from a three day lipid profile screen comparing the wild-type GmFATA with the 14 mutants. Three GmFATA mutants (D3998, D4000, D4003) increased the amount of C18:0 by at least 1.5 fold compared to the wild-type protein (D3997). D3998 and D4003 were mutations that had been described by Facciotti et al (NatBiotech 1999) as substitutions that increased the activity of the GmFATA. In contrast, the D4000 mutation was based on research at Solazyme which demonstrated this position influenced the activity of the FATB thioesterases.
TABLE-US-00008 TABLE 7 SEQ ID Algal Strain DNA # NO: GmFATA C14:0 C16:0 C18:0 C18:1 C18:2 P. moriformis 1.63 29.82 3.08 55.95 7.22 S3150 D3997 15 Wild- 1.79 29.28 7.32 52.88 6.21 Type GmFATA D3998 16 S111A, 1.84 28.88 11.19 49.08 6.21 V193A D3999 17 S111V, 1.73 29.92 3.23 56.48 6.46 V193A D4000 18 G96A 1.76 30.19 12.66 45.99 6.01 D4001 19 G96T 1.82 30.60 3.58 55.50 6.28 D4002 20 G96V 1.78 29.35 3.45 56.77 6.43 D4003 21 G108A 1.77 29.06 12.31 47.86 6.08 D4007 25 G108V 1.81 28.78 5.71 55.05 6.26 D4004 22 L91F 1.76 29.60 6.97 53.04 6.13 D4005 23 L91K 1.87 28.89 4.38 56.24 6.35 D4006 24 L91S 1.85 28.06 4.81 56.45 6.47 D4008 26 T156F 1.81 28.71 3.65 57.35 6.31 D4009 27 T156A 1.72 29.66 5.44 54.54 6.26 D4010 28 T156K 1.73 29.95 3.17 56.86 6.21 D4011 29 T156V 1.80 29.17 4.97 55.44 6.27
Example 6
[0110] Wild-type P. moriformis storage lipid is comprised of 60% oleic (C18:1), 25-30% palmitic (C16:0), and 5-8% linoleic (C18:2) acids, with minor amounts of stearic (C18:0), myristic (C14:0), -linolenic (C18:3a), and palmitoleic (C16:1) acids. This fatty acid profile results from the relative activities and substrate affinities of the enzymes of the endogeneous fatty acid biosynthetic pathway. The introduction of Garcinia mangostana FATA thioesterase (GarmFATA1) gene into P. moriformis results in oils with increased levels of stearate (C18:0). Furthermore we demonstrated that the G96A and G108A single mutations, and the (S111A, V193A) double mutations in GarmFATA1 increased C18:0 accummulation relative to the native GarmFATA1 protein.
[0111] In the present example we assessed the thioesterase activity of a series of additional GarmFATA1 mutants. These mutants were generated by combining the above-described G96A, G108A, S111A and V193A mutations into double, triple or quadruple mutants. Specifically we tested GarmFATA1 (G96A, G108A), GarmFATA1 (G96A, S111A), GarmFATA1 (G96A, V193A), GarmFATA1 (G108A, S111A), GarmFATA1 (G108A, V193A), GarmFATA1 (G96A, G108A, S111A), GarmFATA1 (G96A, G108A, V193A), GarmFATA1 (G96A, S111A, V193A), GarmFATA1 (G108A, S111A, V193A), and GarmFATA1 (G96A, G108A, S111A, V193A) mutant combinations. GarmFATA1 (G108A) was used as a control since out of all the mutants tested earlier this one gave the best increase in C18:0 levels over the native GARMFATA1 protein. The screen was carried out in S5780, a strain previously constructed in S5100a high oleic base strain. S5780 was created through the targeted deletion of the dominant SAD2-1 allele, reducing the rate of conversion of C18:0 to C18:1 and overexpression of PmKASII, increasing elongation of C16:0 to C18:0. S5780 was transformed with constructs that targeted the LPAT2 gene from T. cacao (TcLPAT2) and the above-mentioned combinations of GarmFATA1 site-directed mutants to the FATA-1 locus. TcLPAT2 is highly specific for incorporation of unsaturated fatty acids at the sn-2 position of TAGs. The S5780 strain, containing a deletion of a stearoyl ACP desaturase (SAD) allele, was made according to the teachings in co-owned applications WO2010/063031, WO2011/150411, and/or WO2012/106560, all of which are herein incorporated by reference.
Construct Used for the Expression of TcLPAT2 and GarmFATA1 (G96A, G108A) at PmFATA1 Locus(pSZ5990)
[0112] In this example S5780 strain, transformed with the construct pSZ5990, was generated which express Saccharomyces carlbergenesis SUC2 gene (allowing for their selection and growth on medium containing sucrose), a T. cacao LPAT2 and G. mangostana FATA1 (G96A, G108A) thioesterase targeted at endogenous PmFATA1 genomic region. Construct pSZ5990 introduced for expression in S5780 can be written as FATA-1 3 flank:: CrTub2-ScSUC2-PmPGH: Spacer1:PmG3PDH-1-TcLPAT2-PmATP:Spacer2:PmSAD2-2v2-CpSAD1tp_GarmFATA1(G96A, G108A)_FLAG-PmSAD2-1::FATA-1 5 flank
[0113] The sequence of the transforming DNA is provided in
[0114] In addition to T. cacao LPAT2 and G. mangostana FATA1 (G96A, G108A) genes targeted at PmFAFA1 locus (pSZ5990) several other constructs incorporating the various mutations described above were designed for transformation into S5780. These constructs are summarized below in Table 8:
TABLE-US-00009 TABLE 8 Plasmid SEQ ID NO: Genotype pSZ5936 47 FATA-1::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G108A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5991 48 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, S111A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5986 49 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5982 50 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G108A, S111A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5983 51 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G108A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ6005 52 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, G108A, S111A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5984 53 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, G108A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ6004 54 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, S111A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5985 55 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G108A, S111A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ5987 56 FATA-1_3::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmSAD2-2- CpSAD1_GarmFATA1(G96A, G108A, S111A, V193A)_FLAG-PmSAD2-1::FATA-1_5 pSZ6018 47 FATA-1::CrTUB2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACPp1p CpSAD1_GarmFATA1(G108A)_FLAG-PmSAD2-1::FATA-1_5 pSZ6019 50 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G108A, S111A)_FLAG-PmSAD2-1:FATA-1 pSZ6020 51 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G108A, V193A)_FLAG-PmSAD2-1::FATA-1 pSZ6021 53 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G96A, G108A, V193A)_FLAG-PmSAD2-1::FATA-1 pSZ6022 55 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G108, S111A, V193A)_FLAG-PmSAD2-1::FATA-1 pSZ6023 49 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G96A, V193A)_FLAG-PmSAD2-1::FATA-1 pSZ6026 48 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G96A, S111A)_FLAG-PmSAD2-1:FATA-1 pSZ6028 52 FATA-1::CrTub2-ScSUC2-PmPGH:PmG3PDH-1-TcLPAT2-PmATP:PmACP-P1p- CpSAD1tp_GarmFATA1(G96A G108A, S111A)_FLAG-PmSAD2-1::FATA-1
[0115] All these constructs have the same vector backbone, selectable marker, promoters, genes and 3 UTRs as pSZ5990 differing only in the mutations in the GarmFATA1. In addition, the constructs pSZ6019 tO pSZ6023, pSZ6026 and pSZ6028 differ in promoter driving the particular GarmFATA1 mutant. While in pSZ5990 GarmFATA1 (G96A, G108A) is driven by PmSAD2-2v2 promoter, the various GarmFATA1 mutant combinations in pSZ6019-pSZ6028 are driven by PmACP-P1 promoter. The nucleotide sequences of various GarmFATA1 mutants used in the above constructs are shown in SEQ ID NOS: 47-56. The promoter sequence of PmACP-P1 is pSZ6019-pSZ6028 is shown in SEQ ID NO: 57. Relevant restriction sites as bold text are shown 5-3 respectively.
[0116] To determine their impact on fatty acid profiles, all the constructs described above were transformed independently into either S5780. Primary transformants were clonally purified and grown under standard lipid production conditions at pH5.0. The resulting profiles from a set of representative clones arising from transformation of S5780 with pSZ5936 (D4933), pSZ5990 (D4950), pSZ5991 (D4951), pSZ5986 (D4948), pSZ5982 (4931), pSZ5983 (D4932), pSZ6005 (D4952), pSZ5984 (D4933), pSZ6004 (D4953), pSZ5985 (D4934), pSZ5987 (D4949), pSZ6018 (D4978), pSZ6019 (D4979), pSZ6020 (D4980), pSZ6021 (D4981), pSZ6022 (D4982), pSZ6023 (D4983), pSZ6026 (D4986), pSZ6028 (D4988) are shown in Tables 9-19 respectively.
[0117] Table 13 lists the average fatty acid profiles and glucose consumption (relative to the S7485 base strain) for each set of transformants. Disruption of one allele of FATA-1 reduces C16:0 by 1-2%, while TcLPAT2 activity manifests as a 1-1.5% increase in C18:2 in these strains. D4993 and D4978 expressing GarmFATA1 (G108A) mutant accumulated between 44.69% to 45.33% and 34.26 to 50.94% C18:0 respectively. D4993 has GarmFATA1 (G108A) driven by PmSAD2-2 promoter while for D4978 PmACP-P1 promoter drives the GarmFATA1 (G108A). Strains with the (G96A, G108A), (G108A, S111A) and (G108A, V193A) combinations consistently accumulated more C18:0 than the (G108A) single mutant, with minimal increases in C16:0. D4950 (G96A, G108A) produced more than 50% C18:0 in multiple strains. The (G96A, G108A, S111A), (G96A, G108A, V193A) and (G96A, S111A, V193A) triple mutants also produced generally higher C18:0, but at a cost of increased C16:0. The (G108A, S111A, V193A) triple mutant and (G96A, G108A, S111A, V193A) quadruple mutant produced C18:0 less than the G108 single mutant. PmACP-P1 promoter generally resulted in more C18:0 than the ones driven by PmSAD2-2 promoter.
TABLE-US-00010 TABLE 9 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.75 7.07 30.32 51.61 5.96 0.79 2.16 S5780; T1402; D4993-7 0.65 4.66 45.33 38.86 7.42 0.64 1.50 S5780; T1402; D4993-4 0.66 4.62 45.22 38.64 7.70 0.67 1.51 S5780; T1402; D4993-2 0.63 4.54 44.94 39.11 7.59 0.66 1.54 S5780; T1402; D4993-8 0.65 4.52 44.92 39.22 7.62 0.65 1.50 S5780; T1402; D4993-9 0.64 4.60 44.69 39.45 7.52 0.64 1.48 S5780; T1395; D4978-1 0.72 5.22 50.94 32.58 7.49 0.67 1.43 S5780; T1395; D4978-6 0.68 5.15 49.26 34.74 7.17 0.65 1.45 S5780; T1395; D4978-2 0.78 6.21 43.12 39.62 7.01 0.72 1.57 S5780; T1395; D4978-3 0.79 6.90 34.26 48.01 6.41 0.79 1.91
[0118] Table 9 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4993 (pSZ5936) and D4978 (pSZ6018). Both pSZ5936 and pSZ6018 have GarmFATA1 (G108) mutant driven by PmSAD2-2 or PmACP-P1 respectively.
TABLE-US-00011 TABLE 10 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.70 6.98 30.82 51.28 5.80 0.77 2.27 S5780; T1402; D4950-3 0.64 5.16 50.73 32.92 7.34 0.62 1.41 S5780; T1402; D4950-8 0.64 5.17 50.63 33.10 7.28 0.62 1.41 S5780; T1402; D4950-5 0.66 5.20 50.23 33.31 7.42 0.62 1.40 S5780; T1402; D4950-7 0.65 5.15 49.90 33.81 7.31 0.63 1.40 S5780; T1402; D4950-4 0.66 5.22 49.53 34.13 7.21 0.61 1.42
[0119] Table 10 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4950 (pSZ5990). pSZ5990 expresses GarmFATA1 (G96A, G108) mutant driven by PmSAD2-2.
TABLE-US-00012 TABLE 11 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.81 7.56 31.15 50.19 6.12 0.82 2.18 S5780; T1402; D4951-18 0.73 5.11 46.22 36.56 7.92 0.72 1.54 S5780; T1402; D4951-8 0.70 4.80 42.65 40.59 7.77 0.72 1.58 S5780; T1402; D4951-3 0.70 4.82 42.42 40.74 7.76 0.71 1.58 S5780; T1402; D4951-4 0.69 4.82 42.28 40.88 7.76 0.73 1.60 S5780; T1402; D4951-15 0.72 4.95 42.07 40.72 8.00 0.73 1.58 S5780; T1395; D4986-21 0.79 5.78 48.77 33.99 7.54 0.69 1.48 S5780; T1395; D4986-18 0.77 5.77 48.43 34.61 7.32 0.65 1.46 S5780; T1395; D4986-23 0.78 5.66 47.64 35.30 7.44 0.69 1.49 S5780; T1395; D4986-15 0.75 5.52 47.60 35.80 7.21 0.67 1.50 S5780; T1395; D4986-1 0.84 6.38 46.95 34.55 8.29 0.64 1.33
[0120] Table 11 provides Primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4951 (pSZ5991) and D4986 (pSZ6026). pSZ5991 and pSZ6026 express GarmFATA1 (G96A, S111A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00013 TABLE 12 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.82 7.51 30.86 50.34 6.27 0.86 2.16 S5780; T1388; D4948-6 0.70 4.93 46.65 36.92 7.66 0.68 1.50 S5780; T1388; D4948-10 0.66 4.79 46.23 37.72 7.51 0.68 1.43 S5780; T1388; D4948-11 0.72 5.05 46.18 36.89 8.04 0.67 1.47 S5780; T1388; D4948-4 0.72 5.11 46.11 36.97 8.00 0.66 1.45 S5780; T1388; D4948-9 0.72 5.06 46.09 36.96 8.05 0.67 1.45 S5780; T1395; D4983-25 0.73 5.85 49.47 32.96 7.77 0.62 1.49 S5780; T1395; D4983-14 0.68 5.25 48.53 35.02 7.32 0.63 1.52 S5780; T1395; D4983-27 0.70 5.66 48.35 34.56 7.56 0.62 1.50 S5780; T1395; D4983-18 0.67 5.30 48.26 35.35 7.29 0.62 1.51 S5780; T1395; D4983-13 0.68 5.31 48.09 35.59 7.27 0.63 1.48
[0121] Table 12 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4948 (pSZ5986) and D4983 (pSZ6023). pSZ5986 and pSZ6023 express GarmFATA1 (G96A, V193A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00014 TABLE 13 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.77 7.36 30.84 50.71 6.24 0.87 2.12 S5780; T1388; D4931-25 0.70 5.13 48.48 35.40 7.25 0.64 1.43 S5780; T1388; D4931-9 0.73 5.43 48.29 34.92 7.63 0.65 1.41 S5780; T1388; D4931-13 0.72 5.24 48.13 35.22 7.64 0.66 1.45 S5780; T1388; D4931-17 0.76 5.14 48.07 35.08 7.86 0.68 1.42 S5780; T1388; D4931-12 0.73 5.33 47.91 35.27 7.65 0.67 1.42 S5780; T1395; D4979-36 0.89 6.91 50.03 31.13 7.83 0.67 1.40 S5780; T1395; D4979-5 0.77 5.88 49.65 33.24 7.25 0.68 1.48 S5780; T1395; D4979-41 0.79 6.25 49.52 33.09 7.28 0.63 1.42 S5780; T1395; D4979-39 0.82 6.36 49.43 32.49 7.66 0.66 1.48 S5780; T1395; D4979-32 0.82 6.49 49.12 32.98 7.45 0.63 1.43
[0122] Table 13 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4931 (pSZ5982) and D4979 (pSZ6019). pSZ5982 and pSZ6019 express GarmFATA1 (G108A, S111A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00015 TABLE 14 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.79 7.46 31.60 49.57 6.28 0.86 2.19 S5780; T1388; D4932-48 0.78 4.59 49.48 31.74 9.13 1.30 1.84 S5780; T1388; D4932-36 0.66 4.89 49.25 34.63 7.53 0.66 1.43 S5780; T1388; D4932-28 0.66 4.93 49.04 34.91 7.50 0.65 1.38 S5780; T1388; D4932-23 0.67 4.95 49.03 34.55 7.69 0.66 1.42 S5780; T1388; D4932-5 0.68 4.93 49.01 34.77 7.54 0.67 1.38 S5780; T1395; D4980-21 0.71 4.54 51.48 32.09 7.54 0.87 1.78 S5780; T1395; D4980-1 0.72 5.80 48.65 33.81 8.04 0.62 1.46 S5780; T1395; D4980-25 0.68 5.46 47.67 35.53 7.61 0.66 1.47 S5780; T1395; D4980-18 0.77 6.49 46.51 34.39 8.69 0.71 1.45 S5780; T1395; D4980-30 0.70 5.22 45.14 38.84 6.80 0.70 1.70
[0123] Table 14 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4932 (pSZ5983) and D4980 (pSZ6020). pSZ5983 and pSZ6020 express GarmFATA1 (G108A, V193A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00016 TABLE 15 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.75 7.14 30.84 51.19 5.87 0.79 2.26 S5780; T1402; D4952-9 0.77 5.68 48.96 33.44 7.70 0.68 1.50 S5780; T1402; D4952-5 0.75 5.58 48.60 33.94 7.60 0.70 1.52 S5780; T1402; D4952-1 0.75 5.62 48.59 33.94 7.63 0.69 1.51 S5780; T1402; D4952-8 0.78 5.78 48.51 33.71 7.74 0.67 1.50 S5780; T1402; D4952-10 0.77 5.65 48.35 34.15 7.59 0.70 1.52 S5780; T1395; D4988-5 0.99 8.68 48.51 31.29 7.08 0.64 1.51 S5780; T1395; D4988-7 0.75 5.50 46.63 36.68 7.41 0.69 1.43 S5780; T1395; D4988-8 0.77 5.57 46.51 36.73 7.47 0.70 1.42 S5780; T1395; D4988-3 1.12 9.63 44.06 33.16 8.33 0.76 1.57 S5780; T1395; D4988-10 1.27 11.45 43.35 31.26 8.95 0.74 1.49
[0124] Table 15 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4952 (pSZ6005) and D4988 (pSZ6028). pSZ6005 and pSZ6028 express GarmFATA1 (G96A, G108A, S111A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00017 TABLE 16 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.79 7.46 31.60 49.57 6.28 0.86 2.19 S5780; T1388; D4933-12 0.67 5.48 50.40 32.85 7.31 0.63 1.36 S5780; T1388; D4933-9 0.69 5.68 50.20 32.58 7.55 0.65 1.41 S5780; T1388; D4933-8 0.66 5.46 50.07 33.20 7.35 0.63 1.39 S5780; T1388; D4933-2 0.70 5.66 49.99 32.81 7.61 0.63 1.38 S5780; T1388; D4933-5 0.85 5.84 41.97 39.70 7.94 0.97 1.36 S5780; T1395; D4981-1 0.63 5.07 37.33 46.45 6.75 0.76 2.00 S5780; T1395; D4981-3 0.71 5.70 34.96 47.88 7.02 0.86 1.88 S5780; T1395; D4981-7 0.70 5.87 34.44 48.58 6.52 0.78 2.04 S5780; T1395; D4981-4 0.75 6.18 33.78 48.83 6.61 0.83 1.98 S5780; T1395; D4981-8 0.71 6.42 33.38 49.33 6.05 0.78 2.21
[0125] Table 16 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4933 (pSZ5984) and D4981 (pSZ6021). pSZ5984 and pSZ6021 express GarmFATA1 (G96A, G108A, V193A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00018 TABLE 17 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.74 7.27 31.04 50.75 5.96 0.81 2.18 S5780; T1388; D4953-6 0.84 6.99 47.90 33.26 7.58 0.65 1.46 S5780; T1388; D4953-4 0.85 7.09 47.54 33.64 7.46 0.66 1.42 S5780; T1402; D4953-3 0.89 6.91 47.54 33.36 7.56 0.71 1.60 S5780; T1402; D4953-9 0.91 7.26 46.67 33.52 7.90 0.70 1.49 S5780; T1402; D4953-1 0.90 7.20 46.37 33.86 7.91 0.72 1.54
[0126] Table 17 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4953 (pSZ6004). pSZ6004 expresses GarmFATA1 (G96A, S111A, V193A) mutant driven by PmSAD2-2.
TABLE-US-00019 TABLE 18 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.78 8.24 30.24 50.34 6.00 0.79 2.23 S5780; T1402; D4934-20 0.84 7.10 46.71 34.60 7.34 0.65 1.47 S5780; T1402; D4934-15 0.78 6.76 44.01 38.09 6.88 0.65 1.59 S5780; T1402; D4934-24 1.03 10.69 39.82 33.95 11.12 0.71 1.36 S5780; T1402; D4934-14 0.77 6.83 38.68 43.31 6.51 0.71 1.88 S5780; T1402; D4934-16 0.75 6.91 35.57 46.50 6.20 0.71 1.92 S5780; T1395; D4982-1 0.00 6.19 39.51 41.35 8.23 0.78 1.92 S5780; T1395; D4982-2 0.03 7.02 35.52 46.24 6.59 0.81 1.89
[0127] Table 18 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4934 (pSZ5985) and D4982 (pSZ6022). pSZ5985 and pSZ6022 express GarmFATA1 (G108A, S111A, V193A) mutant driven by PmSAD2-2 and PmACP-P1 respectively.
TABLE-US-00020 TABLE 19 Fatty acid profile Sample ID C14:0 C16:0 C18:0 C18:1 C18:2 C18:3 C20:0 S5780 0.70 6.98 30.82 51.28 5.80 0.77 2.27 S5780; T1402; D4949-2 0.62 4.54 46.07 38.20 7.44 0.63 1.46 S5780; T1402; D4949-13 0.66 4.57 45.33 38.42 7.85 0.68 1.50 S5780; T1402; D4949-7 0.64 4.61 45.02 39.06 7.55 0.64 1.50 S5780; T1402; D4949-8 0.64 4.62 44.87 39.16 7.51 0.67 1.54 S5780; T1402; D4949-3 0.64 4.88 44.18 39.83 7.18 0.65 1.56
[0128] Table 19 provides primary 3-day Fatty acid profiles of representative S5780 strains transformed with D4949 (pSZ5987). pSZ5985 expresses GarmFATA1 (G96A, G108A, S111A, V193A) mutant driven by PmSAD2-2.
[0129] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
TABLE-US-00021 INFORMALSEQUENCELISTING WildtypeCupheahookerianaFATB2(ChFATB2)aminoacidsequence SEQIDNo.1 MVAAAASSAFFPVPAPGASPKPGKFGNWPSSLSPSFKPKSIPNGGFQVKANDSAHPKANGSAVSLKSGSL NTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFGLESTVQDGLVFRQ SFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTLEMCKRDLIWVVIKMQIKVNRYPAW GDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKLPYEVHQEIVPLFVDSPV IEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPTEVLETQELCSLALEYRREC GRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGANGAISTGKTSNGNSVS CupheahookerianaC8/C10specificFATB2CDS SEQIDNO:2 CTGGATACCATTTTCCCTGCGAAAAAACATGGTGGCTGCTGCAGCAAGTTCCGCATTCTTCCCTGTTCCA GCCCCGGGAGCCTCCCCTAAACCCGGGAAGTTCGGAAATTGGCCCTCGAGCTTGAGCCCTTCCTTCAAGC CCAAGTCAATCCCCAATGGCGGATTTCAGGTTAAGGCAAATGACAGCGCCCATCCAAAGGCTAACGGTTC TGCAGTTAGTCTAAAGTCTGGCAGCCTCAACACTCAGGAGGACACTTCGTCGTCCCCTCCTCCTCGGACT TTCCTTCACCAGTTGCCTGATTGGAGTAGGCTTCTGACTGCAATCACGACCGTGTTCGTGAAATCTAAGA GGCCTGACATGCATGATCGGAAATCCAAGAGGCCTGACATGCTGGTGGACTCGTTTGGGTTGGAGAGTAC TGTTCAGGATGGGCTCGTGTTCCGACAGAGTTTTTCGATTAGGTCTTATGAAATAGGCACTGATCGAACG GCCTCTATAGAGACACTTATGAACCACTTGCAGGAAACATCTCTCAATCATTGTAAGAGTACCGGTATTC TCCTTGACGGCTTCGGTCGTACTCTTGAGATGTGTAAAAGGGACCTCATTTGGGTGGTAATAAAAATGCA GATCAAGGTGAATCGCTATCCAGCTTGGGGCGATACTGTCGAGATCAATACCCGGTTCTCCCGGTTGGGG AAAATCGGTATGGGTCGCGATTGGCTAATAAGTGATTGCAACACAGGAGAAATTCTTGTAAGAGCTACGA GCGCGTATGCCATGATGAATCAAAAGACGAGAAGACTCTCAAAACTTCCATACGAGGTTCACCAGGAGAT AGTGCCTCTTTTTGTCGACTCTCCTGTCATTGAAGACAGTGATCTGAAAGTGCATAAGTTTAAAGTGAAG ACTGGTGATTCCATTCAAAAGGGTCTAACTCCGGGGTGGAATGACTTGGATGTCAATCAGCACGTAAGCA ACGTGAAGTACATTGGGTGGATTCTCGAGAGTATGCCAACAGAAGTTTTGGAGACCCAGGAGCTATGCTC TCTCGCCCTTGAATATAGGCGGGAATGCGGAAGGGACAGTGTGCTGGAGTCCGTGACCGCTATGGATCCC TCAAAAGTTGGAGTCCGTTCTCAGTACCAGCACCTTCTGCGGCTTGAGGATGGGACTGCTATCGTGAACG GTGCAACTGAGTGGCGGCCGAAGAATGCAGGAGCTAACGGGGCGATATCAACGGGAAAGACTTCAAATGG AAACTCGGTCTCTTAGAAGTGTCTCGGAACCCTTCCGAGATGTGCATTTCTTTTCTCCTTTTCATTTTGT GGTGAGCTGAAAGAAGAGCATGTCGTTGCAATCAGTAAATTGTGTAGTTCGTTTTTCGCTTTGCTTCGCT CCTTTGTATAATAATATGGTCAGTCGTCTTTGTATCATTTCATGTTTTCAGTTTATTTACGCCATATAAT TTTT AminoacidsequenceofChFATB2-D3570,pSZ4689-thealgaltransit peptideisunderlined,theFLAGepitopetagisboldedandtheP186 residueislower-casebold SEQIDNO:3 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTpEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* AminoacidsequenceofChFATB2-D3573,pSZ4692-thealgaltransit peptideisunderlined,theFLAGepitopetagisboldedandtheK186 residueislower-casebold SEQIDNO:4 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTkEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* AminoacidsequenceofChFATB2-D3582,pSZ4702-thealgaltransit peptideisunderlined,theFLAGepitopetagisboldedandtheA186 residueislower-casebold SEQIDNO:5 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTaEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* AminoacidsequenceofChFATB2-D3584,pSZ4704-thealgaltransit peptideisunderlined,theFLAGepitopetagisboldedandtheY163 residueislower-casebold SEQIDNO:6 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNyLQETSLNHCKSTGILLDGFGRTLEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* AminoacidsequenceofChFATB2-D3588,pSZ4709-thealgaltransit peptideisunderlined,theFLAGepitopetagisboldedandtheF163 residueislower-casebold SEQIDNO:7 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNfLQETSLNHCKSTGILLDGFGRTLEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* Aminoacidsequenceofthewild-typeChFATB2-D3598,pSZ4243-the algaltransitpeptideisunderlined,theFLAGepitopetagisbolded andtheH163andL186residuesarelower-casebold SEQIDNO:8 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNhLQETSLNHCKSTGILLDGFGRTlEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK* NucleotidesequenceoftheChFATB2expressionscreeningvector, usingpSZ4243asanexample.The5and3homologyarmsenabling targetedintegrationintotheThi4locusarenotedwithlowercase; theCrTUB2promoterisnotedinuppercaseitalicwhichdrives expressionoftheNeomycinresistancegenenotedwithlowercase italicfollowedbythePmPGH3UTRterminatorhighlightedin uppercase.ThePmUAPA1promoter(notedinboldtext)drivesthe expressionofthecodonoptimizedChFATB2(notedwithlowercasebold text)andisterminatedwiththeCvNR3UTRnotedinunderlined, lowercasebold.RestrictioncloningsitesandspacerDNAfragments arenotedasunderlined,uppercaseplainlettering. SEQIDNO:9 ccctcaactgcgacgctgggaaccttctccgggcaggcgatgtgcgtgggtttgcctccttggcacgg ctctacaccgtcgagtacgccatgaggcggtgatggctgtgtcggttgccacttcgtccagagacggc aagtcgtccatcctctgcgtgtgtggcgcgacgctgcagcagtccctctgcagcagatgagcgtgact ttggccatttcacgcactcgagtgtacacaatccatttttcttaaagcaaatgactgctgattgacca gatactgtaacgctgatttcgctccagatcgcacagatagcgaccatgttgctgcgtctgaaaatctg gattccgaattcgaccctggcgctccatccatgcaacagatggcgacacttgttacaattcctgtcac ccatcggcatggagcaggtccacttagattcccgatcacccacgcacatctcgctaatagtcattcgt tcgtgtcttcgatcaatctcaagtgagtgtgcatggatcttggttgacgatgcggtatgggtttgcgc cgctggctgcagggtctgcccaaggcaagctaacccagctcctctccccgacaatactctcgcaggca aagccggtcacttgccttccagattgccaataaactcaattatggcctctgtcatgccatccatgggt ctgatgaatggtcacgctcgtgtcctgaccgttccccagcctctggcgtcccctgccccgcccaccag cccacgccgcgcggcagtcgctgccaaggctgtctcggaGGTACCCTTTCTTGCGCTATGACACTTCC AGCAAAAGGTAGGGCGGGCTGCGAGACGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACC CCCCGAAGCTCCTTCGGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTAAATAGC CAGGCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCAAACACCTAGATCACTACC ACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGCTAAGGGGGCGCCTCTTCCTCTTCGTTTC AGTCACAACCCGCAAACTCTAGAATATCAatgatcgagcaggacggcctccacgccggctcccccgcc gcctgggtggagcgcctgttcggctacgactgggcccagcagaccatcggctgctccgacgccgccgt gttccgcctgtccgcccagggccgccccgtgctgttcgtgaagaccgacctgtccggcgccctgaacg agctgcaggacgaggccgcccgcctgtcctggctggccaccaccggcgtgccctgcgccgccgtgctg gacgtggtgaccgaggccggccgcgactggctgctgctgggcgaggtgcccggccaggacctgctgtc ctcccacctggcccccgccgagaaggtgtccatcatggccgacgccatgcgccgcctgcacaccctgg accccgccacctgccccttcgaccaccaggccaagcaccgcatcgagcgcgcccgcacccgcatggag gccggcctggtggaccaggacgacctggacgaggagcaccagggcctggcccccgccgagctgttcgc ccgcctgaaggcccgcatgcccgacggcgaggacctggtggtgacccacggcgacgcctgcctgccca acatcatggtggagaacggccgcttctccggcttcatcgactgcggccgcctgggcgtggccgaccgc taccaggacatcgccctggccacccgcgacatcgccgaggagctgggcggcgagtgggccgaccgctt cctggtgctgtacggcatcgccgcccccgactcccagcgcatcgccttctaccgcctgctggacgagt tcttctgaCAATTGACGCCCGCGCGGCGCACCTGACCTGTTCTCTCGAGGGCGCCTGTTCTGCCTTGC GAAACAAGCCCCTGGAGCATGCGTGCATGATCGTCTCTGGCGCCCCGCCGCGCGGTTTGTCGCCCTCG CGGGCGCCGCGGCCGCGGGGGCGCATTGAAATTGTTGCAAACCCCACCTGACAGATTGAGGGCCCAGG CAGGAAGGCGTTGAGATGGAGGTACAGGAGTCAAGTAACTGAAAGTTTTTATGATAACTAACAACAAA GGGTCGTTTCTGGCCAGCGAATGACAAGAACAAGATTCCACATTTCCGTGTAGAGGCTTGCCATCGAA TGTGAGCGGGCGGGCCGCGGACCCGACAAAACCCTTACGACGTGGTAAGAAAAACGTGGCGGGCACTG TCCCTGTAGCCTGAAGACCAGCAGGAGACGATCGGAAGCATCACAGCACAGGATCCCGCGTCTCGAAC AGAGCGCGCAGAGGAACGCTGAAGGTCTCGCCTCTGTCGCACCTCAGCGCGGCATACACCACAATAAC CACCTGACGAATGCGCTTGGTTCTTCGTCCATTAGCGAAGCGTCCGGTTCACACACGTGCCACGTTGG CGAGGTGGCAGGTGACAATGATCGGTGGAGCTGATGGTCGAAACGTTCACAGCCTAGGGATATCATAG CGACTGCTACCCCCCGACCATGTGCCGAGGCAGAAATTATATACAAGAAGCAGATCGCAATTAGGCAC ATCGCTTTGCATTATCCACACACTATTCATCGCTGCTGCGGCAAGGCTGCAGAGTGTATTTTTGTGGC CCAGGAGCTGAGTCCGAAGTCGACGCGACGAGCGGCGCAGGATCCGACCCCTAGACGAGCACTGTCAT TTTCCAAGCACGCAGCTAAATGCGCTGAGACCGGGTCTAAATCATCCGAAAAGTGTCAAAATGGCCGA TTGGGTTCGCCTAGGACAATGCGCTGCGGATTCGCTCGAGTCCGCTGCCGGCCAAAAGGCGGTGGTAC AGGAAGGCGCACGGGGCCAACCCTGCGAAGCCGGGGGCCCGAACGCCGACCGCCGGCCTTCGATCTCG GGTGTCCCCCTCGTCAATTTCCTCTCTCGGGTGCAGCCACGAAAGTCGTGACGCAGGTCACGAAATCC GGTTACGAAAAACGCAGGTCTTCGCAAAAACGTGAGGGTTTCGCGTCTCGCCCTAGCTATTCGTATCG CCGGGTCAGACCCACGTGCAGAAAAGCCCTTGAATAACCCGGGACCGTGGTTACCGCGCCGCCTGCAC CAGGGGGCTTATATAAGCCCACACCACACCTGTCTCACCACGCATTTCTCCAACTCGCGACTTTTCGG AAGAAATTGTTATCCACCTAGTATAGACTGCCACCTGCAGGACCTTGTGTCTTGCAGTTTGTATTGGT CCCGGCCGTCGAGCACGACAGATCTGGGCTAGGGTTGGCCTGGCCGCTCGGCACTCCCCTTTAGCCGC GCGCATCCGCGTTCCAGAGGTGCGATTCGGTGTGTGGAGCATTGTCATGCGCTTGTGGGGGTCGTTCC GTGCGCGGCGGGTCCGCCATGGGCGCCGACCTGGGCCCTAGGGTTTGTTTTCGGGCCAAGCGAGCCCC TCTCACCTCGTCGCCCCCCCGCATTCCCTCTCTCTTGCAGCCACTAGTAACAatggccaccgcatcca ctttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctccgggccccggcgccca gcgaggcccctccccgtgcgcgggcgcgcctccagcctgagcccctccttcaagcccaagtccatccc caacggcggcttccaggtgaaggccaacgacagcgcccaccccaaggccaacggctccgccgtgagcc tgaagagcggcagcctgaacacccaggaggacacctcctccagcccccccccccgcaccttcctgcac cagctgcccgactggagccgcctgctgaccgccatcaccaccgtgttcgtgaagtccaagcgccccga catgcacgaccgcaagtccaagcgccccgacatgctggtggacagcttcggcctggagtccaccgtgc aggacggcctggtgttccgccagtccttctccatccgctcctacgagatcggcaccgaccgcaccgcc agcatcgagaccctgatgaaccacctgcaggagacctccctgaaccactgcaagagcaccggcatcct gctggacggcttcggccgcaccctggagatgtgcaagcgcgacctgatctgggtggtgatcaagatgc agatcaaggtgaaccgctaccccgcctggggcgacaccgtggagatcaacacccgcttcagccgcctg ggcaagatcggcatgggccgcgactggctgatctccgactgcaacaccggcgagatcctggtgcgcgc caccagcgcctacgccatgatgaaccagaagacccgccgcctgtccaagctgccctacgaggtgcacc aggagatcgtgcccctgttcgtggacagccccgtgatcgaggactccgacctgaaggtgcacaagttc aaggtgaagaccggcgacagcatccagaagggcctgacccccggctggaacgacctggacgtgaacca gcacgtgtccaacgtgaagtacatcggctggatcctggagagcatgcccaccgaggtgctggagaccc aggagctgtgctccctggccctggagtaccgccgcgagtgcggccgcgactccgtgctggagagcgtg accgccatggaccccagcaaggtgggcgtgcgctcccagtaccagcacctgctgcgcctggaggacgg caccgccatcgtgaacggcgccaccgagtggcgccccaagaacgccggcgccaacggcgccatctcca ccggcaagaccagcaacggcaactccgtgtccatggactacaaggaccacgacggcgactacaaggac cacgacatcgactacaaggacgacgacgacaagtgaCTCGAGgcagcagcagctcggatagtatcgac acactctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatcc ctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagc tgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttgcatcccaa ccgcaacttatttacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgca cagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgctg atgcacgggaagtagtgggatgggaacacaaatggaAAGCTGTATAGGGATAACAGGGTAATGAGCTC cagcgccatgccacgccctttgatggcttcaagtacgattacggtgttggattgtgtgtttgttgcgt agtgtgcatggtttagaataatacacttgatttcttgctcacggcaatctcggcttgtccgcaggttc aaccccatttcggagtctcaggtcagccgcgcaatgaccagccgctacttcaaggacttgcacgacaa cgccgaggtgagctatgtttaggacttgattggaaattgtcgtcgacgcatattcgcgctccgcgaca gcacccaagcaaaatgtcaagtgcgttccgatttgcgtccgcaggtcgatgttgtgatcgtcggcgcc ggatccgccggtctgtcctgcgcttacgagctgaccaagcaccctgacgtccgggtacgcgagctgag attcgattagacataaattgaagattaaacccgtagaaaaatttgatggtcgcgaaactgtgctcgat tgcaagaaattgatcgtcctccactccgcaggtcgccatcatcgagcagggcgttgctcccggcggcg gcgcctggctggggggacagctgttctcggccatgtgtgtacgtagaaggatgaatttcagctggttt tcgttgcacagctgtttgtgcatgatttgtttcagactattgttgaatgtttttagatttcttaggat gcatgatttgtctgcatgcgact Aminoacidsequenceofthewild-typeCpalFATB1(D3004,pSZ4241). Thealgaltransitpeptideisunderlined,theFLAGepitopetagis boldedandtheM230residueislower-casebold. SEQIDNO:10 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSSLSPSLKPKSIPNGGFQVKANASAHPKA NGSAVTLKSGSLNTQEDTLSSSPPPRAFFNQLPDWSMLLTAITTVFVAPEKRWTMFDRKSKRPNMLMD SFGLERVVQDGLVFRQSFSIRSYEICADRTASIETVMNHVQETSLNQCKSIGLLDDGFGRSPEMCKRD LIWVVTRMKIMVNRYPTWGDTIEVSTWLSQSGKIGmGRDWLISDCNTGEILVRATSVYAMMNQKTRRF SKLPHEVRQEFAPHFLDSPPAIEDNDGKLQKFDVKTGDSIRKGLTPGWYDLDVNQHVSNVKYIGWILE SMPTEVLETQELCSLTLEYRRECGRDSVLESVTSMDPSKVGDRFQYRHLLRLEDGADIMKGRTEWRPK NAGTNGAISTGKTMDYKDHDGDYKDHDIDYKDDDDK Aminoacidsequenceofthewild-typeChookFATB2(D3042,pSZ4243). Thealgaltransitpeptideisunderlined,theFLAGepitopetagis boldedandtheM228residueislower-casebold. SEQIDNO:11 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRASSLSPSFKPKSIPNGGFQVKANDSAHPKAN GSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFG LESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTLEMCKRDLIW VVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGmGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKL PYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPT EVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGA NGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK Aminoacidsequenceofthewild-typeCaFATB1(D3456,pSZ4532).The algaltransitpeptideisunderlined,theFLAGepitopetagisbolded andtheK228residueislower-casebold. SEQIDNO:12 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRAAINSRAHPKANGSAVSLKSGSLNTQEDTSSSP PPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLMDSFGLESIVQEGLEFRQSFSIRSYE IGTDRTASIETLMNYLQETSLNHCKSTGILLDGFGRTPEMCKRDLIWVVTKMKIKVNRYPAWGDTVEI NTWFSRLGKIGkGRDWLISDCNTGEILIRATSAYATMNQKTRRLSKLPYEVHQEIAPLFVDSPPVIED NDLKLHKFEVKTGDSIHKGLTPGWNDLDVNQHVSNVKYIGWILESMPTEVLETQELCSLALEYRRECG RDSVLESVTAMDPTKVGGRSQYQHLLRLEDGTDIVKCRTEWRPKNPGANGAISTGKTSNGNSVSMDYK DHDGDYKDHDIDYKDDDDK AminoacidsequenceofCupheapalustrisFATB1 SEQIDNO:13 MVAAAASSACFPVPSPGASPKPGKLGNWSSSLSPSLKPKSIPNGGFQVKANASAHPKANG SAVTLKSGSLNTQEDTLSSSPPPRAFFNQLPDWSMLLTAITTVFVAPEKRWTMFDRKSKR PNMLMDSFGLERVVQDGLVFRQSFSIRSYEICADRTASIETVMNHVQETSLNQCKSIGLL DDGFGRSPEMCKRDLIWVVTRMKIMVNRYPTWGDTIEVSTWLSQSGKIGMGRDWLISDCN TGEILVRATSVYAMMNQKTRRFSKLPHEVRQEFAPHFLDSPPAIEDNDGKLQKFDVKTGD SIRKGLTPGWYDLDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRDSVLE SVTSMDPSKVGDRFQYRHLLRLEDGADIMKGRTEWRPKNAGTNGAISTGKT AminoacidsequenceofCupheaavigeraFATB1 SEQIDNO:14 MVAAAASSAFFSVPVPGTSPKPGKFRIWPSSLSPSFKPKPIPNGGLQVKANSRAHPKANG SAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPD MLMDSFGLESIVQEGLEFRQSFSIRSYEIGTDRTASIETLMNYLQETSLNHCKSTGILLD GFGRTPEMCKRDLIWVVTKMKIKVNRYPAWGDTVEINTWFSRLGKIGKGRDWLISDCNTG EILIRATSAYATMNQKTRRLSKLPYEVHQEIAPLFVDSPPVIEDNDLKLHKFEVKTGDSI HKGLTPGWNDLDVNQHVSNVKYIGWILESMPTEVLETQELCSLALEYRRECGRDSVLESV TAMDPTKVGGRSQYQHLLRLEDGTDIVKCRTEWRPKNPGANGAISTGKTSNGNSVS AminoacidsequenceofGmFATAwild-typeparentalgene;D3997, pSZ5083.ThealgaltransitpeptideisunderlinedandtheFLAG epitopetagisuppercasebold SEQIDNO:15 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAS111A,V193Amutantgene;D3998, pSZ5084.Thealgaltransitpeptideisunderlined,theFLAGepitope tagisuppercaseboldandtheS111A,V193Aresiduesarelower-case bold. SEQIDNO:16 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFaTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDaDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAS111V,V193Amutantgene;D3999, pSZ5085.Thealgaltransitpeptideisunderlined,theFLAGepitope tagisuppercaseboldandtheS111V,V193Aresiduesarelower-case bold. SEQIDNO:17 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFvTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDaDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAG96Amutantgene; D4000,pSZ5086.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheG96Aresidueislower-case bold. SEQIDNO:18 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVaCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAG96Tmutantgene; D4001,pSZ5087.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheG96Tresidueislower-case bold. SEQIDNO:19 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVtCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAG96Vmutantgene; D4002,pSZ5088.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheG96Vresidueislower-case bold. SEQIDNO:20 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVvCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAG108Amutantgene; D4003,pSZ5089.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheG108Aresidueislower-case bold. SEQIDNO:21 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTaGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAL91Fmutantgene; D4004,pSZ5090.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheL91Fresidueislower-case bold. SEQIDNO:22 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANfLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAL91Kmutantgene; D4005,pSZ5091.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheL91Kresidueislower-case bold. SEQIDNO:23 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANkLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAL91Smutantgene; D4006,pSZ5092.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheL915residueislower-case bold. SEQIDNO:24 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANsLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAG108Vmutantgene; D4007,pSZ5093.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheG108Vresidueislower-case bold. SEQIDNO:25 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTvGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAT156Fmutantgene; D4008,pSZ5094.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheT156Fresidueislower-case bold. SEQIDNO:26 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGfRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAT156Amutantgene; D4009,pSZ5095.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheT156Aresidueislower-case bold. SEQIDNO:27 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGaRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAT156Kmutantgene; D4010,pSZ5096.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheT156Kresidueislower-case bold. SEQIDNO:28 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGkRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK AminoacidsequenceofGmFATAT156Vmutantgene; D4011,pSZ5097.Thealgaltransitpeptideisunderlined,theFLAG epitopetagisuppercaseboldandtheT156Vresidueislower-case bold. SEQIDNO:29 MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAIPPRIIVVSSSSSKVNPLKTEAVVSSGLAD RLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGCNHAQSVGYSTGGFSTTPTMRKLR LIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGvRRDWILRDYATGQVIGRATSKWVMMNQDTRRL QKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLEDPSQYSKLGLVPRRADLDMNQHVNNVTYIG WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCR NFLHLLRLSGNGLEINRGRTEWRKKPTRMDYKDHDGDYKDHDIDYKDDDDK NucleotidesequenceoftheGmFATAwild-typeparental geneexpressionvector(D3997,pSZ5083).The5and3homologyarms enablingtargetedintegrationintotheThi4locusarenotedwith lowercase;theCrTUB2promoterisnotedinuppercaseitalicwhich drivesexpressionoftheneomycinselectionmarkernotedwith lowercaseitalicfollowedbythePmPGH3UTRterminatorhighlighted inuppercase.ThePmSAD2-1promoter(notedinboldtext)drivesthe expressionoftheGmFATAgene(notedwithlowercaseboldtext)and isterminatedwiththeCvNR3UTRnotedinunderlined,lowercase bold.RestrictioncloningsitesandspacerDNAfragmentsarenoted asunderlined,uppercaseplainlettering. SEQIDNO:30 ccctcaactgcgacgctgggaaccttctccgggcaggcgatgtgcgtgggtttgcctccttggcacgg ctctacaccgtcgagtacgccatgaggcggtgatggctgtgtcggttgccacttcgtccagagacggc aagtcgtccatcctctgcgtgtgtggcgcgacgctgcagcagtccctctgcagcagatgagcgtgact ttggccatttcacgcactcgagtgtacacaatccatttttcttaaagcaaatgactgctgattgacca gatactgtaacgctgatttcgctccagatcgcacagatagcgaccatgttgctgcgtctgaaaatctg gattccgaattcgaccctggcgctccatccatgcaacagatggcgacacttgttacaattcctgtcac ccatcggcatggagcaggtccacttagattcccgatcacccacgcacatctcgctaatagtcattcgt tcgtgtcttcgatcaatctcaagtgagtgtgcatggatcttggttgacgatgcggtatgggtttgcgc cgctggctgcagggtctgcccaaggcaagctaacccagctcctctccccgacaatactctcgcaggca aagccggtcacttgccttccagattgccaataaactcaattatggcctctgtcatgccatccatgggt ctgatgaatggtcacgctcgtgtcctgaccgttccccagcctctggcgtcccctgccccgcccaccag cccacgccgcgcggcagtcgctgccaaggctgtctcggaGGTACCCTTTCTTGCGCTATGACACTTCC AGCAAAAGGTAGGGCGGGCTGCGAGACGGCTTCCCGGCGCTGCATGCAACACCGATGATGCTTCGACC CCCCGAAGCTCCTTCGGGGCTGCATGGGCGCTCCGATGCCGCTCCAGGGCGAGCGCTGTTTAAATAGC CAGGCCCCCGATTGCAAAGACATTATAGCGAGCTACCAAAGCCATATTCAAACACCTAGATCACTACC ACTTCTACACAGGCCACTCGAGCTTGTGATCGCACTCCGCTAAGGGGGCGCCTCTTCCTCTTCGTTTC AGTCACAACCCGCAAACTCTAGAATATCAatgatcgagcaggacggcctccacgccggctcccccgcc gcctgggtggagcgcctgttcggctacgactgggcccagcagaccatcggctgctccgacgccgccgt gttccgcctgtccgcccagggccgccccgtgctgttcgtgaagaccgacctgtccggcgccctgaacg agctgcaggacgaggccgcccgcctgtcctggctggccaccaccggcgtgccctgcgccgccgtgctg gacgtggtgaccgaggccggccgcgactggctgctgctgggcgaggtgcccggccaggacctgctgtc ctcccacctggcccccgccgagaaggtgtccatcatggccgacgccatgcgccgcctgcacaccctgg accccgccacctgccccttcgaccaccaggccaagcaccgcatcgagcgcgcccgcacccgcatggag gccggcctggtggaccaggacgacctggacgaggagcaccagggcctggcccccgccgagctgttcgc ccgcctgaaggcccgcatgcccgacggcgaggacctggtggtgacccacggcgacgcctgcctgccca acatcatggtggagaacggccgcttctccggcttcatcgactgcggccgcctgggcgtggccgaccgc taccaggacatcgccctggccacccgcgacatcgccgaggagctgggcggcgagtgggccgaccgctt cctggtgctgtacggcatcgccgcccccgactcccagcgcatcgccttctaccgcctgctggacgagt tcttctgaCAATTGACGCCCGCGCGGCGCACCTGACCTGTTCTCTCGAGGGCGCCTGTTCTGCCTTGC GAAACAAGCCCCTGGAGCATGCGTGCATGATCGTCTCTGGCGCCCCGCCGCGCGGTTTGTCGCCCTCG CGGGCGCCGCGGCCGCGGGGGCGCATTGAAATTGTTGCAAACCCCACCTGACAGATTGAGGGCCCAGG CAGGAAGGCGTTGAGATGGAGGTACAGGAGTCAAGTAACTGAAAGTTTTTATGATAACTAACAACAAA GGGTCGTTTCTGGCCAGCGAATGACAAGAACAAGATTCCACATTTCCGTGTAGAGGCTTGCCATCGAA TGTGAGCGGGCGGGCCGCGGACCCGACAAAACCCTTACGACGTGGTAAGAAAAACGTGGCGGGCACTG TCCCTGTAGCCTGAAGACCAGCAGGAGACGATCGGAAGCATCACAGCACAGGATCCCGCGTCTCGAAC AGAGCGCGCAGAGGAACGCTGAAGGTCTCGCCTCTGTCGCACCTCAGCGCGGCATACACCACAATAAC CACCTGACGAATGCGCTTGGTTCTTCGTCCATTAGCGAAGCGTCCGGTTCACACACGTGCCACGTTGG CGAGGTGGCAGGTGACAATGATCGGTGGAGCTGATGGTCGAAACGTTCACAGCCTAGGGATATCGTGA AAACTCGCTCGACCGCCCGCGTCCCGCAGGCAGCGATGACGTGTGCGTGACCTGGGTGTTTCGTCGAA AGGCCAGCAACCCCAAATCGCAGGCGATCCGGAGATTGGGATCTGATCCGAGCTTGGACCAGATCCCC CACGATGCGGCACGGGAACTGCATCGACTCGGCGCGGAACCCAGCTTTCGTAAATGCCAGATTGGTGT CCGATACCTTGATTTGCCATCAGCGAAACAAGACTTCAGCAGCGAGCGTATTTGGCGGGCGTGCTACC AGGGTTGCATACATTGCCCATTTCTGTCTGGACCGCTTTACCGGCGCAGAGGGTGAGTTGATGGGGTT GGCAGGCATCGAAACGCGCGTGCATGGTGTGTGTGTCTGTTTTCGGCTGCACAATTTCAATAGTCGGA TGGGCGACGGTAGAATTGGGTGTTGCGCTCGCGTGCATGCCTCGCCCCGTCGGGTGTCATGACCGGGA CTGGAATCCCCCCTCGCGACCCTCCTGCTAACGCTCCCGACTCTCCCGCCCGCGCGCAGGATAGACTC TAGTTCAACCAATCGACAACTAGTatggccaccgcatccactttctcggcgttcaatgcccgctgcgg cgacctgcgtcgctcggcgggctccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcg ccatccccccccgcatcatcgtggtgtcctcctcctcctccaaggtgaaccccctgaagaccgaggcc gtggtgtcctccggcctggccgaccgcctgcgcctgggctccctgaccgaggacggcctgtcctacaa ggagaagttcatcgtgcgctgctacgaggtgggcatcaacaagaccgccaccgtggagaccatcgcca acctgctgcaggaggtgggctgcaaccacgcccagtccgtgggctactccaccggcggcttctccacc acccccaccatgcgcaagctgcgcctgatctgggtgaccgcccgcatgcacatcgagatctacaagta ccccgcctggtccgacgtggtggagatcgagtcctggggccagggcgagggcaagatcggcacccgcc gcgactggatcctgcgcgactacgccaccggccaggtgatcggccgcgccacctccaagtgggtgatg atgaaccaggacacccgccgcctgcagaaggtggacgtggacgtgcgcgacgagtacctggtgcactg cccccgcgagctgcgcctggccttccccgaggagaacaactcctccctgaagaagatctccaagctgg aggacccctcccagtactccaagctgggcctggtgccccgccgcgccgacctggacatgaaccagcac gtgaacaacgtgacctacatcggctgggtgctggagtccatgccccaggagatcatcgacacccacga gctgcagaccatcaccctggactaccgccgcgagtgccagcacgacgacgtggtggactccctgacct cccccgagccctccgaggacgccgaggccgtgttcaaccacaacggcaccaacggctccgccaacgtg tccgccaacgaccacggctgccgcaacttcctgcacctgctgcgcctgtccggcaacggcctggagat caaccgcggccgcaccgagtggcgcaagaagcccacccgcatggactacaaggaccacgacggcgact acaaggaccacgacatcgactacaaggacgacgacgacaagtgaATCGATgcagcagcagctcggata gtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgt gaatatccctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgag ttgctagctgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttg catcccaaccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgc ccctcgcacagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactg caatgctgatgcacgggaagtagtgggatgggaacacaaatggaAAGCTTGAGCTCcagcgccatgcc acgccctttgatggcttcaagtacgattacggtgttggattgtgtgtttgttgcgtagtgtgcatggt ttagaataatacacttgatttcttgctcacggcaatctcggcttgtccgcaggttcaaccccatttcg gagtctcaggtcagccgcgcaatgaccagccgctacttcaaggacttgcacgacaacgccgaggtgag ctatgtttaggacttgattggaaattgtcgtcgacgcatattcgcgctccgcgacagcacccaagcaa aatgtcaagtgcgttccgatttgcgtccgcaggtcgatgttgtgatcgtcggcgccggatccgccggt ctgtcctgcgcttacgagctgaccaagcaccctgacgtccgggtacgcgagctgagattcgattagac ataaattgaagattaaacccgtagaaaaatttgatggtcgcgaaactgtgctcgattgcaagaaattg atcgtcctccactccgcaggtcgccatcatcgagcagggcgttgctcccggcggcggcgcctggctgg ggggacagctgttctcggccatgtgtgtacgtagaaggatgaatttcagctggttttcgttgcacagc tgtttgtgcatgatttgtttcagactattgttgaatgtttttagatttcttaggatgcatgatttgtc tgcatgcgact NucleotidesequenceoftheGmFATAS111A,V193Amutant gene(D3998,pSZ5084).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:31 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttcgccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgcggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAS111V,V193Amutant gene(D3999,pSZ5085).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:32 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttcgtcaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgcggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAG96Amutantgene (D4000,pSZ5086).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:33 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtggcgtgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAG96Tmutantgene (D4001,pSZ5087).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:34 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgacgtgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAG96Vmutantgene (D4002,pSZ5088).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:35 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtggtgtgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAG108Amutantgene (D4003,pSZ5089).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:36 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccgccggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAL91Fmutantgene (D4004,pSZ5090).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:37 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacttcctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAL91Kmutantgene (D4005,pSZ5091).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:38 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacaagctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAL91Smutantgene (D4006,pSZ5092).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:39 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaactcgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAG108Vmutantgene (D4007,pSZ5093).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:40 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccgtcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcacccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAT156Fmutantgene (D4008,pSZ5094).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:41 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcttccgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAT156Amutantgene (D4009,pSZ5095).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:42 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcgcgcgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAT156Kmutantgene (D4010,pSZ5096).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:43 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcaagcgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga NucleotidesequenceoftheGmFATAT156Vmutantgene (D4011,pSZ5097).Thepromoter,3UTR,selectionmarkerand targetingarmsarethesameasdescribedinSEQIDNO:30. SEQIDNO:44 atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggctc cgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccatccccccccgcatcatcgtgg tgtcctcctcctcctccaaggtgaaccccctgaagaccgaggccgtggtgtcctccggcctggccgac cgcctgcgcctgggctccctgaccgaggacggcctgtcctacaaggagaagttcatcgtgcgctgcta cgaggtgggcatcaacaagaccgccaccgtggagaccatcgccaacctgctgcaggaggtgggctgca accacgcccagtccgtgggctactccaccggcggcttctccaccacccccaccatgcgcaagctgcgc ctgatctgggtgaccgcccgcatgcacatcgagatctacaagtaccccgcctggtccgacgtggtgga gatcgagtcctggggccagggcgagggcaagatcggcgtgcgccgcgactggatcctgcgcgactacg ccaccggccaggtgatcggccgcgccacctccaagtgggtgatgatgaaccaggacacccgccgcctg cagaaggtggacgtggacgtgcgcgacgagtacctggtgcactgcccccgcgagctgcgcctggcctt ccccgaggagaacaactcctccctgaagaagatctccaagctggaggacccctcccagtactccaagc tgggcctggtgccccgccgcgccgacctggacatgaaccagcacgtgaacaacgtgacctacatcggc tgggtgctggagtccatgccccaggagatcatcgacacccacgagctgcagaccatcaccctggacta ccgccgcgagtgccagcacgacgacgtggtggactccctgacctcccccgagccctccgaggacgccg aggccgtgttcaaccacaacggcaccaacggctccgccaacgtgtccgccaacgaccacggctgccgc aacttcctgcacctgctgcgcctgtccggcaacggcctggagatcaaccgcggccgcaccgagtggcg caagaagcccacccgcatggactacaaggaccacgacggcgactacaaggaccacgacatcgactaca aggacgacgacgacaagtga AminoacidsequenceofGmFATAwild-typeparentalgene;signal peptideisremoved SEQIDNO:45 IPPRIIVVSSSSSKVNPLKTEAVVSSGLADRLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIAN LLQEVGCNHAQSVGYSTGGFSTTPTMRKLRLIWVTARMHIEIYKYPAWSDVVEIESWGQGEGKIGTRR DWILRDYATGQVIGRATSKWVMMNQDTRRLQKVDVDVRDEYLVHCPRELRLAFPEENNSSLKKISKLE DPSQYSKLGLVPRRADLDMNQHVNNVTYIGWVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTS PEPSEDAEAVFNHNGTNGSANVSANDHGCRNFLHLLRLSGNGLEINRGRTEWRKKPTR NucleotidesequenceoftransformingDNAcontainedinplasmidpSZ5990 transformedintoS5780 SEQIDNO:46 gctcttcccaactcagataataccaatacccctccttctcctcctcatccattcagtaccccccccct tctcttcccaaagcagcaagcgcgtggcttacagaagaacaatcggcttccgccaaagtcgccgagca ctgcccgacggcggcgcgcccagcagcccgcttggccacacaggcaacgaatacattcaatagggggc ctcgcagaatggaaggagcggtaaagggtacaggagcactgcgcacaaggggcctgtgcaggagtgac tgactgggcgggcagacggcgcaccgcgggcgcaggcaagcagggaagattgaagcggcagggaggag gatgctgattgaggggggcatcgcagtctctcttggacccgggataaggaagcaaatattcggccggt tgggttgtgtgtgtgcacgttttcttcttcagagtcgtgggtgtgcttccagggaggatataagcagc