Production methods
10633673 ยท 2020-04-28
Assignee
Inventors
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C12N2770/24034
CHEMISTRY; METALLURGY
C12N2800/60
CHEMISTRY; METALLURGY
C12N15/67
CHEMISTRY; METALLURGY
International classification
C12N15/67
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
Abstract
The present invention provides methods of reducing the levels of a titratable selectable pressure required, the number of amplification cycles, and the time taken to generate protein expressing cell lines by altering the codons of the desired open-reading-frames. Through the use of codon adaptation for this purpose the methods of the invention consistently provide sufficient yields in faster time frames saving many weeks in cell line development activities. Furthermore the methods of the invention also generate cell lines with lower concentrations of selection and amplification agent than previously achievable. Accordingly lower levels of selection and amplification marker in the final cells lines are observed.
Claims
1. A Chinese Hamster Ovarian (CHO) cell line producing at least one therapeutic protein produced by a method comprising the steps of: (a) transforming a CHO cell line with a polynucleotide sequence comprising (i) a sequence that encodes the therapeutic protein and has a codon adaptation index (CAI) that is equal to or greater than 0.9 as calculated using EMBOSS codon usage table Ehum.cut, and (ii) a sequence that encodes an amplifiable selection marker which is capable of providing amplification of the polynucleotide sequence; (b) providing at least one round of amplification in the presence of a selection agent at a concentration of 50% or less than is required to achieve a cell production yield of 0.3-1.5 g/L of the heterologous therapeutic protein in extended unfed batch culture and/or a cell productivity of 10-100 pg/cell/day of the heterologous therapeutic protein in unfed batch culture, compared with a CHO cell line with a sequence that encodes the therapeutic protein and has a codon adaptation index that is less than 0.9 as calculated using EMBOSS codon usage table Ehum.cut; and (c) selecting the cell line once the cell productivity and/or cell production yield of the therapeutic protein is reached; wherein the CHO cell line has lower levels of the amplifiable selection and amplification marker and copy number of transformed DNA compared to said cell line with a sequence that encodes the therapeutic protein and has a codon adaptation index that is less than 0.9 and is not provided with at least one round of amplification in the presence of a selection agent in accordance with step (b).
2. The CHO cell line of claim 1 comprising a vector comprising at least one expression cassette containing an open reading frame containing the polynucleotide sequence that encodes a therapeutic protein with a CAI score above 0.9, and a second expression cassette containing an amplifiable selection marker.
3. The CHO cell line of claim 1 comprising an amplified expression cassette containing an open reading frame containing the polynucleotide sequence that encodes a therapeutic protein with a CAI score above 0.9 contained within said cell line where it is operatively linked to a second expression cassette containing an amplifiable selection marker.
4. The CHO cell line of claim 1 wherein the cell productivity of the therapeutic protein is in the range of 10-100 pg/cell/day in an unfed batch culture.
5. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody with a heavy chain, and the cell line produces an antibody composition comprising less than or equal to 5% of Non-glycosylated heavy chain.
6. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody with a heavy chain, and the cell line produces an antibody composition comprising at least 95% glycosylated heavy chain.
7. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody with a heavy chain, and the cell line produces an antibody composition comprising at least 96% glycosylated heavy chain.
8. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody with a heavy chain, and the cell line produces an antibody composition comprising at least 97% glycosylated heavy chain.
9. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody with a heavy chain, and the cell line produces an antibody composition comprising at least 98% glycosylated heavy chain.
10. The CHO cell line of claim 1, wherein the therapeutic protein is an antibody and the antibody is monoclonal.
Description
BRIEF DESCRIPTION OF FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
DETAILED DESCRIPTION
(16) The codon usage frequency of the genes encoding the therapeutic polypeptides produced according to the present invention is measured and defined by codon adaptation index (CAI).
(17) Codon adaptation is the adaptation of the codons of an open reading frame to the synonymous codons preferred in human/mammalian genes whilst avoiding the introduction of unwanted secondary sequence functions that impede expression of the resulting open reading frames. We have observed that preferred human codons are also very suitable even when subsequent expression is planned in non-human mammalian cells (e.g. hamster derived cells). However, if the most preferred codon for any given amino acid differs in a given mammalian species then this can also be employed instead of the human preference. The CAI score generated for each open reading frame highlights the degree the open reading frame is adapted to the use of synonymous codons most preferred by human/mammalian genes.
(18) Within the context of the present invention, a CAI score of 1 means that the most optimal codon is used for each amino acid in each codon position. For optimal results in the methods of the present invention the genes encoding the therapeutic protein have a CAI which is sufficiently close to 1 such that the desired level of expression of the therapeutic protein is achieved with significantly less selection and amplification agent and/or in a faster time relative to that observed when expressing the naturally occurring starting sequence, for example, the CAI is at least 0.9, or at least 0.95 or at least 0.975.
(19) It is however not necessary to replace all codons with most preferred codons, or replace all least preferred with more preferred codons. The only requirement is that the resulting sequence possesses an unnaturally high CAI score and does not contain expression disrupting elements. Commercially available software such as Leto 1.0 (Entelechon, Regensburg, Germany) can design a sequence of suitably high CAI score. To further help guide in designing codon adapted sequences for use in this invention, 24044 RefSEQ database human transcript products have been analysed (NM_prefixed accession numbers) derived from NCBI genome build number 36. The CAI score range was calculated and was from 0.593 to 0.894 with an average score of 0.720. The highest score (0.894) for a known and expressed gene (rather than theoretical) in this database was generated by the keratin associated protein 5-8 (KRTAP5-8; NM_021046) and by the late cornified envelope 1A (LCE1A; NM_178348). Additionally a database of 21182 human IgG cDNA's revealed that IgG scores range from 0.576 to 0.878 with an average of 0.766. To help guide those skilled in the art, sequences suitable for use in the invention could possess CAI scores above and beyond that of naturally occurring highest human genes such as the late cornified envelope 1A (LCE1A; NM_178348). More preferably CAI scores above 0.9 should be employed.
(20) It was observed that if codon adaptation was carried out across a shorter sequence (for example just the variable region) then an increased level of high producing clones is observed however, when codon adaptation is carried out across the entire open reading frame then the breadth (i.e. number) of high producing clones generated is increased still further (see Table 5).
(21) Due to the sequence of preferred codons, typical adaptation approaches will normally by default also avoid introducing high-scoring ARE (AU Rich Elements see Akashi et al Blood 1994; Vol 83 pp 3182-3187)) RNA instability sequences. However occasionally after codon adaptation there is a requirement to remove expression disrupting sequence elements accidentally introduced. These include but are not limited to:
(22) (i) Functioning splice sites,
(23) (ii) Areas of dyad symmetry (e.g. direct, inverted or palindromic sequences) that noticeably reduce expression levels and/or increase recombination rates between the sequences.
(24) (iii) Functioning instability sequences.
(25) On the rare occasions when such unwanted disruptive elements are created during adaptation it is recommended a less preferred but not least preferred human codon (unless choice is limited) be employed to disrupt the local sequence to inactivate function. Small deviations from maximal scores will not significantly impact use of the resulting open reading frames in this invention.
(26) It is also recognised that if small areas of an open reading frame remain non-adapted (e.g. to retain useful restriction sites) then this will not significantly impact overall CAI score.
(27) If the open reading frame encodes for a fusion, hybrid or chimeric protein it is encouraged that the CAI score is increased in a same manner as described above. Again this adaptation towards synonymous codons preferred by the host cell for the expression of highly expressed endogenous genes should be undertaken for each and every component of gene or cognate cDNA of the fused or engineered open reading frames. For purely synthetic coding sequences present in a protein (i.e. sequence for which no prior sequence exists) it is advised to introduce unnaturally high human gene CAI scores in precisely the same manner. Open reading frames with CAI scores of above and beyond the late cornified envelope 1A human gene should be employed in this invention.
(28) The present invention herein described is the first to describe a method of reducing the levels of a selectable and amplification agent required, the time required, and the number of amplification cycles required in order to generate genetically engineered cell lines expressing desired levels of protein by codon adaptation of the open-reading-frames encoding the protein. Through the use of codon adaptation for this purpose sufficient yields are being observed in faster time frames and so saving many weeks in cell line development activities. Furthermore we are also generating equivalent or improved cell lines by using lower concentrations of selection and amplification agent than we have ever previously achieved. Indeed it is likely that when such improvements as described herein are combined with standard cell culture and seeding protocol improvements as those described by Celina de la Cruz Edmonds et al (ibid), further reductions in the levels of selection and amplification agents, and further reduction in the time needed to generate equivalent or improved yields from genetically engineered cell lines, will be observed.
(29) The present invention is suitable for use when the therapeutic protein is a glycoprotein. Whilst previous work discloses the fact that one can control protein product glycosylation by modification of process duration, temperature, pH, osmolarity and media constituents and additives etc (e.g. see WO2002076578 and references therein), we have found that codon adaptation of open reading frames encoding therapeutic polypeptide sequences (in the case of antibody therapeutic polypeptides) is able to decrease levels of incomplete glycosylation and levels of reduced site occupancy independently of CHO cell sub-type, selection and amplification regimes or media culture conditions.
(30) This surprising observation is the first to demonstrate that one can impact protein glycosylation profile via open reading frame codon adaptation. By employing the codon-adaptation approaches as described herein, a robust manufacturing process can thus be ensured which depends on the sequence of the gene rather than the conditions that the host cell is grown in. In turn this allows for greater opportunity to improve culture conditions and feed regimes through traditional media and feed development iterations without excessive concern over the resulting impact on the product glycoprofile.
(31) The degree of codon adaptation can be measured using the method first described by Sharp and Li (Nucleic Acid Res 1987 15:1281-95). Sharp and Li proposed the Codon Adaptation Index (CAI) score which is essentially derived from the codon preference statistics, but normalized for each amino acid so as to exclude the effects of variation in amino acid composition between different genes. This CAI metric is readily available (e.g. via EMBOSS The European Molecular Biology Open Software Suite (see Rice et al 2000: Trends in Genetics 16; pp 276-277)).
(32) In order to score open reading frames intended for use in this invention, one must first use the appropriate reference database. First one should consider the cell host to be used then one should identify a reference table of relative synonymous codon usage (RSCU) for expressed genes in said cell host. Typically human RSCU databases are suitable for reference when expressing resulting open reading frame in any mammalian cell type. One example of a database is that provided by EMBOSS which uses as a reference the Ehum.cut codon usage table to determine codon usage preferences in human cells. An alternative reference codon usage table is that described by Massaer et al (ibid) in which a smaller number of highly expressed human genes are employed to determine codon preference. Whilst these two reference tables broadly agree on the most preferred codon, there is one notable divergence for one amino acid (arginine). Therefore when designing open reading frames for use in this invention it is logical to cross reference the same codon usage tables to (i) determine the most preferred codons to include in the open reading frame and then (ii) CAI score the open reading frame subsequently generated to ensure the score is sufficiently high to be suitable for use in this invention. For example if the Massaer et al database is employed regularly to design open reading frames for expression in human and mammalian cells and therefore CGC codon is considered most preferred to encode arginine then it is logical to also use this preference reference data when determining the CAI score of the resulting open reading frames generated.
(33) The methodology as described herein is particularly suitable when expressing antibodies or derivatives thereof and is particularly effective when combined with expression cassettes driven by promoter and expression elements derived from the EF-1 alpha gene. Expression cassettes driven by other promoter and expression elements (e.g. derived from the RSV LTR) are also suitable. It is well known in the art that expression cassette elements (for example promoters, enhancers, matrix attachment regions (MARS), insulators, untranslated regions, intervening sequences such as introns and polyadenylations sites) can be combined in many different combinations to create suitable expression cassettes to drive expression of the desired open reading frames and to drive expression of the selection and amplification markers employed in this invention.
(34) Once clones in any given cell line development protocol approach a production plateau in unfed extended batch production, it is observed that additional laboratory activities are best focused on methodologies such as (i) single cell cloning of the best clones, (ii) fed-batch process development, (iii) perfusion style process developments, (iv) bespoke media and feed recipes and regimes and (v) further culture adaptation. For example once a production threshold is reached for an individual clone, its derived single-cell sub-clones are normally more stable and high-yielding than amplified daughter clones generated by further selection and amplification regimes in yet more stringent levels of selection and amplification agent. Indeed increasing selection and amplification of final clones already approaching a threshold of production often leads to instability and after initial improvements, can often ultimately lead to similar or even lower titres in extended unfed production model batch cultures than the amplified parental clone. Therefore whilst it is recognised that on occasion a rare and fortuitous further amplification event may increase titres above 2-fold in some instances, once an expression threshold is approached, there are more reliable techniques that can instead be employed to increase stable titres still further.
(35) The present invention is exemplified by and not limited by, the following examples.
EXAMPLES
(36) In the past, DHFR selection methodology has been employed on more than fifteen antibody projects. In all cases when using this methodology at least two rounds of amplification and a minimum of 50 nM MTX as a selection and maintenance pressure to generate cell lines with suitable yields has been necessary. Typical results generated over this period of time by this methodology are represented by antibodies 1, 2, 3 and 4 in Table 1. Antibody project 1 was carried out using standard methodologies available at the time. Antibody projects 2-9 were carried out according to the materials and methods below.
(37) The impact of improving the codon adaptation index (CAI) of open reading frames was studied.
(38) Antibody 5 was first chosen for investigation. This study involved expressing the antibody product from wild-type (i.e. non codon-adapted) heavy and light chain antibody open reading frames (recorded as antibody 5 (a)), heavy and light chain open reading frames with codon adaptation broadly of the variable domain coding sequences only (recorded as antibody 5 (b) or 5 (c)) or codon adaptation of the entire heavy and light chain open reading frames (recorded as antibody 5 (d)). The results of this study are presented in Tables 1-5.
Example 1, Materials and Methods
(39) 1.1 DNA Cloning and Vector Construction.
(40) All DNA cloning was performed by established restriction enzyme based sub-cloning and PCR assembly methodologies (see Molecular Cloning: A Laboratory Manual. Third Edition: Sambrook et al (CSH Laboratory Press)). Schematic representations of the expression and selection vectors are shown (see
(41) 1.2 Codon Adaptation.
(42) In projects where CAI adapted ORF sequences were investigated, these were generated using desired overlapping oligonucleotides combined with the aid of standard fusion polymerase chain reaction (PCR) prior to cloning and sequence confirmation; all by standard methodology (see Molecular Cloning: A Laboratory Manual. Third Edition: Sambrook et al (CSH Laboratory Press) and Stemmer et al., Gene. 164(1):49-53, 1995). The sequences of the adapted regions of the ORFs of project 5 (b) and 5 (c) were designed using the Massaer Codon Usage preference for human/mammalian cells (see
(43) For antibody project 5 (d), the codon adapted ORF sequences were designed and generated by contract service provider 1. The resulting ORFs possessed a CAI score of >0.9. The codon adapted sequences encoding the antibody variable domains for antibody project 6 were designed and generated by contract service provider 2. These variable domains were then combined with the codon adapted constant domains encoding sequences of project 5 (d) by standard sub-cloning with aid of unique cloning sites located between constant and variable regions (using SpeI for heavy chain, BsiWI for light chain) (projects 6 (b) and 6 (d)). The resulting ORFs encoding the full length antibody for project 6 (b) and 6 (d) each possessed a CAI score of >0.9. The entire codon adapted ORFs of antibody project 7 were designed and made by contract service provider 2 and the resulting ORFs possessed a CAI score of >0.9. The ORFs of projects 8 and 9 employed the Leto software algorithm to design the variable domain sequence. In-frame full-length open-reading-frames were then generated by combining these sequences with appropriate constant domain encoding sequences (again using the SpeI and BsiWI sites as above): For antibody 8, the sequences encoding the variable domains were fused with the respective constant domain encoding sequences from project 7. For antibody 9, the variable domain encoding sequences generated were fused with the respective constant domain encoding sequences from project 6 (d). Once more the resulting ORFs encoding the entire heavy and light chains for project 8 and 9 each possessed CAI scores >0.9.
(44) In
(45) Note for both heavy and light chain ORFs, unique Hind III (5) and EcoR1 sites (3) were routinely employed to shuttle open reading frames into the expression vectors.
(46) All sequences were confirmed prior to use in transfection.
(47) For example sequences see
(48) For all CAI scores reported herein, the Ehum.cut codon usage table was used for reference (available via EMBOSS).
(49) These scores are calculated using the Codon Adaptation Index application which employs the methodology first described by Sharp and Li (ibid). This application is part of the EMBOSS suite. Version 2.8.0 Ehum.cut codon usage files and the default parameter settings were used to determine the CAI scores of the sequences.
(50) TABLE-US-00001 TABLE6 Ehum.cutcodonusagetablederivedfromEMBOSS. ColumnA:Codonsequence;ColumnB:aminoacid encoded;ColumnC:Proportionofusageofagiven codonamongitsredundantset;ColumnD:Number ofcodonsper1000codons;ColumnE:Numberof timescodonobservedindatasetusedtoderive thetable. (A) (B) (C) (D) (E) GCG A 0.100 6.950 10994 GCA A 0.220 15.370 24296 GCT A 0.270 18.750 29645 GCC A 0.410 28.340 44818 TGT C 0.440 9.970 15764 TGC C 0.560 12.630 19971 GAT D 0.460 22.530 35629 GAC D 0.540 26.940 42601 GAA E 0.420 29.040 45923 GAG E 0.580 40.670 64302 TTT F 0.450 16.640 26304 TTC F 0.550 20.620 32611 GGT G 0.170 11.880 18792 GGG G 0.240 16.520 26128 GGA G 0.250 17.710 28000 GGC G 0.340 23.940 37852 CAT H 0.400 9.660 15276 CAC H 0.600 14.350 22687 ATA I 0.150 6.920 10941 ATT I 0.350 16.280 25738 ATC I 0.500 23.380 36976 AAA K 0.410 24.120 38145 AAG K 0.590 34.370 54344 CTA L 0.070 6.320 9990 TTA L 0.070 6.400 10123 TTG L 0.120 11.520 18218 CTT L 0.130 11.740 18564 CTC L 0.200 18.690 29552 CTG L 0.420 38.790 61342 ATG M 1.000 22.230 35143 AAT N 0.450 17.340 27422 AAC N 0.550 21.190 33512 CCG P 0.110 6.700 10588 CCA P 0.280 16.810 26574 CCT P 0.280 16.970 26837 CCC P 0.330 19.900 31463 CAA Q 0.260 11.930 18863 CAG Q 0.740 33.220 52535 CGT R 0.090 4.770 7535 CGA R 0.110 6.040 9547 CGC R 0.200 10.750 17002 AGG R 0.200 10.780 17049 AGA R 0.200 10.820 17104 CGG R 0.200 10.830 17126 TCG S 0.060 4.390 6942 TCA S 0.140 11.070 17497 AGT S 0.150 11.180 17681 TCT S 0.180 14.120 22320 TCC S 0.230 17.320 27389 AGC S 0.250 18.890 29874 ACG T 0.120 6.550 10364 ACT T 0.240 13.250 20954 ACA T 0.270 15.220 24071 ACC T 0.370 20.980 33176 GTA V 0.110 6.920 10939 GTT V 0.170 10.880 17196 GTC V 0.250 15.440 24415 GTG V 0.470 29.080 45989 TGG W 1.000 12.430 19658 TAT Y 0.430 12.320 19479 TAC Y 0.570 16.510 26110
1.3 Cell Culture.
(51) Suspension-adapted CHO DG44 cells were routinely passaged in animal-derived-component-free-media to which they had been previously adapted. This media consisted of a basal formulation containing amino acids, trace elements, vitamins, glucose, and yeast hydrolysate. This media was also supplemented with recombinant insulin, lipids and nucleosides. Sodium bicarbonate was added to media as a buffer. Many equivalent animal derived component free media recipes are known in the art. Initial selection for vector transformed cells was undertaken by nucleoside withdrawal (for DHFR selection) and G418 addition (for neomycin phosphotransferase selection). For titre ranking, the 96-well assay titres were prone to variation induced by cell growth, seeding numbers, media dispensing volumes, and evaporation kinetics across a plate. As a consequence the titres generated in shake flasks production models were more indicative of cell line rank order in high-yielding, amplified cell lines. For such models all cells were seeded at the same initial density. In such models, viability and growth were also monitored.
(52) 1.4 DNA Preparation Before Transfection
(53) Equal amounts (15 g) of the heavy-chain and light-chain expression vector were linearised to completion (with Not I) in a 200 l volume eppendorf reaction and then ethanol/sodium acetate precipitated. The pellet was then washed in 70% ethanol, air dried and re-suspended in 50 l of molecular-biology grade water.
(54) 1.5 Preparation of CHO DG44 Cells Before Transfection
(55) 1.210.sup.7 cells (per transfection) of healthy growing cells were spun (1000 rpm for 2-10 minutes) in a 15 or 50 ml tube, washed in 15 ml of ice-cold PBS/sucrose, spun again and then re-suspended in 800 l of ice-cold PBS sucrose. This cell suspension was then added to the previously prepared DNA and left on ice for 15-minutes before being transferred to a chilled electroporation cuvette.
(56) 1.6 Electroporation
(57) The cuvette containing the prepared DNA and cells was electroporated in a Gene Pulser set to 25 F and 0.38 kV and then returned to ice for 10 minutes. The cells were then removed and added to 240-mls of non-selective media and then plated in non-selective media in 4096-well dish at 2-510.sup.3 cells per well (i.e. 50 L per well). The plates were then wrapped in foil and incubated at 37 C. and 5% CO.sub.2 for 48 h.
(58) 1.7 Selection, Amplification and Clone Identification
(59) 48-hours after electroporation, 150 L of selective media was added to each well. This selective media contains G418 and no nucleosides. Once a week thereafter, 140 l of media was carefully exchanged for fresh selective media without disturbing the settled cell layer and after 3-4 weeks, all growing clones (typically growth of 0.1 colony per well; i.e. growth in 10 wells per 96-well plate) were titred for antibody production. The top ranking clones (typically 20-100) identified were then scaled-up in the same selective media through 24-well dishes and up to 6-well dishes. These clones were then plated at 1000 cells/per well in a 96-well dish (96-wells per clone) and then selected on selective media also containing 5 nM methotrexate in a volume of 200 l per well. After additional two to three weeks incubation, the best clones were again scaled up and then re-plated at 1000 cells per well but in 50 nM MTX. These clones were also screened in 96-well plates after 2-3 weeks of growth and the best scaled up and then plated at 1000 cells per well in 96-well dishes but with 150 nM MTX. In order to evaluate final clones for production potential, the best clones at 150 nM MTX were then scaled-up and evaluated in shake flask production models for titre and quality of the product generated. The best clone for project 5 (a) was a clone labelled 17-9-6-1. This generated 0.3 g per litre end-titre in unfed production models.
(60) NB. Levels of methotrexate and the number of rounds of amplification required in step 1.7 varied depending on the project and whether the sequences were codon adapted.
(61) 1.8 Titre Analysis.
(62) For media samples obtained from 96-well plates, antibody titre was determined by automated 96-well sandwich ELISA style methodology on an IGEN M-Series M8/384 analyser (Bioveris, MaryLand, USA) with manufacturer's recommendations and standard methodologies. The sandwich consisted of Streptavidin coated magnetic coated beads, Biotinylated-Protein A and Ruthenium labelled F(ab)2 fragments. The signal generated for the test sample was then compared to a serial dilution of the antibody reference standard. Whilst a highly sensitive assay, due to assay variation combined with cell growth variables at 96-well cultures, assay intermediate precision and reproducibility is relatively low for this assay for high-yielding, amplified cell lines. For media samples obtained during shake flask and bioreactor production modelling, antibody titre was measured with the aid of a nephelometric method where a light signal is scattered by the insoluble immune-precipitin in the reaction solution using a Beckman Coulter Image system (Buckinghamshire, England) and manufacturer's recommendations and standard methodologies. The signal generated for the test sample again being compared to a serial dilution of the antibody reference standard. All titres reported are approximate.
(63) 1.9 Bioreactor Shake Flask Models (Extended Unfed Batch Production Models).
(64) Typically cells were seeded in standard 250 ml tissue-culture shake-flasks at 800,000 cells per ml with vented lids containing animal-derived-component-free media and to total volume of 120 mls. These flasks were then incubated with agitation in carbon dioxide enriched air and set temperatures to encourage and sustain cell growth. Various conditions were tested for each clonefor example at various temperature conditions. In the results reported herein the highest titre for each clone (across standard conditions) tested is exemplified. Typically the production model end point titres as reported herein were recorded at the point at which cell viability drops to approximately 50% as determined by trypan blue exclusion based assay on a Vi-Cell (Beckman) using standard Vi-Cell CHO parameter settings and manufacturer's recommended protocol. Typically this end-point titre is generated after 10-20 days incubation.
(65) 1.10 Bioreactor Culture Methodology.
(66) Standard bioreactor culturing methodologies and equipment were employed at all times. Typically to generate a seed train, cells were scaled up into larger volumes and passaged twice a week on a repeated 3-day then 4-day regime. For the work shown in
(67) 1.11 RT-QPCR Analysis (for Results, See
(68) CHO RNA extractions and RT-QPCR reactions were undertaken by automated silica based extraction using the MagNA Pure and the RNA High Performance RNA Isolation kit and protocols (Roche). Following reverse transcription using random hexamers, the PCR reaction was undertaken using an ABI-7700 (Applied Biosystems) and analysed via the Ct relative quantitation algorithm using standard methodology. The reactions were multiplexed (18S+ Target gene [heavy chain/light chain]), 18S being the most abundant target was primer limited to prevent inhibition of the target reactions. Probes and flanking primer pairs employed for Q-PCR were used according to SEQ ID. NO's 1-9
(69) Note that the heavy chain and light chain probes/primers above were not suitable for use with project 5 (d) due to increased ORF codon adaptation undertaken in this project hence their exclusion from
(70) 1.12 Western Blot Analysis (for Results See
(71) Standard methodology was employed and is described in detail elsewhere (e.g. see Sambrook et al IBID). In brief polyclonal equivalent cell extracts were made using whole cell lysis and protein extraction buffer. Equal amounts of each extract were then heat incubated with Laemmli loading buffer and then loaded and run on SDS-Page gels with tris-glycine running buffer to separate the protein fractions. Once separated, the proteins were then electro transfer blotted onto nitrocellulose membranes and then probed with a whole anti-human IgG (HRP conjugated). A signal was generated by incubation with an HRP substrate and recorded with X-ray film. An additional longer exposure was required to detect antibody light-chain product for project 5 (a).
(72) 1.13 Fluorescent Methotrexate Staining to Determine DHFR Levels in Clones Producing Desired Recombinant Protein.
(73) Each clone was cultured without methotrexate for 4-5 days prior to addition of 10 M Alexa-Fluor 488Methotrexate (Molecular Probes/Invitrogen, Paisley) for 18-22 hrs at 37 C. 5% CO.sub.2 to 700,000 live cells. Stained cells were then harvested and washed with media and incubated at 37 C., 5% CO.sub.2 for 30 mins. Harvested cells were washed again with media and then re-suspended in media, filtered and live/dead exclusion dye Propidium Iodide (Sigma, St Louis) was added before analyzing on BD FACS ARIA. Data shown in
(74) 1.14 qPCR Analysis of Genomic DNA for DHFR and Neo Levels.
(75) CHO genomic DNA extraction was performed using standard kits from Qiagen. Following DNA quantitation and normalisation using a spectrophotometer reading, the PCR reaction was undertaken using an ABI-7700 (Applied Biosystems) and analysed via the Ct relative quantitation algorithm using standard methodology. Probes and flanking primer pairs employed for Q-PCR were used according to SEQ ID. No's 20-25. results are shown in
Example 2, Expression of Monoclonal Antibody Heavy and Light Chains in CHO Cells
(76) Surprisingly whilst the high CAI scoring ORF's, but still of natural score (i.e scoring less than highest observed natural human ORF's such as late-cornified envelope a! LCE1A; NM 1783480) of project 5 (c) generated a higher top titre than the unnaturally high CAI scoring open reading frames of project 5 (d), the breadth (number) of high producers in 5 (d) were improved (see Table 5). The best clones of 5 (a), (c) and (d) were then amplified and evaluated further. For this further evaluation, the 5 (a) clones were progressed as the control and to represent the typical project titres observed prior to the results described herein. The results of this work generated a high producing, stable clone (titre and growth observed for 40 passages) from project 5 (d) in an unexpectedly fast time and with reduced levels of amplification. Indeed the levels of methotrexate required to generate the final cell line from 5 (d) was significantly lower (97% less methotrexate) relative to that required to generate equivalent cell lines expressing similar or lower levels of the same protein product from non codon-adapted open-reading-frames of project 5 (a) (see Table 1). Further detailed analysis was carried outSee Tables 2-4.
(77) To investigate if the binding properties of the resulting recombinant proteins generated by modified CAI scored ORFs were impacted by codon adaptation, the binding characteristics were compared and analysed for the antibody of project 5 encoded by either ORFs of CAI score 0.809 (HC)/0.761 (LC) or by ORFs of CAI score 0.982 (HC)/0.976 (LC). Both materials were generated in bioreactors and then purified by equivalent purification regimes. Through this comparison it was shown that the binding characteristics of the antibody were unaffected by the CAI alterations to the ORFs that encoded this antibody.
(78) From project 5 (d) the top producing clone, 097-7, as shown in Table 1, was single-cell cloned to ensure clonality of the cell line, with the resulting titre of the best sub-clone generating a near 2-fold increase in unfed extended batch cultures relative to the non-cloned parent. The titres shown in
(79) TABLE-US-00002 TABLE 1 For each protect, the final clone chosen for subsequent further development and banking is presented. Also highlighted are the 96-well titres (ng/ml) generated for each final clone at each stage of its cell line development. Typical data generated prior to the results as described herein are represented as antibody projects 1, 2, 3 and 4. Note that project 2 and project 4 express the same product. For project 2 and 4 all activities were carried out in two independent laboratories using the same vectors, host cells and protocols but different lab operators and equipment. All titres shown below at the 0, 5, 50 and 150 nM MTX are those generated at 96-well stage. Higher titrations showed no significant improvement in batch production models and so lower MTX clone progressed (see Table 2). FIO = For information only, not required. Project 6 (a) was discontinued before plateau was reached due to better titres from projects 6 (b) -6 (d). Antibody 1 2 3 4 5 (a) 5 (d) 6 (a) Final Best ACC522(L4) 15-27-4 C9-13-9 129-1-3-1 17-9-6-1 O97-7 141-6-4 Clone (DRC349) (best A2 96- well titre) 0 nM MTX 120 110 20 41 12 340 16 5 nM MTX 530 180 150 920 32 880 72 50 nM MTX 1720 1240 490 5231 310 6700 438 (FIO) 150 nM MTX Not Not 1910 23000 1670 Not Not undertaken- Required Required Required required Codon No No No No No Yes No Optimised? Promoter CMV RSV RSV RSV RSV RSV RSV CAI 0.679 0.811 0.814 0.811 0.809 0.982 0.818 (Heavy Chain) CAI 0.674 0.767 0.763 0.767 0.761 0.976 0.755 (Light Chain) Weeks to ~15 12 19.5 18 19 7 >15 generate final line in 96 well Non-Fed 0.3 g 0.3 g 0.5 g 0.9 g 0.2 g 0.7 g Not determined- Production (100%) (100%) (300%) (300%) (300%) (10%) estimated Bioreactor at <0.1 g Model (% MTX) (100%) Antibody 6 (b) 6 (c) 6 (d) 7 (a) 7(b) 8 9 Final Best 280-9-6 58-3-3 P100-1 C65-5 74-3 454-6 390-8 Clone 0 nM MTX 78 76 2350 64 2054 1280 2055 5 nM MTX 1140 1160 2025 5700 2125 1690 14055 50 nM MTX 4170 5775 Not Not Not Not Not Required Required Required Required Required 150 nM MTX Not Not Not Not Not Not Not Required Required Required Required Required Required Required Codon Yes No Yes Yes Yes Yes Yes Optimised? Promoter RSV EF-1a EF-1a RSV EF-1a EF-1a Ef-1A CAI 0.976 0.818 0.976 0.977 0.977 0.954 0.975 (Heavy Chain) CAI 0.978 0.755 0.978 0.973 0.973 0.919 0.973 (Light Chain) Weeks to 14 ~15 10 8.5 8.5 7.5 8 generate final line in 96 well Non-Fed 0.5 g 0.9 g 0.9 g 0.4 g 0.5 g 0.6 g 2.2 g Production (100%) (100%) (10%) (10%) (10%) (10%) (10%) Bioreactor Model (% MTX)
(80) TABLE-US-00003 TABLE 5 Titre comparison of non-amplified clones generated by standard transfection and selection protocol and then selected on nucleoside withdrawal and G418 addition. All cell lines contain the same vectors expressing the same antibody (of project 5) but from open reading frames encoding with differing CAI scores. For project 5 (a) (non-optimised) three further transfections were performed but are not shown as results were essentially background. In Figure (A) % titre > 5 ng refers to the % of wells after screening recording above 5 ng/ml. % titre > 50 ng/ml refers to the % of wellsscreened recording above 50 ng/ml. Top titre refers to the highest scoring titre of all screened. 50.sup.th Value refers to the 50.sup.th best titre screened. 20.sup.th value refers to the 20.sup.th best titre screened. In (B), the average results for Top, 20.sup.th and 50.sup.th titres reported in (A) are represented in histogram format. % with % with HC CAI LC CAI titre > titre > Top 50.sup.th 20.sup.th Transfection SCORE SCORE 5 ng/ml 50 ng/ml titre value value 1 0.809 0.761 23 0 43 6 8 2 0.809 0.761 26 0 16 5 6 3 0.809 0.761 26 0 23 6 7 4 0.847 0.833 43 7 376 2 17 5 0.847 0.833 62 24 778 9 76 6 0.872 0.894 47 20 674 23 105 7 0.872 0.894 63 30 923 12 103 8 0.982 0.976 57 25 706 46 178 9 0.982 0.976 82 61 653 80 171
(81) TABLE-US-00004 TABLE 3 Detailed titre analysis in 96-well plates of the projects shown in Table 1. Titre of the best and the 50.sup.th best clone is shown after G418 addition and nucleoside withdrawal selection but with no methotrexate addition. Promoter used to Codon drive expression of Top Titre 50th Titre Project Adaptation? antibody ORFs (ng/ml) (ng/ml) 2 No RSV 130 2 (22nd) 3 No RSV 71 12 4 No RSV 152 22 5 (a) No RSV 43 6 5 (d) Yes RSV 653 80 6 (a) No RSV 116 14 6 (b) Yes RSV 840 89 6 (c) No EF-1a 1153 87 6 (d) Yes EF-1a 2499 1426 7 (a) Yes RSV 830 50 7 (b) Yes EF-1a 3467 528 8 Yes EF-1a 4090 739 9 Yes EF-1a 3108 573
(82) TABLE-US-00005 TABLE 4 The top 20-100 clones as observed in projects 5 and 6 were then scaled into 6-well dishes before being re-plated into 96-wells in media containing 5 nM methotrexate. The mean and high titres of growing clones observed in experiments 5 and 6 selected at 5 nM (A1) and 50 nM (A2) concentrations of the methotrexate antifolate in 96-well dishes are shown below. A1 5 nm MTX A2 50 nm MTX Project Mean Titre Max Titre Mean Titre Max Titre 5 (a) 42 253 137 452 5 (d) 626 1760 1130 9500 6 (a) 134 316 129 809 6 (b) 761 6340 2525 15030 6 (c) 593 2592 949 3884 6 (d) 1012 5075 3017 12360
(83) TABLE-US-00006 TABLE 2 Examples of production plateaus: Example (A) the final chosen clone for Project 5 (d) was amplified further in 50 nM MTX. The unfed production models titres of parent clone (shaded) and resulting highest titre of amplified daughter clones are shown. Similar examples (B, C, D, E, F, G) also shown. For each example the highest titre of daughter clone after further amplification is recorded. This demonstrates that reaching higher titres earlier is more beneficial than attempting to reach higher titres through further rounds of amplification. Production % change in Model production model 96-well end-point end-point titre MTX titres titres after further Example Cell Line levels (ng/ml) (mg/l) amplification Example A: 097-7 5 nM 880 690 Chosen Clone 097-7-1 50 nM 6700 550 20% Project 5 (d) 097-7-3 50 nM 3300 216 69% 097-7-5 50 nM 3100 615 11% 097-7-6 50 nM 1900 566 18% Example B: P100-1 5 nM 2025 901 Chosen Clone P100-1-8 50 nM 4570 499 45% Project 6 (d) Example C: P100-6 5 nM 1435 468 Non-chosen clone P100-6-8 50 nM 5650 125 73% Project 6 (d) Example D: P634-2 5 nM 3205 692 Non-chosen clone P634-2-4 50 nM 3685 369 47% Project 6 (d) Example E: P502-1 5 nM 2385 357 Non-chosen clone P502-1-4 50 nM 5325 157 56% Project 6 (d) Example F: C65-5 5 nM 5700 400 Chosen Clone C65-5-7 50 nM 4515 168 58% Project 7 (a) Example G: 74-3 5 nM 2125 488 Chosen Clone 74-3-3 50 nM 820 239 51% Project 7 (b)
Example 3, Antibodies 6 and 7 and EF-1a Promoter
(84) Codon-adaptation of the open reading frames of both the heavy and light chains for antibody 6 was carried out, again to generate final CAI scores across the ORFs of >0.9. (See Table 1). The wild-type/starting and codon-adapted open reading frames were expressed in RSV based promoter expression vectors as well as a human elongation-factor-1 alpha (EF-1a) promoter based expression vector in which cis acting insulator, enhancer and promoter expression elements are instead supplied from a non-viral promoter source. The results of this work again demonstrated that significantly less methotrexate was required to generate a final high producing cell line when the open reading frame of the desired protein were first codon-adapted. Indeed, transfection 6 (a) in which antibody 6 was encoded by non-adapted ORFs (ie. with CAI score of <0.9) was abandoned at 5 nM MTX stage prior to the generation of cells nearing a plateau of production. The amplification regime was not pursued further in transfection 6 (a) because it was evident that significant more resource and time would have been required to generate cell lines capable of producing equivalent yields of protein relative the yields already obtained from cell lines in which ORFs of >0.9 had been employed (ie transfections 6 (b) and 6 (d). Furthermore, when comparing like-for-like vectors plus or minus codon adaptation, it was observed that codon-adaptation always reduced antifolate levels required. Again, for project 7, codon adaptation was carried out in a similar manner to project 6 (see Table 1) and the codon adapted ORFs (CAI>0.9) were expressed in an RSV as well as in an EF-1a promoter based expression vector. Once again, and irrespective of promoter, equivalent high yielding cell lines were generated in a faster time and with less methotrexate from CAI adapted ORFs when compared to all previous projects in which non-adapted ORFs were employed to encode the recombinant products (summarised in Table 1).
Example 4, mRNA Levels
(85) To further investigate this methodology the impact of codon adaptation on the levels of mRNA generated was investigated in like-for-like polyclonal cell populations expressing the same product (the antibody of project 5) from the same vectors but from open reading frames reporting differing CAI scores.
(86) CHO Cells were co-transfected with heavy chain (HC) and light chain (LC) encoding expression vectors encoding the same protein product (antibody of project 5). Each transfected population was maintained as polyclonal pools. Each vector pair encodes the same antibody heavy chain (HC) and light chain (LC) but from open reading frames with differing CAI scores.
(87) The results of this experiment are captured in
(88)
(89) (A): Intracellular RNA levels of HC and LC message measured by RT Q-PCR: All signals normalised to ribosomal RNA and fold increases are relative to signals generated for starting HC and LC vectors encoded by the non-codon adapted open reading frames. Y-axis: Values range from 0 to 50-fold increase in RNA signal. X axis: a (h) denotes negative control HC signal generated from RNA extracts taken from non-transfected cells (in duplicate); b (h) denotes HC signal generated from RNA extracts derived from cells transfected with non-codon adapted HC and LC expression vectors, as used for project 5 (a) (CAI scores of 0.809 for HC and 0.761 for LC); c (h) denotes HC signal generated from RNA extracts derived from cells transfected with codon adapted HC and LC expression vectors, as used for project 5 (b) (CAI scores of 0.847 for HC and 0.833 for LC); d (h) denotes HC signal generated from RNA extracts derived from cells transfected with further codon adapted HC and LC expression vectors, as used for project 5 (c) (CAI scores of 0.872 for the HC and 0.894 for the LC). Light chain signals generated from the same RNA extracts as described above are shown as a(l), b(l), c(l) and d(l) respectively.
(B): Western Blot Analysis; Equivalent cell extracts were separated by SDS-Page, blotted and interrogated with anti-product antibodies (HRP conjugated). Control of non-transfected cells is shown in lane 1. Polyclonal cells expressing product heavy and light chain open reading frames as follows; Lane 2 and 3; HC with 0.809 CAI score and LC with 0.761 CAI score (protein expressed from experiment b(h) and b(l) above, vectors equivalent as those used in project 5 (a); Lane 4 and 5; HC with 0.847 CAI score and LC with 0.833 CAI score (protein expressed from experiment c (h) and c (l) above, vectors equivalent as those used in project 5 (b); Lanes 6 and 7; HC with 0.872 CAI score and LC with 0.894 CAI score (protein expressed from experiment d (h) and d (l) above, vectors equivalent as those used in project 5 (c); Lanes 8 and 9; HC with 0.982 CAI score and LC with 0.976 CAI score (protein expressed by vectors equivalent as those used in project 5 (d).
(C); 24-hour product titres reported in ng/ml for polyclonal cells described in
Example 5, Different Methods to Achieve High CAI. Example (a) Project 8 and Example (b) Project 9
(90) a) For project 8 the Leto software was used to design the variable domains. These were then fused to the identical constant domains previously generated for project 7 with aid of standard restriction enzyme digest and ligation methodology. The resulting heavy chain and light chain ORFs scored 0.954 and 0.919 respectively. These were then employed in a cell line development project and once again we generated high yielding cell lines in a faster time frame and with less methotrexate than ever previously employed prior to codon adaptation (see Table 1).
b) For project 9 again the Leto software was used to design the variable domains. These were then fused to the identical constant domains previously generated for project 6 (d) with aid of standard restriction enzyme digest and ligation methodology. The resulting heavy chain and light chain ORFs scored 0.975 and 0.973 respectively. These were then employed in a cell line development project and once again we generated high yielding cell lines in a faster time frame and with less methotrexate than ever previously employed prior to codon adaptation (see Table 1).
Example 6Impact Upon Glycosylation
(91) It was noted that the levels of non-glycosylated heavy chain (NGHC) were significantly lower when expressed from codon-adapted open reading frames relative to levels generated when expressed from non-adapted open reading frames even though the same host, culture media and DHFR selection and amplification system were employed for the expression in both situations. Even more interestingly similar high levels of NGHC were also observed when the same non-adapted open reading frames were instead expressed in different host cells employing in different culture conditions and different vector, selection and amplification regime (Glutamine Synthetase/MSX) (see
(92) 6.1 Cell Line Development with the Lonza CHOK1SV and Glutamine Synthetase Selection System (
(93) Vector construction and cell line development were undertaken according to the recommended Lonza (Slough) protocols. The media employed at all times was CD-CHO (Invitrogen). Open reading frames employed in antibody project 5 (a) containing non-adapted open reading frames were first sub-cloned into the Lonza vectors pEE14.4 (for the light chain) and pEE6.4 (for the heavy chain). These vectors were then combined according to the recommended Lonza protocol into a single double gene vector expressing heavy and light chains. This vector was then delivered to the Lonza suspension adapted CHOK1 strain named CHOK1SV host cells using electroporation as per Lonza recommended instructions and selected and amplified with glutamine withdrawal and with the addition of MSX also as recommended. The resulting clones were titred at 96-well and the best scaled-up into shake flasks and further evaluated. The best clone was selected to make product in large-scale bioreactors. For further general details on this approach see de La Cruz Edmonds et al 2006 Molecular Biotechnology 34:179-190)
(94) 6.2 Product NGHC Analyses
(95) Protein was purified from culture supernatant with aid of protein A columns. The product was subsequently analysed with SDS capillary electrophoresis lab-on-a-chip equipment (Agilent Technologies, Cheshire UK) under reducing conditions and according to manufacturer's protocol. The non-glycosylated heavy chain is observed as a slightly faster migrating species relative to the main glycosylated heavy chain species (See
(96)
Example 7 Impact on Levels of Selection and Amplification Agents in the Final Cell Lines
(97) The addition or stepwise titration of increasing amounts of the MTX selection and amplification agent in the DHFR selection system is undertaken in order to augment expression by increasing gene copy number. To investigate the impact of codon adaptation on the gene copy number of the transfected plasmid DNA, two different semi-quantitative methodologies were employed (see sections 1.13 and 1.14 for the description of the experiments).
(98) Firstly FACS analysis was used. For this purpose the final cell lines or single cell clones thereof for projects 2, 3, 4, 5 (d), 6 (d) and 7 (b) were stained with fluorescent methotrexate and analysed by FACS. The results (shown in
(99) The results discussed above demonstrate that cell lines derived from the codon adapted ORFs (projects 5 (d), 6 (d), 7 (b) and 9 for this example) have lower gene copy number compared to lines derived from non adapted ORFs (projects 2, 3, 4, 5 (a) for this example). The use of codon adapted ORFs (CAI>0.9) therefore results in the generation of cell lines (when compared to cell lines derived from the non-adapted ORFs) with equal or higher titres, with lower levels of amplification and lower copy number of transfected DNA. The generation of clones making equivalent or higher levels of antibody from lower copy number, less amplified expression vectors is highly desirable. For example it has been shown that repeat-induced gene silencing (RIGS) can be induced when copy number of an integrated expression vector is increased and that such RIGS can then result in reduced expression levels from such vectors in mammalian cells (eg see McBurney M W et al Exp Cell Res 2002 274:1-8).
(100)
(101) TABLE-US-00007 Sequence Listing SEQ ID NO. DESCRIPTION OF SEQUENCE 1 18S RNA probe - nucleotide 2 Primer 1 3 Primer 2: 4 Heavy Chain probe: 5 Primer 1: 6 Primer 2: 7 Light chain probe 8 Primer 1: 9 Primer 2: 10 Non-adapted heavy chain of project 5 with a CAI score of 0.809 and employed in project 5(a) 11 Non-adapted light chain of project 5 with a CAI score of 0.761 and employed in project 5(a) 12 Heavy Chain ORF of project 5 with increased CAI score (0.847): See Table 5 and FIG. 6. This sequence was employed in Project 5 (b) 13 Light Chain ORF of project 5 with increased CAI score (0.833): See Table 5 and FIG. 6 This sequence was employed in project 5 (b) 14 Heavy Chain ORF of project 5 with increased CAI score (0.872). This sequence was employed in antibody project 5 (c). 15 Light Chain ORF of project 5 with increased CAI score (0.894). This sequence was employed in antibody project 5 (c). 16 Heavy Chain ORF of project 5 with increased CAI score (0.982). This sequence was employed in antibody project 5 (d). 17 Light Chain ORF of project 5 with increased CAI score (0.976). This sequence was employed in antibody project 5 (d). 18 candidate (H2L1) heavy chain 19 candidate (H2L1) light chain 20 Primer 1: 21 Primer 2: 22 DHFR Probe: 23 Primer 1: 24 Primer 2 25 Neo Probe:
(102) TABLE-US-00008 SEQIDNO.1 5-VIC-tggctgaacgccacttgtccctctaaa-TAMRA-3. SEQIDNO.2 5-aggaattgacggaagggcac-3. SEQIDNO.3 5-ggacatctaagggcatcaca-3 SEQIDNO.4 5-FAM-ctccggctgcccattgctctcc-TAMRA-3. SEQIDNO.5 5-ggaggcgtggtcttgtagttg-3. SEQIDNO.6 5-ggcttctatcccagcgacatc-3. SEQIDNO.7 5-FAM-tctcgtagtctgctttgctcagcgtca-TAMRA-3. SEQIDNO.8 5-cttcgcaggcgtagactttgt-3. SEQIDNO.9 5-gccctccaatcgggtaactc-3 SEQIDNO.10 ATGGAGTTGGGGCTGTGCTGGGTTTTCCTTGTTGCTATTTTAGAAGGTGT CCAGTGTGAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTG GGGGGTCCCTGAGACTCTCCTGTGCAGTCTCTGGATTCACCTTCAGTGAC AACGGAATGGCGTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGT TTCATTCATTAGTAATTTGGCATATAGTATCGACTACGCAGACACTGTGA CGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCACTGTATCTG CAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGTCAG CGGGACCTGGTTTGCTTACTGGGGCCAGGGCACACTAGTCACAGTCTCCT CAGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTT CCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCG TGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTG CAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC CCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA CTCGCGGGGGCACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACAC CCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGA GCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAG GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTA CCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAG AAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACAC CCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCT GCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTC CGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA SEQIDNO.11 ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAATGCTCTGGGTCTCTGG ATCCAGTGGGGATATTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCA CCCCTGGAGAGCCGGCCTCCATCTCCTGCAGAGTTAGTCAGAGCCTTTTA CACAGTAATGGATACACCTATTTACATTGGTACCTGCAGAAGCCAGGGCA GTCTCCACAGCTCCTGATCTATAAAGTTTCCAACCGATTTTCTGGGGTCC CTGACAGGTTCAGTGGCAGTGGATCAGGCACAGATTTTACACTGAAAATC AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCTCTCAAACTAG ACATGTTCCGTACACGTTCGGCGGAGGGACCAAGGTGGAAATCAAACGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTG AAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAG AGAGGCCAAAGTACAGTGGAAGGTGGACAACGCCCTCCAATCGGGTAACT CCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTC AGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCT TCAACAGGGGAGAGTGT SEQIDNO.12 ATGGAGCTCGGGCTGTGCTGGGTGTTCCTCGTGGCCATCCTGGAGGGAGT GCAGTGTGAGGTGCAGCTGGTGGAGAGTGGGGGCGGCCTGGTGCAGCCCG GCGGCAGCCTGCGGCTGTCGTGCGCCGTGAGCGGCTTCACCTTCAGTGAC AACGGCATGGCTTGGGTCAGGCAGGCCCCCGGAAAGGGGCTCGAGTGGGT GAGCTTCATCAGTAACCTGGCCTACAGTATCGACTATGCTGACACCGTGA CCGGCCGCTTCACTATCTCTCGGGATAATGCTAAGAACAGCCTGTACCTC CAGATGAACAGCCTGCGCGCTGAGGACACCGCCGTGTACTACTGCGTGTC TGGAACCTGGTTCGCCTACTGGGGCCAGGGTACACTAGTCACAGTCTCCT CAGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTT CCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCG TGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTG CAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC CCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA CTCGCGGGGGCACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACAC CCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGA GCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAG GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTA CCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAG AAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACAC CCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCT GCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTC CGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA SEQIDNO.13 ATGCGCCTGCCTGCCCAGCTGCTCGGCCTGCTGATGCTGTGGGTGTCGGG CAGCTCCGGCGACATCGTCATGACCCAGAGCCCCCTGAGTCTCCCCGTCA CCCCCGGCGAACCTGCCAGCATCAGCTGCAGGGTGTCCCAGTCGCTGCTC CATTCCAACGGGTACACGTACCTGCATTGGTACCTGCAGAAGCCCGGGCA ATCCCCTCAGCTGCTGATCTACAAGGTGAGCAACCGCTTCTCCGGCGTCC CGGACCGGTTCAGTGGCAGCGGCTCTGGAACCGACTTCACCCTGAAAATC AGCCGCGTGGAAGCTGAGGACGTGGGCGTCTACTACTGCAGCCAGACCCG GCATGTGCCCTACACCTTCGGCGGCGGCACAAAGGTGGAGATCAAGCGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTG AAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAG AGAGGCCAAAGTACAGTGGAAGGTGGACAACGCCCTCCAATCGGGTAACT CCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTC AGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCT TCAACAGGGGAGAGTGT SEQIDNO.14 ATGGAGCTGGGCCTGTGCTGGGTGTTCCTGGTGGCCATCCTGGAGGGCGT GCAGTGCGAGGTGCAGCTGGTGGAGAGCGGCGGCGGCCTGGTGCAGCCCG GCGGCAGCCTGCGCCTGAGCTGCGCCGTGAGCGGCTTCACCTTCAGCGAC AACGGCATGGCCTGGGTGCGCCAGGCCCCCGGCAAGGGCCTGGAGTGGGT GAGCTTCATCAGCAACCTGGCCTACAGCATCGACTACGCCGACACCGTGA CCGGCCGCTTCACCATCAGCCGCGACAACGCCAAGAACAGCCTGTACCTG CAGATGAACAGCCTGCGCGCCGAGGACACCGCCGTGTACTACTGCGTGAG CGGCACCTGGTTCGCCTACTGGGGCCAGGGCACACTAGTCACAGTCTCCT CAGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTT CCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCG TGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTG CAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC CCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA CTCGCGGGGGCACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACAC CCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGA GCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAG GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTA CCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAG AAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACAC CCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCT GCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTC CGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA SEQIDNO.15 ATGCGCCTGCCCGCCCAGCTGCTGGGCCTGCTGATGCTGTGGGTGAGCGG CAGCAGCGGCGACATCGTGATGACCCAGAGCCCCCTGAGCCTGCCCGTGA CCCCCGGCGAGCCCGCCAGCATCAGCTGCCGCGTGAGCCAGAGCCTGCTG CACAGCAACGGCTACACCTACCTGCACTGGTACCTGCAGAAGCCCGGCCA GAGCCCCCAGCTGCTGATCTACAAGGTGAGCAACCGCTTCAGCGGCGTGC CCGACCGCTTCAGCGGCAGCGGCAGCGGCACCGACTTCACCCTGAAGATC AGCCGCGTGGAGGCCGAGGACGTGGGCGTGTACTACTGCAGCCAGACCCG CCACGTGCCCTACACCTTCGGCGGCGGCACCAAGGTGGAGATCAAGCGTA CGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTG AAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAG AGAGGCCAAAGTACAGTGGAAGGTGGACAACGCCCTCCAATCGGGTAACT CCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTC AGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCT TCAACAGGGGAGAGTGT SEQIDNO.16 ATGGAGCTGGGCCTGTGCTGGGTGTTCCTGGTGGCCATCCTGGAGGGCGT GCAGTGCGAGGTGCAGCTGGTGGAGTCTGGCGGCGGACTGGTGCAGCCTG GCGGCAGCCTGAGACTGAGCTGTGCCGTGTCCGGCTTCACCTTCAGCGAC AACGGCATGGCCTGGGTGAGGCAGGCCCCTGGCAAGGGCCTGGAGTGGGT GTCCTTCATCAGCAACCTGGCCTACAGCATCGACTACGCCGACACCGTGA CCGGCAGATTCACCATCAGCCGGGACAACGCCAAGAACAGCCTGTACCTG CAGATGAACAGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGTGTGAG CGGCACCTGGTTCGCCTACTGGGGCCAGGGCACCCTGGTGACCGTGTCCA GCGCCAGCACCAAGGGCCCCAGCGTGTTCCCCCTGGCCCCCAGCAGCAAG AGCACCAGCGGCGGCACAGCCGCCCTGGGCTGCCTGGTGAAGGACTACTT CCCCGAACCGGTGACCGTGTCCTGGAACAGCGGAGCCCTGACCAGCGGCG TGCACACCTTCCCCGCCGTGCTGCAGAGCAGCGGCCTGTACAGCCTGAGC AGCGTGGTGACCGTGCCCAGCAGCAGCCTGGGCACCCAGACCTACATCTG TAACGTGAACCACAAGCCCAGCAACACCAAGGTGGACAAGAAGGTGGAGC CCAAGAGCTGTGACAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAG CTGGCCGGAGCCCCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACAC CCTGATGATCAGCAGAACCCCCGAGGTGACCTGTGTGGTGGTGGATGTGA GCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTGGAG GTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGCACCTA CCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCA AGGAGTACAAGTGTAAGGTGTCCAACAAGGCCCTGCCTGCCCCTATCGAG AAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCCCAGGTGTACAC CCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAGGTGTCCCTGACCT GCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGC AACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAG CGATGGCAGCTTCTTCCTGTACAGCAAGCTGACCGTGGACAAGAGCAGAT GGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGCCCTGCAC AATCACTACACCCAGAAGAGCCTGAGCCTGTCCCCTGGCAAG SEQIDNO.17 ATGAGACTGCCCGCCCAGCTGCTGGGCCTGCTGATGCTGTGGGTGTCCGG CAGCAGCGGCGACATCGTGATGACCCAGAGCCCCCTGAGCCTGCCCGTGA CCCCTGGCGAGCCCGCCAGCATCAGCTGTAGAGTGAGCCAGAGCCTGCTG CACAGCAACGGCTACACCTACCTGCACTGGTATCTGCAGAAGCCTGGCCA GAGCCCTCAGCTGCTGATCTACAAGGTGTCCAACCGGTTCAGCGGCGTGC CTGATAGATTCAGCGGCAGCGGCTCCGGCACCGACTTCACCCTGAAGATC AGCAGAGTGGAGGCCGAGGATGTGGGCGTGTACTACTGCTCCCAGACCAG ACACGTGCCTTACACCTTTGGCGGCGGAACAAAGGTGGAGATCAAGCGTA CGGTGGCCGCCCCCAGCGTGTTCATCTTCCCCCCCAGCGATGAGCAGCTG AAGAGCGGCACCGCCAGCGTGGTGTGTCTGCTGAACAACTTCTACCCCCG GGAGGCCAAGGTGCAGTGGAAGGTGGACAATGCCCTGCAGAGCGGCAACA GCCAGGAGAGCGTGACCGAGCAGGACAGCAAGGACTCCACCTACAGCCTG AGCAGCACCCTGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTA CGCCTGTGAGGTGACCCACCAGGGCCTGTCCAGCCCCGTGACCAAGAGCT TCAACCGGGGCGAGTGC SEQIDNO18 EVQLVESGGGLVQPGGSLRLSCAVSGFTFSDNGMAWVRQAPGKGLEWVSF ISNLAYSIDYADTVTGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVSGT WFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQIDNO19 DIVMTQSPLSLPVTPGEPASISCRVSQSLLHSNGYTYLHWYLQKPGQSPQ LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQTRHVP YTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC SEQIDNO20 GAGGCAGTTCTGTTTACCAGGAA SEQIDNO21 CCTGCATGATCCTTGTCACAA SEQIDNO22 Cy5-CCATGAATCAACCAGGCCACCTCAG-BBq SEQIDNO23 GCCCGGTTCTTTTTGTCAAG SEQIDNO24 CTGCCTCGTCCTGCAGTTC SEQIDNO25 Cy5-CCGACCTGTCCGGTGCCCTG-BBq