YEAST WITH IMPROVED ALCOHOL PRODUCTION

20200131591 ยท 2020-04-30

    Inventors

    Cpc classification

    International classification

    Abstract

    Described are compositions and methods relating to yeast cells having a genetic mutation that give rise to increased alcohol production. Such yeast is well-suited for use in alcohol production to reduce fermentation time and/or increase yields.

    Claims

    1. Modified yeast cells derived from parental yeast cells, the modified cells comprising a genetic alteration that causes the modified cells to produce a decreased amount of functional Cpr1 polypeptide compared to the parental cells, wherein the modified cells produce during fermentation an increased amount of ethanol compared to parental cells under equivalent fermentation conditions.

    2. The modified cells of claim 1, wherein the genetic alteration comprises a disruption of the YDR155c gene present in the parental cells.

    3. The modified cells of claim 2, wherein disruption of the YDR155c gene is the result of deletion of all or part of the YDR155c gene.

    4. The modified cells of claim 2, wherein disruption of the YDR155c gene is the result of deletion of a portion of genomic DNA comprising the YDR155c gene.

    5. The modified cells of claim 2, wherein disruption of the YDR155c gene is the result of mutagenesis of the YDR155c gene.

    6. The modified cells of any of claims 2-5, wherein disruption of the YDR155c gene is performed in combination with introducing a gene of interest at the genetic locus of the YDR155c gene.

    7. The modified cells of any of claims 1-6, wherein the cells do not produce functional Cpr1 polypeptides.

    8. The modified cells of any of claims 1-6, wherein the cells do not produce Cpr1 polypeptides.

    9. The modified cells of any of claims 1-8, wherein the cells further comprise an exogenous gene encoding a carbohydrate processing enzyme.

    10. The modified cells of any of claims 1-9, further comprising an alteration in the glycerol pathway and/or the acetyl-CoA pathway.

    11. The modified cells of any of claims 1-10, further comprising an alternative pathway for making ethanol.

    12. The modified cells of any of claims 1-11, further comprising a disruption of the YJL065 gene present in the parental cells.

    13. The modified cells of any of claims 1-12, wherein the cells do not produce functional Dls1 polypeptides.

    14. The modified cells of any of claims 1-13, wherein the cells are of a Saccharomyces spp.

    15. The modified cells of any of claims 1-14, wherein the amount of ethanol produced by the modified yeast cells and the parental yeast cells is measured at 24 hours following inoculation of a hydrolyzed starch substrate comprising 34-35% dissolved solids and having a pH of 4.8-5.4.

    16. A method for producing a modified yeast cell comprising: introducing a genetic alteration into a parental yeast cell, which genetic alteration reduces or prevents the production of functional Cpr1 polypeptide compared to the parental cells, thereby producing modified cells that produces during fermentation an increased amount of ethanol compared to the parental cells under equivalent fermentation conditions.

    17. The method of claim 16, wherein the genetic alteration comprises disrupting the YDR155c gene in the parental cells by genetic manipulation.

    18. The method of claim 16 or 17, wherein the genetic alteration comprises deleting the YDR155c gene in the parental cells using genetic manipulation.

    19. The method of any of claims 16-18, wherein disruption of the YDR155c gene is performed in combination with introducing a gene of interest at the genetic locus of the YDR155c gene.

    20. The method of any of claims 16-19, wherein disruption of the YDR155c gene is performed in combination with making an alteration in the glycerol pathway and/or the acetyl-CoA pathway.

    21. The method of any of claims 16-20, wherein disruption of the YDR155c gene is performed in combination with adding an alternative pathway for making ethanol.

    22. The method of any of claims 16-21, wherein disruption of the YDR155c gene is performed in combination with disrupting the YJL065 gene present in the parental cells.

    23. The method of any of claims 16-22, wherein disruption of the YDR155c gene is performed in combination with introducing an exogenous gene encoding a carbohydrate processing enzyme.

    24. The method of any of claims 16-23, wherein the modified cell is from a Saccharomyces spp.

    25. In some embodiments of the method of any of claims 16-24, the amount of ethanol produced by the modified yeast cells and the parental yeast cells is measured at 24 hours following inoculation of a hydrolyzed starch substrate comprising 34-35% dissolved solids and having a pH of 4.8-5.4.

    26. Modified yeast cells produced by the method of any of claims 16-25.

    Description

    DETAILED DESCRIPTION

    I. Overview

    [0032] The present compositions and methods relate to modified yeast cells demonstrating increased ethanol production compared to their parental cells. When used for ethanol production, the modified cells allow for increased yields and or shorter fermentation times, thereby increasing the supply of ethanol for world consumption.

    II. Definitions

    [0033] Prior to describing the present strains and methods in detail, the following terms are defined for clarity. Terms not defined should be accorded their ordinary meanings as used in the relevant art.

    [0034] As used herein, alcohol refer to an organic compound in which a hydroxyl functional group (OH) is bound to a saturated carbon atom.

    [0035] As used herein, butanol refers to the butanol isomers 1-butanol, 2-butanol, tert-butanol, and/or isobutanol (also known as 2-methyl-1-propanol) either individually or as mixtures thereof.

    [0036] As used herein, yeast cells yeast strains, or simply yeast refer to organisms from the phyla Ascomycota and Basidiomycota. Exemplary yeast is budding yeast from the order Saccharomycetales. Particular examples of yeast are Saccharomyces spp., including but not limited to S. cerevisiae. Yeast include organisms used for the production of fuel alcohol as well as organisms used for the production of potable alcohol, including specialty and proprietary yeast strains used to make distinctive-tasting beers, wines, and other fermented beverages.

    [0037] As used herein, the phrase variant yeast cells, modified yeast cells, or similar phrases (see above), refer to yeast that include genetic modifications and characteristics described herein. Variant/modified yeast do not include naturally occurring yeast.

    [0038] As used herein, the phrase substantially free of an activity, or similar phrases, means that a specified activity is either undetectable in an admixture or present in an amount that would not interfere with the intended purpose of the admixture.

    [0039] As used herein, the terms polypeptide and protein (and their respective plural forms) are used interchangeably to refer to polymers of any length comprising amino acid residues linked by peptide bonds. The conventional one-letter or three-letter codes for amino acid residues are used herein and all sequence are presented from an N-terminal to C-terminal direction. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.

    [0040] As used herein, functionally and/or structurally similar proteins are considered to be related proteins. Such proteins can be derived from organisms of different genera and/or species, or even different classes of organisms (e.g., bacteria and fungi). Related proteins also encompass homologs determined by primary sequence analysis, determined by secondary or tertiary structure analysis, or determined by immunological cross-reactivity.

    [0041] As used herein, the term homologous protein refers to a protein that has similar activity and/or structure to a reference protein. It is not intended that homologs necessarily be evolutionarily related. Thus, it is intended that the term encompass the same, similar, or corresponding enzyme(s) (i.e., in terms of structure and function) obtained from different organisms. In some embodiments, it is desirable to identify a homolog that has a quaternary, tertiary and/or primary structure similar to the reference protein. In some embodiments, homologous proteins induce similar immunological response(s) as a reference protein. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).

    [0042] The degree of homology between sequences can be determined using any suitable method known in the art (see, e.g., Smith and Waterman (1981) Adv. Appl. Math. 2:482; Needleman and Wunsch (1970) J. Mol. Biol., 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, Wis.); and Devereux et al. (1984) Nucleic Acids Res. 12:387-95).

    [0043] For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle, (Feng and Doolittle (1987) J. Mol. Evol. 35:351-60). The method is similar to that described by Higgins and Sharp ((1989) CABIOS 5:151-53). Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps. Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al. ((1990) J. Mol. Biol. 215:403-10) and Karlin et al. ((1993) Proc. Natl. Acad. Sci. USA 90:5873-87). One particularly useful BLAST program is the WU-BLAST-2 program (see, e.g., Altschul et al. (1996) Meth. Enzymol. 266:460-80). Parameters W, T, and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word-length (W) of 11, the BLOSUM62 scoring matrix (see, e.g., Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M5, N-4, and a comparison of both strands.

    [0044] As used herein, the phrases substantially similar and substantially identical, in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference (i.e., wild-type) sequence. Percent sequence identity is calculated using CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:

    TABLE-US-00001 Gap opening penalty: 10.0 Gap extension penalty: 0.05 Protein weight matrix: BLOSUM series DNA weight matrix: TUB Delay divergent sequences %: 40 Gap separation distance: 8 DNA transitions weight: 0.50 List hydrophilic residues: GP SNDQEKR Use negative matrix: OFF Toggle Residue specific penalties: ON Toggle hydrophilic penalties: ON Toggle end gap separation penalty OFF.

    [0045] Another indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide. Typically, polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive. Thus, a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).

    [0046] As used herein, the term gene is synonymous with the term allele in referring to a nucleic acid that encodes and directs the expression of a protein or RNA. Vegetative forms of filamentous fungi are generally haploid, therefore a single copy of a specified gene (i.e., a single allele) is sufficient to confer a specified phenotype.

    [0047] As used herein, the terms wild-type and native are used interchangeably and refer to genes proteins or strains found in nature.

    [0048] As used herein, the term protein of interest refers to a polypeptide that is desired to be expressed in modified yeast. Such a protein can be an enzyme, a substrate-binding protein, a surface-active protein, a structural protein, a selectable marker, or the like, and can be expressed at high levels. The protein of interest is encoded by a modified endogenous gene or a heterologous gene (i.e., gene of interest) relative to the parental strain. The protein of interest can be expressed intracellularly or as a secreted protein.

    [0049] As used herein, deletion of a gene, refers to its removal from the genome of a host cell. Where a gene includes control elements (e.g., enhancer elements) that are not located immediately adjacent to the coding sequence of a gene, deletion of a gene refers to the deletion of the coding sequence, and optionally adjacent enhancer elements, including but not limited to, for example, promoter and/or terminator sequences, but does not require the deletion of non-adjacent control elements.

    [0050] As used herein, disruption of a gene refers broadly to any genetic or chemical manipulation, i.e., mutation, that substantially prevents a cell from producing a function gene product, e.g., a protein, in a host cell. Exemplary methods of disruption include complete or partial deletion of any portion of a gene, including a polypeptide-coding sequence, a promoter, an enhancer, or another regulatory element, or mutagenesis of the same, where mutagenesis encompasses substitutions, insertions, deletions, inversions, and combinations and variations, thereof, any of which mutations substantially prevent the production of a function gene product. A gene can also be disrupted using RNAi, antisense, or any other method that abolishes gene expression. A gene can be disrupted by deletion or genetic manipulation of non-adjacent control elements.

    [0051] As used herein, the terms genetic manipulation and genetic alteration are used interchangeably and refer to the alteration/change of a nucleic acid sequence. The alteration can include but is not limited to a substitution, deletion, insertion or chemical modification of at least one nucleic acid in the nucleic acid sequence.

    [0052] As used herein, a primarily genetic determinant refers to a gene, or genetic manipulation thereof, that is necessary and sufficient to confer a specified phenotype in the absence of other genes, or genetic manipulations, thereof. However, that a particular gene is necessary and sufficient to confer a specified phenotype does not exclude the possibility that additional effects to the phenotype can be achieved by further genetic manipulations.

    [0053] As used herein, a functional polypeptide/protein is a protein that possesses an activity, such as an enzymatic activity, a binding activity, a surface-active property, or the like, and which has not been mutagenized, truncated, or otherwise modified to abolish or reduce that activity. Functional polypeptides can be thermostable or thermolabile, as specified.

    [0054] As used herein, a functional gene is a gene capable of being used by cellular components to produce an active gene product, typically a protein. Functional genes are the antithesis of disrupted genes, which are modified such that they cannot be used by cellular components to produce an active gene product, or have a reduced ability to be used by cellular components to produce an active gene product.

    [0055] As used herein, yeast cells have been modified to prevent the production of a specified protein if they have been genetically or chemically altered to prevent the production of a functional protein/polypeptide that exhibits an activity characteristic of the wild-type protein. Such modifications include, but are not limited to, deletion or disruption of the gene encoding the protein (as described, herein), modification of the gene such that the encoded polypeptide lacks the aforementioned activity, modification of the gene to affect post-translational processing or stability, and combinations, thereof.

    [0056] As used herein, attenuation of a pathway or attenuation of the flux through a pathway i.e., a biochemical pathway, refers broadly to any genetic or chemical manipulation that reduces or completely stops the flux of biochemical substrates or intermediates through a metabolic pathway. Attenuation of a pathway may be achieved by a variety of well-known methods. Such methods include but are not limited to: complete or partial deletion of one or more genes, replacing wild-type alleles of these genes with mutant forms encoding enzymes with reduced catalytic activity or increased Km values, modifying the promoters or other regulatory elements that control the expression of one or more genes, engineering the enzymes or the mRNA encoding these enzymes for a decreased stability, misdirecting enzymes to cellular compartments where they are less likely to interact with substrate and intermediates, the use of interfering RNA, and the like.

    [0057] As used herein, aerobic fermentation refers to growth in the presence of oxygen.

    [0058] As used herein, anaerobic fermentation refers to growth in the absence of oxygen.

    [0059] As used herein, the singular articles a, an, and the encompass the plural referents unless the context clearly dictates otherwise. All references cited herein are hereby incorporated by reference in their entirety. The following abbreviations/acronyms have the following meanings unless otherwise specified: [0060] C. degrees Centigrade [0061] AA -amylase [0062] bp base pairs [0063] DNA deoxyribonucleic acid [0064] DP degree of polymerization [0065] ds or DS dry solids [0066] EtOH ethanol [0067] g or gm gram [0068] g/L grams per liter [0069] GA glucoamylase [0070] GAU/g ds glucoamylase units per gram dry solids [0071] H.sub.2O water [0072] HPLC high performance liquid chromatography [0073] hr or h hour [0074] kg kilogram [0075] M molar [0076] mg milligram [0077] mL or ml milliliter [0078] ml/min milliliter per minute [0079] mM millimolar [0080] N normal [0081] nm nanometer [0082] PCR polymerase chain reaction [0083] ppm parts per million [0084] SAPU/g ds protease units per gram dry solids [0085] SSCU/g ds fungal alpha-amylase units per gram dry solids [0086] relating to a deletion [0087] g microgram [0088] L and l microliter [0089] M micromolar

    III. Modified Yeast Cells Having Reduced or Eliminated Cpr1 Activity

    [0090] In one aspect, modified yeast cells are provided, the modified yeast having a genetic alteration that causes the cells of the modified strain to produce a decreased amount of functional Cpr1 polypeptide (alternatively called Cpr1p or YDR155c polypeptide) compared to the otherwise-identical parental cells. Cpr1 is a 162-amino acid peptidyl-prolyl cis-trans isomerase that accelerate the folding of proteins. Cpr1 localizes to the nucleus and is believed to have multiple roles in chromatin structure, cell division and transport (Hasumi, H. and Nishikawa, T. (1993) Biochim. Biophys. Acta 1161:161-67; Brown, C. R. et al., (2001) J. Biol. Chem. 276:48017-26 and Arevalo-Rodriguez, M. and Heitman, J. (2005) Eukaryot. Cell 4:17-29.

    [0091] Applicants have discovered that yeast having a genetic alteration that affects Cpr1 function demonstrate increased ethanol production in fermentations, allowing for higher yields, shorter fermentation times or both. Shorter fermentation times allow alcohol production facilities to run more fermentation in a given period of time, increasing productivity. Shorter fermentation times and higher fermentation temperatures also reduce the risk of contamination during fermentation and, depending on ambient conditions, reduce the need to cool the fermentation reaction to maintain the viability of the yeast.

    [0092] The reduction in the amount of functional YDR155c protein can result from disruption of the YDR155c gene present in the parental strain. Because disruption of the YDR155c gene is a primary genetic determinant for conferring the increased ethanol-production-phenotype to the modified cells, in some embodiments the modified cells need only comprise a disrupted YDR155c gene, while all other genes can remain intact. In other embodiments, the modified cells can optionally include additional genetic alterations compared to the parental cells from which they are derived. While such additional genetic alterations are not necessary to confer the described phenotype, they may confer other advantages to the modified cells.

    [0093] Disruption of the YDR155c gene can be performed using any suitable methods that substantially prevent expression of a function YDR155c gene product, i.e., Cpr1. Exemplary methods of disruption as are known to one of skill in the art include but are not limited to: complete or partial deletion of the YDR155c gene, including complete or partial deletion of, e.g., the Cpr1-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element; and complete or partial deletion of a portion of the chromosome that includes any portion of the YDR155c gene. Particular methods of disrupting the YDR155c gene include making nucleotide substitutions or insertions in any portion of the YDR155c gene, e.g., the Cpr1-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element. Preferably, deletions, insertions, and/or substitutions (collectively referred to as mutations) are made by genetic manipulation using sequence-specific molecular biology techniques, as opposed to by chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. Nonetheless, chemical mutagenesis can, in theory, be used to disrupt the YDR155c gene.

    [0094] Mutations in the YDR155c gene can reduce the efficiency of the YDR155c promoter, reduce the efficiency of a YDR155c enhancer, interfere with the splicing or editing of the YDR155c mRNA, interfere with the translation of the YDR155c mRNA, introduce a stop codon into the YDR155c-coding sequence to prevent the translation of full-length tYDR155c protein, change the coding sequence of the Cpr1 protein to produce a less active or inactive protein or reduce Cpr1 interaction with other nuclear protein components, or DNA, change the coding sequence of the Cpr1 protein to produce a less stable protein or target the protein for destruction, cause the Cpr1 protein to misfold or be incorrectly modified (e.g., by glycosylation), or interfere with cellular trafficking of the Cpr1 protein. In some embodiments, these and other genetic manipulations act to reduce or prevent the expression of a functional Cpr1 protein, or reduce or prevent the normal biological activity of Cpr1.

    [0095] In some embodiments, the present modified cells include genetic manipulations that reduce or prevent the expression of a functional Cpr1 protein, or reduce or prevent the normal biological activity of Cpr1.

    [0096] In some embodiments, the decrease in the amount of functional Cpr1 polypeptide in the modified cells is a decrease of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Cpr1 polypeptide in parental cells growing under the same conditions. In some embodiments, the reduction of expression of functional Cpr1 protein in the modified cells is a reduction of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Cpr1 polypeptide in parental cells growing under the same conditions.

    [0097] In some embodiments, the increase in alcohol in the modified cells is an increase of at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, or more, compared to the amount of alcohol produced in parental cells growing under the same conditions.

    [0098] Preferably, disruption of the YDR155c gene is performed by genetic manipulation using sequence-specific molecular biology techniques, as opposed to chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. However, chemical mutagenesis is not excluded as a method for making modified yeast cells.

    [0099] In some embodiments, the parental cell that is modified already includes a gene of interest, such as a gene encoding a selectable marker, carbohydrate-processing enzyme, or other polypeptide. In some embodiments, a gene of introduced is subsequently introduced into the modified cells.

    [0100] The amino acid sequence of the exemplified S. cerevisiae Cpr1 polypeptide is shown, below, as SEQ ID NO: 1:

    TABLE-US-00002 MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTG EKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGK FPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWL DGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL

    [0101] Based on a BLAST search of the NCBI protein database, the described Cpr1 polypeptide is 100% identical to at least ten deposits:

    TABLE-US-00003 TABLE 1 SEQ ID NO: 1 compared to other S. cerevisiae Cpr1 polypeptides Description E value % Identity GenBank Accession No. Cpr1p [S. cerevisiae S288c] 2.8E79 100% NP_010439.1 Cpr1p [S. cerevisiae VL3] 2.8E79 100% EGA87502.1 Cpr1p [S. cerevisiae AVRI796] 2.8E79 100% EGA75445.1 Cpr1p [S. cerevisiae RM11-1a] 2.8E79 100% EDV08157.1 Cpr1p [S. cerevisiae Kyokai No. 7] 2.8E79 100% GAA22386.1 Cpr1p [S. cerevisiae JAY291] 2.8E79 100% EEU04638.1.1 Cpr1p [S. cerevisiae FostersO] 2.8E79 100% EGA63002.1 Cpr1p [S. cerevisiae YJM789] 2.8E79 100% EDN60494.1 Cpr1p [S. cerevisiae Vin13] 2.8E79 100% EGA79484.1 Cpr1p [S. cerevisiae CEN.PK113-7D] 2.8E79 100% EIW11359.1

    [0102] It is expected that the present compositions and methods are applicable to other structurally similar Cpr1 polypeptides, as well as other related proteins, homologs, and functionally similar polypeptides.

    [0103] In some embodiments of the present compositions and methods, the amino acid sequence of the Cpr1 protein that is altered in production levels has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 1.

    [0104] In some embodiments of the present compositions and methods, the YDR155c gene that is disrupted encodes a Cpr1 protein that has a specified degree of overall amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1, e.g., at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 1.

    [0105] The amino acid sequence information provided, herein, readily allows the skilled person to identify a Cpr1 protein, and the nucleic acid sequence encoding a Cpr1 protein, in any yeast, and to make appropriate disruptions in the YDR155c gene to affect the production of the Cpr1 protein.

    [0106] In some embodiments, the decrease in the amount of functional Cpr1 polypeptide in the modified cells is a decrease of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Cpr1 polypeptide in parental cells growing under the same conditions. In some embodiments, the reduction of expression of functional Cpr1 protein in the modified cells is a reduction of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Cpr1 polypeptide in parental cells growing under the same conditions.

    [0107] In some embodiments, the increase in ethanol production by the modified cells, compared to otherwise identical parental cells, is an increase of at least 0.2%, at least 0.4%, at least 0.6%, at least 0.8%, at least 1.0%, at least 1.2%, at least 1.4%, at least 1.6%, at least 1.8%, at least 2.0% or more.

    IV. Modified Yeast Cells Having Reduced Cpr1 Expression and Reduced Dls1 Expression

    [0108] In some embodiments, in addition to expressing decreased amounts of functional Cpr1 polypeptides, the present modified yeast cells further express reduced amounts of functional Dls1 polypeptides.

    [0109] Dls1, encoded by YJL065c, is a 167-amino acid polypeptide subunit of the ISW2 yeast chromatin accessibility complex (yCHRAC), which contains Isw2, Itc1, Dpb3-like subunit (Dls1), and Dpb4 (see, e.g., Peterson, C. L. (1996) Curr. Opin. Genet. Dev. 6:171-75 and Winston, F. and Carlson, M. (1992) Trends Genet. 8:387-91). Applicants have determined that yeast having a genetic alteration that reduces the amount of functional Dls1 in the cell, in the absence of other genetic modifications, exhibit increased robustness in an alcohol fermentation, allowing higher-temperature, and potentially shorter, fermentations (data not shown).

    [0110] Reduction in the amount of functional Dls1 produced in a cell can be accomplished by disruption of the YJL065c gene. Disruption of the YJL065c gene can be performed using any suitable methods that substantially prevent expression of a function YJL065c gene product, i.e., Dls1. Exemplary methods of disruption as are known to one of skill in the art include but are not limited to: complete or partial deletion of the YJL065c gene, including complete or partial deletion of, e.g., the Dls1-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element; and complete or partial deletion of a portion of the chromosome that includes any portion of the YJL065c gene. Particular methods of disrupting the YJL065c gene include making nucleotide substitutions or insertions in any portion of the YJL065c gene, e.g., the Dls1-coding sequence, the promoter, the terminator, an enhancer, or another regulatory element. Preferably, deletions, insertions, and/or substitutions (collectively referred to as mutations) are made by genetic manipulation using sequence-specific molecular biology techniques, as opposed to by chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. Nonetheless, chemical mutagenesis can, in theory, be used to disrupt the YJL065c gene.

    [0111] Mutations in the YJL065c gene can reduce the efficiency of the YJL065c promoter, reduce the efficiency of a YJL065c enhancer, interfere with the splicing or editing of the YJL065c mRNA, interfere with the translation of the YJL065c mRNA, introduce a stop codon into the YJL065c-coding sequence to prevent the translation of full-length tYJL065c protein, change the coding sequence of the Dls1 protein to produce a less active or inactive protein or reduce Dls1 interaction with other nuclear protein components, or DNA, change the coding sequence of the Dls1 protein to produce a less stable protein or target the protein for destruction, cause the Dls1 protein to misfold or be incorrectly modified (e.g., by glycosylation), or interfere with cellular trafficking of the Dls1 protein. In some embodiments, these and other genetic manipulations act to reduce or prevent the expression of a functional Dls1 protein, or reduce or prevent the normal biological activity of Dls1.

    [0112] In some embodiments, the present modified cells include genetic manipulations that reduce or prevent the expression of a functional Dls1 protein, or reduce or prevent the normal biological activity of Dls1, as well as additional mutations that reduce or prevent the expression of a functional Isw2, Itc1, or Dpb4 proteins or reduce or prevent the normal biological activity of Isw2, Itc1, or Dpb4 proteins. In some embodiments, the present modified cells include genetic manipulations that reduce or prevent the expression of a functional Dls1 protein, or reduce or prevent the normal biological activity of Dls1, while having no additional mutations that reduce or prevent the expression of a functional Isw2, Itc1, or Dpb4 proteins or reduce or prevent the normal biological activity of Isw2, Itc1, or Dpb4 proteins.

    [0113] The amino acid sequence of the exemplified S. cerevisiae Dls1 polypeptide is shown, below, as SEQ ID NO: 3:

    TABLE-US-00004 MNNETSGKETASAPLCSPKLPVEKVQRIAKNDPEYMDTSD DAFVATAFATEFFVQVLTHESLHRQQQQQQQQVPPLPDEL TLSYDDISAAIVHSSDGHLQFLNDVIPTTKNLRLLVEENR VRYTTSVMPPNEVYSAYVVNDTAPKPNIVEIDLDNDEDDD EDVTDQE

    [0114] Based on such BLAST and Clustal W data, it is apparent that the exemplified S. cerevisiae Dls1 polypeptide (SEQ ID NO: 3) share a very high degree of sequence identity to other known S. cerevisiae Dls1 polypeptides, as well as Dls1 polypeptides from other Saccharomyces spp. The present compositions and methods, are therefore, fully expected to be applicable to yeast cells containing such structurally similar polypeptides, as well as other related proteins, homologs, and functionally similar polypeptides.

    [0115] In some embodiments of the present compositions and methods, the amino acid sequence of the Dls1 protein that is disrupted has an overall amino acid sequence identity to the amino acid sequence of at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or even at least about 99% identity, to SEQ ID NO: 3

    [0116] Preferably, disruption of the YJL065c gene is performed by genetic manipulation using sequence-specific molecular biology techniques, as opposed to chemical mutagenesis, which is generally not targeted to specific nucleic acid sequences. However, chemical mutagenesis is not excluded as a method for making modified yeast cells.

    [0117] In some embodiments, the decrease in the amount of functional Dls1 polypeptide in the modified cells is a decrease of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Dls1 polypeptide in parental cells growing under the same conditions. In some embodiments, the reduction of expression of functional Dls1 protein in the modified cells is a reduction of at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or more, compared to the amount of functional Dls1 polypeptide in parental cells growing under the same conditions.

    [0118] In some embodiments, the additional increase in ethanol production by the modified cells, compared to cells that only have reduced Cpr1 expression, is an increase of at least 0.2%, at least 0.4%, at least 0.6%, at least 0.8%, at least 1.0%, at least 1.2%, at least 1.4%, at least 1.6%, at least 1.8%, at least 2.0% or more.

    V. Combination of Decreased Cpr1 Expression with Other Mutations that Affect Alcohol Production

    [0119] In some embodiments, in addition to expressing decreased amounts of functional Cpr1 polypeptides, optionally in combination with reduced expression of functional Dls1 polypeptides, the present modified yeast cells further include additional modifications that affect ethanol production.

    [0120] In particular embodiments the modified yeast cells include an artificial or alternative pathway resulting from the introduction of a heterologous phosphoketolase gene and a heterologous phosphotransacetylase gene. An exemplary phosphoketolase can be obtained from Gardnerella vaginalis (UniProt/TrEMBL Accession No.: WP_016786789). An exemplary phosphotransacetylase can be obtained from Lactobacillus plantarum (UniProt/TrEMBL Accession No.: WP_003641060).

    [0121] The modified cells may further include mutations that result in attenuation of the native glycerol biosynthesis pathway, which are known to increase alcohol production. Methods for attenuation of the glycerol biosynthesis pathway in yeast are known and include reduction or elimination of endogenous NAD-dependent glycerol 3-phosphate dehydrogenase (GPD) or glycerol phosphate phosphatase activity (GPP), for example by disruption of one or more of the genes GPD1, GPD2, GPP1 and/or GPP2. See, e.g., U.S. Pat. No. 9,175,270 (Elke et al.), U.S. Pat. No. 8,795,998 (Pronk et al.) and U.S. Pat. No. 8,956,851 (Argyros et al.).

    [0122] The modified yeast may further feature increased acetyl-CoA synthase (also referred to acetyl-CoA ligase) activity (EC 6.2.1.1) to scavenge (i.e., capture) acetate produced by chemical or enzymatic hydrolysis of acetyl-phosphate (or present in the culture medium of the yeast for any other reason) and converts it to Ac-CoA. This avoids the undesirable effect of acetate on the growth of yeast cells and may further contribute to an improvement in alcohol yield. Increasing acetyl-CoA synthase activity may be accomplished by introducing a heterologous acetyl-CoA synthase gene into cells, increasing the expression of an endogenous acetyl-CoA synthase gene and the like. A particularly useful acetyl-CoA synthase for introduction into cells can be obtained from Methanosaeta concilii (UniProt/TrEMBL Accession No.: WP_013718460). Homologs of this enzymes, including enzymes having at least 85%, at least 90%, at least 92%, at least 95%, at least 97%, at least 98% and even at least 99% amino acid sequence identity to the aforementioned acetyl-CoA synthase from Methanosaeta concilii, are also useful in the present compositions and methods.

    [0123] In some embodiments the modified cells may further include a heterologous gene encoding a protein with NAD.sup.+-dependent acetylating acetaldehyde dehydrogenase activity and/or a heterologous gene encoding a pyruvate-formate lyase. The introduction of such genes in combination with attenuation of the glycerol pathway is described, e.g., in U.S. Pat. No. 8,795,998 (Pronk et al.). However, in most embodiments of the present compositions and methods, the introduction of an acetylating acetaldehyde dehydrogenase and/or a pyruvate-formate lyase is not required because the need for these activities is obviated by the attenuation of the native biosynthetic pathway for making Ac-CoA that contributes to redox cofactor imbalance. Accordingly, embodiments of the present compositions and methods expressly lack a heterologous gene(s) encoding an acetylating acetaldehyde dehydrogenase, a pyruvate-formate lyase or both.

    [0124] In some embodiments, the present modified yeast cells further comprise a butanol biosynthetic pathway. In some embodiments, the butanol biosynthetic pathway is an isobutanol biosynthetic pathway. In some embodiments, the isobutanol biosynthetic pathway comprises a polynucleotide encoding a polypeptide that catalyzes a substrate to product conversion selected from the group consisting of: (a) pyruvate to acetolactate; (b) acetolactate to 2,3-dihydroxyisovalerate; (c) 2,3-dihydroxyisovalerate to 2-ketoisovalerate; (d) 2-ketoisovalerate to isobutyraldehyde; and (e) isobutyraldehyde to isobutanol. In some embodiments, the isobutanol biosynthetic pathway comprises polynucleotides encoding polypeptides having acetolactate synthase, keto acid reductoisomerase, dihydroxy acid dehydratase, ketoisovalerate decarboxylase, and alcohol dehydrogenase activity.

    [0125] In some embodiments, the modified yeast cells comprising a butanol biosynthetic pathway further comprise a modification in a polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. In some embodiments, the yeast cells comprise a deletion, mutation, and/or substitution in an endogenous polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. In some embodiments, the polypeptide having pyruvate decarboxylase activity is selected from the group consisting of: PDC1, PDC5, PDC6, and combinations thereof. In some embodiments, the yeast cells further comprise a deletion, mutation, and/or substitution in one or more endogenous polynucleotides encoding FRA2, ALD6, ADH1, GPD2, BDH1, and YMR226C.

    GOI Section

    VI. Combination of Decreased Cpr1 Expression with Other Beneficial Mutations

    [0126] In some embodiments, in addition to expressing reduced amounts of Cpr1 polypeptides, optionally in combination with other genetic modifications that benefit alcohol production, the present modified yeast cells further include any number of additional genes of interest encoding proteins of interest. Additional genes of interest may be introduced before, during, or after genetic manipulations that result in reduced expression of Cpr1 polypeptides. Proteins of interest, include selectable markers, carbohydrate-processing enzymes, and other commercially-relevant polypeptides, including but not limited to an enzyme selected from the group consisting of a dehydrogenase, a transketolase, a phosphoketolase, a transladolase, an epimerase, a phytase, a xylanase, a -glucanase, a phosphatase, a protease, an -amylase, a -amylase, a glucoamylase, a pullulanase, an isoamylase, a cellulase, a trehalase, a lipase, a pectinase, a polyesterase, a cutinase, an oxidase, a transferase, a reductase, a hemicellulase, a mannanase, an esterase, an isomerase, a pectinases, a lactase, a peroxidase and a laccase. Proteins of interest may be secreted, glycosylated, and otherwise-modified.

    VII. Yeast Cells Suitable for Modification

    [0127] Yeasts are unicellular eukaryotic microorganisms classified as members of the fungus kingdom and include organisms from the phyla Ascomycota and Basidiomycota. Yeast that can be used for alcohol production include, but are not limited to, Saccharomyces spp., including S. cerevisiae, as well as Kluyveromyces, Lachancea and Schizosaccharomyces spp. Numerous yeast strains are commercially available, many of which have been selected or genetically engineered for desired characteristics, such as high alcohol production, rapid growth rate, and the like. Some yeasts have been genetically engineered to produce heterologous enzymes, such as glucoamylase or -amylase.

    VIII. Substrates and Products

    [0128] Alcohol production from a number of carbohydrate substrates, including but not limited to corn starch, sugar cane, cassava, and molasses, is well known, as are innumerable variations and improvements to enzymatic and chemical conditions and mechanical processes. The present compositions and methods are believed to be fully compatible with such substrates and conditions.

    [0129] Alcohol fermentation products include organic compound having a hydroxyl functional group (OH) is bound to a carbon atom. Exemplary alcohols include but are not limited to methanol, ethanol, n-propanol, isopropanol, n-butanol, isobutanol, n-pentanol, 2-pentanol, isopentanol, and higher alcohols. The most commonly made fuel alcohols are ethanol, and butanol.

    [0130] These and other aspects and embodiments of the present strains and methods will be apparent to the skilled person in view of the present description. The following examples are intended to further illustrate, but not limit, the strains and methods.

    EXAMPLES

    Example 1. Deletion of YDR155c in Saccharomyces cerevisiae

    [0131] Genetic screening was performed to identify S. cerevisiae mutants capable of improved ethanol production after 24 hours of fermentation, and a number of candidate genes were identified and selected for further testing (data not shown). One of the genes selected for further analysis was YDR155c, which encodes Cpr1. The amino acid sequence of Cpr1 is provided below as SEQ ID NO: 1:

    TABLE-US-00005 MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTG EKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGK FPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWL DGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL

    [0132] Using standard yeast molecular biology techniques, the YDR155c gene was disrupted by deleting essentially the entire coding sequence for Cpr1, i.e., by deleting the nucleic acid sequence from 4 base-pair before the start codon to 10 base-pairs before the stop codon in both alleles of S. cerevisiae. All procedures were based on the publically available nucleic acid sequence of YDR155c, which is provided below as SEQ ID NO: 2 (5 to 3):

    TABLE-US-00006 ATGTCCCAAGTCTATTTTGATGTCGAAGCTGATGGCCAAC CAATTGGCCGTGTCGTTTTCAAGTTGTACAACGACATAGT CCCAAAGACTGCAGAAAACTTCAGAGCTCTATGTACCGGT GAAAAGGGATTCGGCTACGCTGGCTCTCCATTCCACAGAG TTATTCCAGACTTCATGTTGCAAGGTGGTGACTTCACTGC TGGTAACGGTACCGGCGGTAAGTCTATCTACGGTGGCAAA TTCCCAGATGAAAACTTCAAGAAGCACCACGACAGACCAG GTTTGTTGTCCATGGCCAACGCCGGTCCAAACACCAACGG TTCTCAATTCTTCATCACCACCGTTCCATGCCCATGGTTG GACGGTAAGCATGTTGTCTTTGGTGAAGTTGTTGACGGTT ACGACATCGTTAAGAAGGTTGAGTCCTTGGGTTCTCCTTC CGGTGCCACCAAGGCTAGAATTGTTGTTGCCAAGTCCGGT GAATTATAA

    [0133] The host yeast used to make the modified yeast cells was commercially available FERMAX Gold (Martrex, Inc., Chaska, Minn., USA). Deletion of the YDR155c gene were confirmed by colony PCR. The modified yeast was grown in non-selective media to remove the plasmid conferring Kanamycin resistance used to select transformants, resulting in modified yeast that required no growth supplements compared to the parental yeast.

    Example 2: Ethanol Production by Modified Yeast with Reduced Expression of Cpr1

    [0134] FG-155c yeast harboring the deletion of the YDR155c gene was tested for its ability to produce ethanol compared to benchmark yeast (i.e., FERMAX Gold), which is wild-type for the YDR155c gene) in liquefact at 32 and 34 C. Liquefact (i.e., corn flour slurry having a dry solid (ds) value of 34.2% was prepared by adding 600 ppm urea, 0.124 SAPU/g ds FERMGEN 2.5 (an acid fungal protease), 0.33 GAU/g ds CS4 (a variant of Trichoderma reesei glucoamylase) and 1.46 SSCU/g ds Aspergillus kawachii -amylase at pH 4.8.

    [0135] 50 grams of liquefact was weighted into 100 ml vessels and inoculated with fresh overnight cultures from colonies of the modified strain or FG strain at 32 and 34 C. Samples were harvested by centrifugation at 24 and 55 hrs, filtered through 0.2 m filters, and analyzed for ethanol, glucose, acetate and glycerol content by HPLC (Agilent Technologies 1200 series) using Bio-Rad Aminex HPX-87H columns at 55 C., with an isocratic flow rate of 0.6 ml/min in 0.01 N H.sub.2SO.sub.4 eluent. A 2.5 l sample injection volume was used. Calibration standards used for quantification included known amounts of DP4+, DP3, DP2, DP1, glycerol and ethanol. The results of the analyses are shown in Table 2. Ethanol increase is reported with reference to the FG strain.

    TABLE-US-00007 TABLE 2 Analysis of fermentation broth following fermentation for 24 and 55 hrs Time Temp. Glucose Ethanol Increase in ethanol (hrs) Strain ( C.) (g/L) (g/L) compared to FG (%) 24 FG 32 44.10 108.35 1* 24 FG-155c 32 34.79 110.22 1.7 24 FG 34 41.12 110.50 1* 24 FG-155c 34 35.13 111.78 1.2 55 FG 32 0 146.62 1* 55 FG-155c 32 0 146.20 1.0 55 FG 34 2.02 144.65 1* 55 FG-155c 34 2.70 142.30 1.0 *nominal reference value

    [0136] Yeast harboring the YDR155cc gene deletion produced significantly more (i.e., almost 1.2 to 1.7%) ethanol compared the unmodified reference strain under at both 32 and 34 C. at 24 hrs.

    Example 3. Reduced Expression of Cpr1 in Combination with Reduced Expression of Dls1

    [0137] An experiment was performed to determine if decreasing the amount of Cpr1 in combination with reducing the amount of Dls1 (encoded by the YJL065c gene) in yeast increase further increase tolerance and alcohol production compared to decrease Cpr1, alone. Using standard yeast molecular biology techniques, the YDR155c gene was disrupted by deleting essentially the entire coding sequence for Cpr1 in the aforementioned FG host yeast in which the deletion of YJL065c had been made (FG-65c). Yeast harboring the deletion of YJL065c and the Cpr1 deletion (FG-65c-155c) were tested for their ability to produce ethanol compared to the benchmark yeast in liquefact incubated at 32 C. Liquefact (i.e., corn flour slurry having a dry solid (ds) value of 34.1% was prepared by adding 600 ppm urea, 0.124 SAPU/g ds FERMGEN 2.5 (an acid fungal protease), 0.33 GAU/g ds CS4 (a variant of Trichoderma reesei glucoamylase) and 1.46 SSCU/g ds Aspergillus kawachii -amylase at pH 4.8.

    [0138] 50 grams of liquefact was weighted into 250 ml vessels and inoculated with fresh overnight cultures from colonies of the FG-65c and FG-65c-155c strain and incubated at 32 C. for 24 hrs. A gas monitoring system (ANKOM Technology) was used to record the rate of fermentation based on cumulative pressure following CO.sub.2 production over time. Samples were harvested by centrifugation, filtered through 0.2 m filters, and analyzed for ethanol, glucose, acetate and glycerol content by HPLC (Agilent Technologies 1200 series) using Bio-Rad Aminex HPX-87H columns at 55 C., with an isocratic flow rate of 0.6 ml/min in 0.01 N H.sub.2SO.sub.4 eluent. A 2.5 l sample injection volume was used. Calibration standards used for quantification included known amounts of DP4+, DP3, DP2, DP1, glycerol and ethanol. The results of the analyses are shown in Table 3. Ethanol increase at 24 hrs is reported with reference to the FG-65c strain.

    TABLE-US-00008 TABLE 3 Analysis of fermentation broth for 24 hrs with FG, FG-65c and FG-65c-155c yeast Temperature Glucose Glycerol Ethanol Ethanol ( C.) Strain (g/L) (g/L) (g/L) increase (%) 32 FG-65c 51.69 13.01 106.12 1* 32 FG-65c-155c 44.88 13.57 109.13 2.8 32 FG 52.05 13.08 108.20 *nominal reference value

    [0139] Yeast harboring the deletion of the gene YDR155c in addition to the deletion of the gene DLS1 (YJ065c) produced significantly more ethanol (i.e., up to 2.8%) compared to the strain harboring the gene deletion of DLS1 alone at 24 hrs. Note that the FG-65c yeast ultimately produce more ethanol at 48 hours that wild-type FG yeast (data not shown); however, they are relatively slow starters and produce less ethanol at 24 hours. Deletion of the YDR155c gene therefore appears to increase the initial growth rate of the FG-65c yeast.

    Example 4: Ethanol Production by Modified Yeast Having an Alternative Ethanol Pathway

    [0140] Yeast harboring the deletion of the gene YDR155c and further expressing an alternative pathway to produce ethanol (i.e., by expressing a heterologous phosphoketolase, a heterologous phosphotransacetylase, and an acetylating acetaldehyde dehydrogenase, as described in international patent application WO 2015/148272 (Miasnikov et al.)), were tested for their ability to produce ethanol compared to parental yeast, which included the alternative ethanol pathway but did not have a deletion of gene YDR155c. In this case, the parental yeast is designated GPY10009 and the modified yeast is designated GPY10009-155c. Assay conditions and procedures were as described in the previous Examples. Samples were analyzed for ethanol, glucose, and glycerol content and the results are shown in Table 4. Ethanol increase at 24 hrs is reported with reference to the GPY10009 strain.

    TABLE-US-00009 TABLE 4 Analysis of fermentation broth following fermentation for 24 hrs with FG, GPY10009 and GPY10009-155c at 32 C. Temp. Glucose Glycerol Ethanol Ethanol ( C.) Strain (g/L) (g/L) (g/L) increase (%) 32 FG 52.05 13.08 108.20 32 GPY10009 52.81 12.51 106.72 1* 32 GPY10009-155c 46.29 12.93 109.05 2.2 *nominal reference value

    [0141] Yeast harboring the deletion of the gene YDR155c, and also expressing the alternative pathway, produced significantly more ethanol (i.e., in excess of 2%) compared to equivalent yeast without the YDR155c deletion at 24 hrs. Note that the GPY10009 yeast ultimately produce more ethanol at 48 hours that wild-type FG yeast (data not shown); however, they are relatively slow starters and produce less ethanol at 24 hours. Deletion of the YDR155c gene therefore appears to increase the initial growth rate of the GPY10009 yeast.

    Example 5: Ethanol Production by Modified Yeast Expressing Glucoamylase

    [0142] Yeast expressing the aforementioned CS4 variant of Trichoderma reesei glucoamylase and further harboring the deletion of the gene YDR155c (i.e., SA-155c) were tested for their ability to produce ethanol compared to benchmark yeast, which did not have a YDR155c deletion (i.e., SYNERXIA ADY, herein SA, which are wild-type for the YDR155c gene) in liquefact at 32 C. for 24 hrs. Liquefact (i.e., corn flour slurry having a dry solid (ds) value of 34.3% was prepared by adding 600 ppm urea, 0.124 SAPU/g ds FERMGEN 2.5 (an acid fungal protease), no exogenous CS4 (a variant of Trichoderma reesei glucoamylase) was added and 1.46 SSCU/g ds Aspergillus kawachii -amylase at pH 4.8.

    [0143] 5 grams of liquefact was weighted into 10 ml vessels and inoculated with fresh overnight cultures from colonies of the SA and SA-155c strain and incubated at 32 C. for 24 hrs. Samples were harvested by centrifugation, filtered through 0.2 m filters, and analyzed for ethanol, glucose, acetate and glycerol content by HPLC (Agilent Technologies 1200 series) using Bio-Rad Aminex HPX-87H columns at 55 C., with an isocratic flow rate of 0.6 ml/min in 0.01 N H.sub.2SO.sub.4 eluent. A 2.5 l sample injection volume was used. Calibration standards used for quantification included known amounts of DP4+, DP3, DP2, DP1, glycerol and ethanol. The results of the analyses are shown in Table 5. Ethanol increase is reported with reference to the SA strain.

    TABLE-US-00010 TABLE 5 Analysis of fermentation broth following fermentation with SA and SA-155c strains Glucose Glycerol Acetate Ethanol Ethanol Temp. ( C.) Strain (g/L) (g/L) (g/L) (g/L) increase (%) 32 SA-155c 67.53 14.61 0.31 99.35 4.0 32 SA 80.89 13.35 0.26 95.49 1* *nominal reference value

    [0144] Yeast harboring the deletion of the gene YDR155c, and also expressing the glucoamylase, produced significantly more ethanol (i.e., about 4%) compared to the strains without the YDR155c deletion at 24 hrs.