METHOD FOR THE PREPARATION OF (3E,7E)-HOMOFARNESIC ACID OR (3E,7E)-HOMOFARNESIC ACID ESTER

20200123586 ยท 2020-04-23

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention provides an improved method of isolating the 3-(E)-isomer of an unsaturated carboxylic acid from a mixture of corresponding (E/Z)isomers. More particularly, the present invention relates to an improved method for the biocatalytic preparation of (3E,7E)-homofarnesylic acid; as well as a novel biocatalytic method for the improved preparation of homofarnesol, in particular of (3E,7E)-homofarnesol and homofarnesol preparations having an increased content of (3E,7E)-homofarnesol. The present invention also relates to methods of preparing()-ambroxby applying (3E,7E)-homofarnesylic acid or (3E,7E)-homofarnesol as obtained according to the invention as starting material.

    Claims

    1-19. (canceled)

    20. A method for isolating the 3-(E)-isomer of an unsaturated carboxylic acid compound of the general formula (I) ##STR00014## wherein R.sup.1 is H or a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20 hydrocarbyl residue; R.sup.3 is H or a C.sub.1-C.sub.4-hydrocarbyl residue; R.sup.2 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue; with the proviso that, if R.sup.3 is a C.sub.1-C.sub.4-hydrocarbyl residue, R.sup.2 represents an hydrocarbyl residue containing at least one additional carbon atom; from a mixture of isomers comprising the 3-(E)- and 3-(Z)-isomer of said carboxylic acid compound, whereby said mixture of isomers is subjected to a lipase (E.C. 3.1.1.3) catalyzed enzymatic conversion reaction, which lipase preferentially converts said 3-(E)-isomer, and the conversion product of said 3-(E)-isomer is isolated from said reaction mixture.

    21. The method of claim 20, wherein said lipase originates from Candida sp., in particular Candida antarctica.

    22. The method of claim 21, wherein said lipase is Candida antarctica lipase B (CALB) comprising an amino acid sequence of SEQ ID NO: 330, or a mutant thereof having a sequence identity of at least 60% to SEQ ID NO: 330 and retaining said 3-(E)-selectivity.

    23. The method of claim 20, wherein said conversion reaction comprises an enzymatic esterification reaction of an acid of the formula (Ia); ##STR00015## wherein R.sup.2 and R.sup.3 are as defined above; and wherein the 3-(E)-ester is predominantly formed.

    24. The method of claim 20, wherein said conversion reaction comprises an enzymatic ester cleavage reaction of an ester of the formula (Ib); ##STR00016## wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-, in particular C.sub.4-C.sub.20-, hydrocarbyl residue; and R.sup.2 and R.sup.3 are as defined above; and wherein the 3-(E)-acid is predominantly formed.

    25. The method of claim 20, wherein said conversion reaction is performed in an organic solvent or aqueous-organic solvent.

    26. The method of claim 20, wherein said carboxylic acid compound is a 3-(E)/7-(E)-homofarnesoic acid compound of formula (II) ##STR00017## wherein R.sup.1 is as defined above.

    27. A method of preparing an unsaturated 3-(E)-carboxylic acid of the general formula (Ia): ##STR00018## wherein R.sup.2 and R.sup.3 are as defined above; wherein a) an isomer mixture, comprising the 3-(E)- and the 3-(Z)-isomer of said carboxylic acid of formula (Ia) is subjected to an enzymatic esterification reaction in the presence of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue; and in the presence of a lipase enzyme as defined in claim 20; b) said 3-(E)-carboxylic ester as formed in step a) is isolated; and c) said isolated ester of step b) is saponified to the corresponding 3-(E)-carboxylic acid of formula (Ia).

    28. A method of preparing an unsaturated 3-(E)-carboxylic acid of the general formula (Ia): ##STR00019## wherein R.sup.2 and R.sup.3 are as defined above; wherein a) an isomer mixture, comprising the 3-(E)- and the 3-(Z)-isomer of a carboxylic acid ester of formula (Ib) ##STR00020## wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue; and R.sup.2 and R.sup.3 are as defined above; is subjected to an enzymatic ester cleavage reaction in the presence of a lipase enzyme as defined in claim 20; b) said 3-(E)-carboxylic acid as formed in step a) is isolated.

    29. The method of claim 27, wherein an organic solvent as defined in claim 25 is applied.

    30. The method of claim 20, wherein said 3-(E)-isomer of an unsaturated carboxylic acid is 3-(E)/7-(E)-homofarnesoic acid.

    31. The method of claim 20 wherein said isomer mixture comprises a mixture of 3-(E)/7-(E)-homofarnesoic acid and 3-(Z)/7-(E)-homofarnesoic acid; or a mixture of 3-(E)/7-(E)-homofarnesoic acid ester and 3-(Z)/7-(E)-homofarnesoic acid ester of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue.

    32. The method of claim 31 for preparing 3-(E)/7-(E)-homofarnesoic acid wherein a) an isomer mixture, comprising 3-(E)/7-(E)-homofarnesoic acid and 3-(Z)/7-(E)-homofarnesoic acid is subjected to an enzymatic esterification reaction in the presence of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue; and in the presence of a lipase enzyme as defined in claim 1 in a solvent as defined in claim 25; b) said 3-(E)/7-(E)-homofarnesoic acid ester as formed in step a) is separated from unreacted acid, in particular by distillation or, preferably, extraction; and c) said isolated 3-(E)/7-(E)-homofarnesoic acid ester is saponified to 3-(E)/7-(E)-homofarnesoic acid.

    33. The method of claim 31 for preparing 3-(E)/7-(E)-homofarnesoic acid wherein a) an isomer mixture, comprising 3-(E)/7-(E)-homofarnesoic acid ester and 3-(Z)/7-(E)-homofarnesoic acid ester is subjected to an enzymatic ester cleavage reaction in the presence of a lipase enzyme as defined in claim 1 in a solvent as defined in claim 25, and in particular in the presence of water; and b) said 3-(E)/7-(E)-homofarnesoic acid as formed in step a) is separated from unreacted ester, in particular by distillation or, preferably, extraction.

    34. A method of preparing ()-ambrox of the formula (III) ##STR00021## comprising the steps of a) obtaining said 3-(E)/7-(E)-homofarnesoic acid by applying a method as defined in claim 20; b) chemically reducing 3-(E)/7-(E)-homofarnesoic acid to 3-(E)/7-(E)-homofarnesol and c) enzymatically cycling of 3-(E)/7-(E)-homofarnesol to ()-ambrox.

    35. A method of preparing ()-ambrox of the formula (III) ##STR00022## comprising the steps of a) obtaining said 3-(E)/7-(E)-homofarnesoic acid by applying a method as defined in claim 20, b) enzymatically cycling of 3-(E)/7-(E)-homofarnesoic acid to sclareolide of the formula (IV) ##STR00023## and c) chemically converting said sclareolide to ()-ambrox.

    36. The method of claim 34, wherein the enzymatic cyclization is performed in the presence of an intramolecular transferase (E.C. 5.4), in particular a squalene-hopene cyclase (E.C. 5.4.99.17) showing homofarnesoic acid cyclase activity

    37. The method of claim 36, wherein said cyclase is from Zymomonas mobilis, comprising an amino acid sequence according to SEQ ID NO:2 or an amino acid sequence having at least 60% sequence identity to SEQ ID NO:2.

    38. 3-(E)/7-(E)-homofarnesoic acid alkyl ester, wherein said alkyl group is selected from n-propyl, isopropyl, n-butyl, 2-butyl or isobutyl, as well as pentyl, hexyl, heptyl, octyl, and their constitutional isomers.

    Description

    DETAILED DESCRIPTION OF THE INVENTION

    1. General Definitions

    [0013] In the absence of information to the contrary the following general definitions shall apply:

    [0014] Homofarnesylic acid or homofarnesoic acid are synonyms for (3E,7E)-4,8,12-trimethyltrideca-3,7,11-trienic acid or (3Z,7E)-4,8,12-trimethyltrideca-3,7,11-trienic acid or mixtures of said E/Z isomers.

    [0015] Sclareolid is used as synonym for (3aR,5aS,9aS,9bR)-3a,6,6,9a-tetramethyl-1,4,5,5a,7,8,9,9b-octahydrobenzo[e]benzofuran-2-one.

    [0016] Left-handed sclareolide shows the following structural formula:

    ##STR00003##

    [0017] Ambrox, Ambroxan and Ambroxid are used as synonyms. They include all stereoisomeric forms, such as, in particular. (+) Ambrox, 3a-epi-()Ambrox, 9b-epi-() Ambrox and in particular () Ambrox.

    [0018] According to the invention, the term lipase means enzymes of class E.C. 3.1.1.3 according to the IUBMB enzyme nomenclature (www.iubmb.unibe.ch; www.chem.qmul.ac.uk/iubmb/enzyme/).

    [0019] According to a special embodiment of the method according to the invention, the lipase is lipase B, the gene product of CALB from Candida antarctica. The CALB gene was described previously (Uppenberg J., Hansen, M. T., Patkar, S., Jones, A., Structure 2: 293-308 (1994)) and its nucleotide or protein sequence was deposited under the access numbers Z30645 and CAA83122.1 at GenBank. Unless designated more precisely, here CALB means a nucleotide sequence with this access number. Another example of a triacylglycerol lipase is lipase B from Pseudozyma tsukubaensis (Suen, W. C., Zhang, N., Xiao, L, Madison, V., Zaks, A. Protein Eng. Des. Sel. 17(2): 133-40 (2004)).

    [0020] For the purposes of the present invention; cyclases are generally enzymes or enzyme mutants, which in particular exhibit the activity of a homofarnesylic acid cyclase and/or of a homofarnesol cyclase. As enzymes with the activity of a homofarnesylic acid cyclase or homofarnesol cyclase are intramolecular transferases from the subclass of the isomerases; i.e. proteins with the EC number EC 5.4 are suitable. (Enzyme code according to Eur. J. Biochem, 1999, 264, 610-650). In particular, these are members of the class EC 5.4,99,17, Suitable enzymes having the activity of a homofamesylic acid cyclase or homofarnesol cyclase are, in particular, those cyclases which also effect the cyclization of homofarnesylic acid to sclareolide and/or of squalene to hopene (hence also sometimes referred to as SHC or squalene-hopene cyclase) and which are described extensively in the International Patent Application WO2010139719, which is incorporated herein by reference. Mutants thereof are, for example, described in WO 2012/066059, which is expressly incorporated herein by reference.

    [0021] The term cyclase activity describes an enzyme activity determined with a reference substrate under standard conditions, and which describes the formation of a cyclic product from a non-cyclic substrate. Standard conditions are e.g. substrate concentrations of 10 mM to 0.2 M, especially 15 to 100 mM, e.g. about 20 to 25 mM; at pH 4 to 8, and at temperatures of e.g. 15 to 30 or 20 to 25 C. The determination can be carried out with recombinant cyclase-expressing cells, digested cyclase-expressing cells, fractions thereof or enriched or purified cyclase enzyme. In particular, a reference substrate is a (3E,7E)-homofarnesylic acid.

    [0022] Yield and/or the conversion rate of a reaction according to the invention is determined over a defined period of, for example, 4, 6, 8, 10, 12, 16, 20, 24, 36 or 48 hours, in which the reaction takes place. In particular, the reaction is carried out under precisely defined conditions, for example at 25, 30, 40, 50 or 60 C.

    [0023] An enzymatically catalyzed or biocatalytic method means that said method is performed under the catalytic action of an enzyme, including enzyme mutants, as herein defined. Thus the method can either be performed in the presence of said enzyme in isolated (purified, enriched) or crude form or in the presence of a cellular system, in particular, natural or recombinant microbial cells containing said enzyme in active form, and having the ability to catalyze the conversion reaction as disclosed herein.

    [0024] The terms selectively converting or increasing the selectivity in general means that a particular stereoisomeric form, i.p. the 3E-form, of an unsaturated carboxylic acid as herein defined, is converted in a higher proportion or amount (compared on a molar basis) than the corresponding 3Z-form, either during the entire course of said reaction (i.e. between initiation and termination of the reaction), at a certain point of time of said reaction, or during an interval of said reaction. In particular, said selectivity may be observed during an interval corresponding 1 to 99%, 2 to 95%, 3 to 90%, 5 to 85%, 10 to 80%, 15 to 75%, 20 to 70%, 25 to 65%, 30 to 60, or 40 to 50% conversion of the initial amount of the substrate. Said higher proportion or amount may, for example, be expressed in terms of:

    [0025] a higher maximum yield of the 3E-isomer observed during the entire course of the reaction or said interval thereof;

    [0026] a higher relative amount of the 3E-isomer at a defined % degree of conversion value of the substrate; and/or

    [0027] an identical relative amount of the 3E-isomer at a higher % degree of conversion value; each of which preferably being observed relative to a reference method, said reference method being performed under otherwise identical condition with chemical means, as for example chemical esterification or chemical ester cleavage.

    [0028] The term about indicates a potential variation of 25% of the stated value, in particular 15%, 10%, preferably 5%, 2% or 1%.

    [0029] The term substantially describes a range of values of from about 80 to 100%, such as, for example, 85-99.9%, in particular 90 to 99.9%, preferably 95 to 99.9%, or 98 to 99.9% Especially 99 to 99.9%.

    [0030] Predominantly refers to a proportion in the range of above 50%, as for example in the range of 51 to 100%, preferably in the range of 75 to 99.9%; more particularly 85 to 98.5%, like 95 to 99%.

    [0031] Because of the reversibility of enzymatic reactions, the present invention relates to the enzymatic reactions described herein in both directions of reaction.

    [0032] Functional mutants of herein described enzymes include the functional equivalents of such enzymes as defined below.

    [0033] The term stereoisomers includes in particular conformational isomers.

    [0034] Included in general are, according to the invention, all stereoisomeric forms of the compounds described herein, such as constitutional isomers and, in particular, stereoisomers and mixtures thereof, e.g. optical isomers, or geometric isomers such as E and Z isomers, and combinations thereof. If several asymmetric centers are present in one molecule, the invention encompasses all combinations of different conformations of these asymmetry centers, e.g. enantiomeric pairs

    [0035] Stereoselectivity describes the ability to produce a particular stereoisomer of a compound in a stereoisomerically pure form or to specifically convert a particular stereoisomer in an enzymatically catalyzed method as described herein out of a plurality of stereoisomers. More specifically, this means that a product of the invention is enriched with respect to a specific stereoisomer. This may be quantified via the purity % ee-parameter calculated according to the formula:


    % ee=[X.sub.AX.sub.B]/[X.sub.A+X.sub.B]*100,

    wherein X.sub.A and X.sub.B represent the molar ratio (Molenbruch) of the stereoisomers A and B.

    [0036] E-stereoselectivity or E-selectivity describes the ability to produce an E-Isomer of an at least one-fold unsaturated at a particular CC-double bond in an E-isomerically pure or essentially pure or enriched form or to specifically or essentially specifically convert an E-isomer in an enzymatically catalyzed method as described herein out of a plurality of other isomers or a mixture of E- and Z-isomers at said particular position of the double-bond within s

    [0037] The above definition for stereoselectivity and its calculation applies in analogy also to the term enantioselecitivity

    [0038] Stereoisomeric or enantiomeric purities of at least 90% ee, like at least 95% ee, or at lest 98% ee, or at east 99% ee or more may be obtained according to the invention.

    [0039] Unless otherwise stated, the following general chemical definitions apply:

    [0040] The term carboxylic acid encompasses both the free acid and the salt form thereof, e.g. their alkali metal or alkaline earth metal salts. This applies accordingly to all carboxylic acids mentioned herein, in particular homofarnesylic acid.

    [0041] A linear or branched, saturated or non-saturated, hydrocarbyl residue according to the present invention particularly refers to linear or branched, alkyl or alkenyl residues.

    [0042] An alkyl residue comprises C.sub.1-C.sub.20-alkyl radicals which are linear or branched radicals having from 1 to 20 carbon atoms or C.sub.1-C.sub.4-alkyl radicals or C.sub.4-C.sub.20-alkyl radicals. Examples thereof are:

    [0043] C.sub.1-C.sub.4-alkyl radicals selected from methyl, ethyl, n-propyl, isopropyl, n-butyl, 2-butyl, isobutyl or tert-butyl, [0044] C.sub.1-C.sub.6-alkyl radicals selected from the C.sub.1-C.sub.4-alkyl radicals as defined above, pentyl, 1-methylbutyl, 2-methylbutyl, 3-methylbutyl, 2,2-dimethylpropyl, 1-ethylpropyl, hexyl, 1,1-dimethylpropyl, 1,2-dimethylpropyl, 1-methylpentyl, 2-methylpentyl, 3-methylpentyl, 4-methylpentyl, 1,1-dimethylbutyl, 1,2-dimethylbutyl, 1,3-dimethylbutyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl, 3,3-dimethylbutyl, 1-ethylbutyl, 2-ethylbutyl, 1,1,2-trimethylpropyl, 1,2,2-trimethylpropyl, 1-ethyl-1-methylpropyl, 1-ethyl-2-methylpropyl;

    [0045] C.sub.7-C.sub.20-alkyl radicals which are linear or branched radicals having from 7 to 20 carbon atoms; examples thereof being selected from heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl, tetradecyl, pentadecyl, hexadecyl, heptadecyl, octadecyl, nonadecyl, eicosyl, and their constitutional isomers, as for example 4,8-dimethynonyl.

    [0046] An alkenyl residue comprises C.sub.2-C.sub.20-alkenyl radicals which are mono- or polyunsaturated, in particular 1-, 2-, 3- or 4-fold, preferably 1-2- or 3-fold unsaturated linear or branched hydrocarbon radicals having from 2 to 20 carbon atoms.

    [0047] Examples of mono-unsaturated C.sub.2-C.sub.20-alkenyl residues, with a position of the double bond in any position within the hydrocarbon chain are vinyl, 2-propene-1-yl, 1-methylprop-2-ene-1-yl, 2-butene-1-yl, 3-butene-1-yl, n-pentenyl, n-hexenyl, n-heptenyl, n-octenyl, n-nonenyl, n-decenyl, n-undecenyl, n-dodecenyl, n-tridecenyl, n-tetradecenyl, n-pentadecenyl, n-hexadecenyl, n-heptadecenyl, n-octadecenyl, oleyl, n-nonadecenyl, n-eicosenyl;

    [0048] Examples of di- or tri-unsaturated C.sub.4-C.sub.20-alkenyl residues with two or three double, preferably non-cumulated and preferably non-conjugated bounds in a any position of the hydrocarbon chain are sind n-butadienyl, n-pentadienyl, n-hexadienyl, n-heptadienyl, n-octadienyl, n-octatrienyl, n-nonadienyl, n-nonatrienyl, n-decadienyl, n-decatrienyl, n-undecadienyl, n-undecatrienyl, n-dodecadienyl, n-dodecatrienyl, n-tridecadienyl, n-tridecatrienyl, n-tetradecadienyl n-tetradecatrienyl, n-pentadecadienyl, n-pentadecatrienyl, n-hexadecadienyl, n-hexadecatrienyl, n-heptadecadienyl, n-heptadecatrienyl, n-octadecadienyl, n-octadecatrienyl, n-nonadecadienyl, n-nonadecatrienyl, n-eicosadienyl, n-eicosatrienyl, and the constitutional isomers thereof, as for example 4,8-dimethylnona-3,7-dienyl.

    [0049] Each double bond within the above C.sub.2-C.sub.20-alkenyl residue may, unless otherwise stated, take the E- or the Z-configuration, and independently of the other double bond in the case of polyunsaturation.

    [0050] Non-limiting examples of optionally substituted residues as defined herein comprise 1, 2, 3, 4, 5 or 6, preferably 1 or 2 identical or different substituents like, HO, SH, NH.sub.2, NO.sub.2, halogen, like F, Cl, Br, J; lower alkyl, lower alkoxy, lower alkylthio, lower alkyl, lower alkenyl, lower alkynyl or hydroxyl-lower alkyl, as defined above.

    [0051] Lower alkyl refers to C.sub.1-C.sub.4-alkyl radicals as defined above.

    [0052] Lower alkoxy preferably refers to the C.sub.1-C.sub.4-alkoxy analogues of the above-mentioned lower alkyl radicals.

    [0053] Lower alkylthio preferably refers to the C.sub.1-C.sub.4-alkthio analogues of the above-mentioned lower alkyl radicals. Examples are methylthio, ethylthio, propylthio, isopropylthio, butylthio, sec-butylthio, isobutylthio and tert-butylthio.

    [0054] Lower alkenyl comprises C.sub.2-C.sub.4-alkenyl radicals as defined above.

    [0055] Lower alkynyl comprises the alkynyl homologues of the above lower alkeny radicals.

    [0056] The term hydroxy lower-alkyl refers to C.sub.1-C.sub.4-hydroxyalkyl which is a linear or branched alkyl radical having from 1 to 4 carbon atoms, in which at least one hydrogen atom, for example 1 or 2 of the hydrogen atoms, is/are replaced by a hydroxyl group. Examples thereof are hydroxymethyl, 2-hydroxy-1-ethyl, 2- and 3-hydroxy-1-propyl, 2-, 3- and 4-hydroxy-1-butyl, and their constitutional isomers.

    [0057] Herein disclosed are parameter ranges of different degree of preference for a particular parameter. Within the scope of the present disclosure is also any combination of parameter ranges of different degree of preference for any combination of two or more parameter referred to herein.

    2. Particular Embodiments of the Invention

    [0058] The present invention provides the following particular embodiments: [0059] 1. A method for isolating the 3-(E)-isomer of an unsaturated carboxylic acid compound of the general formula (I)

    ##STR00004## [0060] wherein [0061] R.sup.1 is H or a straight chain or branched, saturated or unsaturated, optionally substituted C.sub.1-C.sub.20 hydrocarbyl residue, preferably a saturated, non-substituted straight chain C.sub.1-C.sub.20 hydrocarbyl residue; [0062] R.sup.3 is H or a C.sub.1-C.sub.4-hydrocarbyl residue, preferably H or methyl; [0063] R.sup.2 is a straight chain or branched, saturated or unsaturated, optionally substituted, C.sub.1-C.sub.20-hydrocarbyl residue, preferably a non-saturated, branched chain C.sub.2-C.sub.16-hydrocarbyl residue; [0064] with the proviso that, if R.sup.3 is a C.sub.1-C.sub.4-hydrocarbyl residue, R.sup.2 represents an hydrocarbyl residue containing at least one additional carbon atom; [0065] from a mixture of isomers comprising the 3-(E)- and 3-(Z)-isomer of said carboxylic acid compound, whereby said mixture of isomers is subjected to a lipase (E.C. 3.1.1.3) catalyzed enzymatic conversion reaction, which lipase preferentially, in particular stereoselectively, converts said 3-(E)-isomer, and the conversion product of said 3-(E)-isomer is isolated from said reaction mixture. [0066] 2. The method of embodiment 1, wherein said lipase catalyzes a 3-(E)-stereoselective conversion reaction. [0067] 3. The method of one of the preceding embodiments, wherein the lipase is applied in free or immobilized form. [0068] 4. The method of one of the preceding embodiments, wherein said lipase is a natural or recombinantly produced, optionally genetically modified (mutated) enzyme. [0069] 5. The method of one of the preceding embodiments, wherein said lipase originates from Candida sp., in particular Candida antarctica. [0070] 6. The method of embodiment 5, wherein said lipase is Candida antarctica. lipase B (CALB) comprising an amino acid sequence of SEQ ID NO:330 or a mutant thereof having a sequence identity of at least 60% to SEQ ID NO:330 and retaining said 3-(E)-selectivity. [0071] 7. The method of one of the preceding embodiments, wherein said conversion reaction comprises an enzymatic esterification reaction of an acid of the formula (Ia);

    ##STR00005## [0072] wherein [0073] R.sup.2 and R.sup.3 are as defined above; [0074] and wherein the 3-(E)-ester is predominantly formed; and wherein an aliphatic alkanol R.sup.1OH, wherein R.sup.1 is as defined above, preferably a straight chain or branched, saturated C.sub.1-C.sub.20 alkyl preferably C.sub.1-C.sub.4 alkyl residue, optionally in the presence of an organic solvent which does not disturb or even inhibit lipase activity. [0075] 8. The method of one of the embodiments 1 to 6, wherein said conversion reaction comprises an enzymatic ester cleavage reaction of an ester of the formula (Ib);

    ##STR00006## [0076] wherein [0077] R.sup.1 is H or a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-, in particular C.sub.4-C.sub.20-, hydrocarbyl residue; [0078] and R.sup.2 and R.sup.3 are as defined above; [0079] and wherein the 3-(E)-acid is predominantly formed; and wherein the reaction is performed in the presence of water, and optionally in the presence of an organic solvent, which does not disturb or even inhibit lipase activity. [0080] 9. The method of one of the preceding embodiments, wherein said conversion reaction is performed in an organic solvent or aqueous-organic solvent. [0081] 10. The method of embodiment 9, wherein said organic solvent is selected from aliphatic or cycloaliphatic hydrocarbons, like hydrocarbons having at least 5 carbon atoms, in particular hexane, cyclohexane, heptane, octane; aromatic hydrocarbons, in particular mononuclear aromatic compounds, like benzene, xylene and toluene; and aliphatic ethers, like MTBE, diisopropyl ether. Preferably, suitable organic solvents should be able to form a 2-phase system with water. [0082] 11. The method of one of the preceding embodiments, wherein said carboxylic acid compound is a 3-(E)/7-(E)-homofarnesoic acid compound of formula (II)

    ##STR00007## [0083] wherein R.sup.1 is as defined above. [0084] 12. A method of preparing an unsaturated 3-(E)-carboxylic acid of the general formula (Ia):

    ##STR00008## [0085] wherein [0086] R.sup.2 and R.sup.3 are as defined above; [0087] wherein [0088] a) an isomer mixture, comprising the 3-(E)- and the 3-(Z)-isomer of said carboxylic acid of formula (Ia) is subjected to an enzymatic esterification reaction in the presence of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue, preferably a straight chain or branched, saturated C.sub.1-C.sub.20 alkyl, preferably C.sub.1-C.sub.4 alkyl residue; and in the presence of a lipase enzyme as defined in one of the embodiments 1 to 6; [0089] b) said 3-(E)-carboxylic ester as formed in step a) is isolated, for example by transferring the non-reacted acid isomer in an aqueous phase (as acid salt) and recovering the ester by means of an organic solvent which was either present during the conversion or which was added afterwards; and [0090] c) said isolated ester of step b) is saponified to the corresponding 3-(E)-carboxylic acid of formula (Ia). [0091] 13. A method of preparing an unsaturated 3-(E)-carboxylic acid of the general formula (Ia):

    ##STR00009## [0092] wherein [0093] R.sup.2 and R.sup.3 are as defined above; [0094] wherein [0095] a) an isomer mixture, comprising the 3-(E)- and the 3-(Z)-isomer of a carboxylic acid ester of formula (Ib)

    ##STR00010## [0096] wherein [0097] R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue, preferably a straight chain or branched, saturated C.sub.1-C.sub.20 alkyl, preferably C.sub.1-C.sub.4 alkyl, residue; and [0098] R.sup.2 and R.sup.3 are as defined above; [0099] is subjected to an enzymatic ester cleavage reaction in the presence of a lipase enzyme as defined in one of the embodiments 1 to 6, and preferably in the presence of water and optionally an organic solvent; [0100] b) said 3-(E)-carboxylic acid as formed in step a) is isolated, preferably as free acid from the aqueous phase of the reaction mixture.. [0101] 14. The method of embodiment 12 or 13, wherein an organic solvent as defined in one of the embodiments 9 and 10 is applied. [0102] 15. The method of one of the preceding embodiments, wherein said 3-(E)-isomer of an unsaturated carboxylic acid is 3-(E)/7-(E)-homofarnesoic acid. [0103] 16. The method of one of the preceding embodiments wherein said isomer mixture comprises a mixture of 3-(E)/7-(E)-homofarnesoic acid and 3-(Z)/7-(E)-homofarnesoic acid; or a mixture of 3-(E)/7-(E)-homofarnesoic acid ester and 3-(Z)/7-(E)-homofarnesoic acid ester of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue. [0104] 17. The method of embodiment 16 for preparing 3-(E)/7-(E)-homofarnesoic acid wherein [0105] a) an isomer mixture, comprising 3-(E)/7-(E)-homofarnesoic acid and 3-(Z)/7-(E)-homofarnesoic acid is subjected to an enzymatic esterification reaction in the presence of an alkanol of the formula R.sup.1OH, wherein R.sup.1 is a straight chain or branched, saturated or unsaturated C.sub.1-C.sub.20-hydrocarbyl residue, preferably a straight chain or branched, saturated C.sub.1-C.sub.20 alkyl, preferably C.sub.1-C.sub.4 alkyl residue; and in the presence of a lipase enzyme as defined in one of the embodiments 1 to 6 in a solvent as defined in one of the embodiments 9 and 10; [0106] b) said 3-(E)/7-(E)-homofarnesoic acid ester as formed in step a) is separated from unreacted acid (i.p. 3-(Z)/7-(E)-homofarnesoic acid), in particular by distillation or, preferably, extraction; and [0107] c) said isolated 3-(E)/7-(E)-homofarnesoic acid ester is saponified to 3-(E)/7-(E)-homofarnesoic acid. [0108] 18. The method of embodiment 16 for preparing 3-(E)/7-(E)-homofarnesoic acid wherein [0109] a) an isomer mixture, comprising 3-(E)/7-(E)-homofarnesoic acid ester and 3-(Z)/7-(E)-homofarnesoic acid ester is subjected to an enzymatic ester cleavage reaction in the presence of a lipase enzyme as defined in one of the embodiments 1 to 6 in a solvent as defined in one of the embodiments 9 and 10, and preferably in the presence of water; and [0110] b) said 3-(E)/7-(E)-homofarnesoic acid as formed in step a) is separated from unreacted ester (i.p. 3-(Z)/7-(E)-homofarnesoic acid ester), in particular by distillation or, preferably, extraction. [0111] 19. A method of preparing ()-ambrox of the formula (III)

    ##STR00011## [0112] comprising the steps of [0113] a) obtaining said 3-(E)/7-(E)-homofarnesoic acid by applying a method as defined in any-one of the embodiments 1 to 18; [0114] b) chemically reducing 3-(E)/7-(E)-homofarnesoic acid to 3-(E)/7-(E)-homofarnesol and [0115] c) enzymatically cycling of 3-(E)/7-(E)-homofarnesol to ()-ambrox. [0116] 20. A method of preparing ()-ambrox of the formula (III)

    ##STR00012## [0117] comprising the steps of [0118] a) obtaining said 3-(E)/7-(E)-homofarnesoic acid by applying a method as defined in any-one of the embodiments 1 to 18, [0119] b) enzymatically cycling of 3-(E)/7-(E)-homofarnesoic acid to sclareolide of the formula (IV)

    ##STR00013## [0120] and [0121] c) chemically converting said sclareolide to ()-ambrox. [0122] 21. The method of embodiment 19 or 20, wherein the enzymatic cyclization is performed in the presence of an intramolecular transferase (E.C. 5.4), in particular a homofarnesoic acid cyclase (E.C. 5.4.99.17), in particular a squalene-hopene cyclase (E.C. 5.4.99.17), showing homofarnesoic acid cyclase activity. [0123] 22. The method of embodiment 21, wherein said cyclase is a natural or recombinantly produced, optionally genetically modified (mutated) squalene-hopene cyclase (SHC). [0124] 23. The method of embodiment 22, wherein said cyclase is a squalene hopene cyclase originating from Methylococcus capsalatus, Rhodopseudomonas palustris, Bradyrhizobium japonicum, Frankia spec., Streptomyces coelicolor, or, preferably, Zymomonas mobilis. [0125] 24. The method of embodiment 23, wherein said cyclase is from Zymomonas mobilis, comprising an amino acid sequence according to SEQ ID NO:2 or an amino acid sequence having at least 60% sequence identity to SEQ ID NO:2. [0126] 25. 3-(E)/7-(E)-homofarnesoic acid alkyl ester, wherein said alkyl group is selected from C.sub.2-C.sub.10, in particular C.sub.3-C.sub.8-alkyl, as for example, ethyl, n-propyl, isopropyl, n-butyl, 2-butyl, isobutyl or tert-buty; as well as pentyl, hexyl, heptyl, octyl, and their constitutional isomers; preferably in the form of the substantially stereoisomerically pure 3-(E)/7-(E)-form, and in particular as prepared according to a method as defined herein above.

    [0127] In general cyclases applicable in said aspect of the invention are SHCs which are listed below by making reference to their wild type sequence (SEQ ID NO's and Genbank-numbers are stated) and their microbial source.

    TABLE-US-00001 GI-Nr. der Referenz S_ID DB SEQ ID NO Organism Sequenzen s1 seq_ID 2 Zymomonas mobilis AAV90172.1 s20 seq_ID 3 Streptomyces coelicolor CAB39697.1 s911 seq_ID 4 Acetobacter pasteurianus BAH99456.1 s2 seq_ID 5 Bradyrhizobium sp. ABQ33590.1 s940 seq_ID 6 Zymomonas mobilis EER62728.1 s949 seq_ID 7 Acidithiobacillus caldus EET25937.1 s167 seq_ID 8 Acidithiobacillus ferrooxidans ACH84004.1 s41 seq_ID 9 Acidobacterium capsulatum ACO34244.1 s36 seq_ID 10 Acidothermus cellulolyticus ABK53469.1 s83 seq_ID 11 Adiantum capillus-veneris BAF93209.1 s143 seq_ID 12 Ajellomyces capsulatus EDN09769.1 s995 seq_ID 13 Ajellomyces capsulatus EER40510.1 s163 seq_ID 14 Ajellomyces capsulatus EEH02950.1 s13 seq_ID 15 Alicyclobacillus EED08231.1 acidocaldarius s14 seq_ID 16 Alicyclobacillus P33247.4 acidocaldarius s1193 seq_ID 17 Alicyclobacillus AAT70690.1 acidocaldarius s21 seq_ID 18 Alicyclobacillus CAA61950.1 acidoterrestris s1189 seq_ID 19 Alicyclobacillus AAT70691.1 acidoterrestris s51 seq_ID 20 Anabaena variabilis ABA24268.1 s76 seq_ID 21 Anaeromyxobacter sp. ABS28257.1 s159 seq_ID 22 Aspergillus clavatus EAW07713.1 s131 seq_ID 23 Aspergillus flavus EED48353.1 s176 seq_ID 24 Aspergillus fumigatus EDP50814.1 s126 seq_ID 25 Aspergillus fumigatus EAL84865.1 s178 seq_ID 26 Aspergillus fumigatus EAL86291.2 s121 seq_ID 27 Aspergillus niger CAK43501.1 s115 seq_ID 28 Aspergillus niger CAK45506.1 s124 seq_ID 29 Aspergillus oryzae BAE63941.1 s119 seq_ID 30 Azotobacter vinelandii EAM07611.1 s223 seq_ID 31 Bacillus amyloliquefaciens ABS74269.1 s221 seq_ID 32 Bacillus anthracis AAP27368.1 s976 seq_ID 33 Bacillus cereus EEK66523.1 s225 seq_ID 34 Bacillus cereus EAL12758.1 s972 seq_ID 35 Bacillus cereus EEL44583.1 s977 seq_ID 36 Bacillus cereus EEK43841.1 s985 seq_ID 37 Bacillus cereus EEK82938.1 s988 seq_ID 38 Bacillus cereus EEK99528.1 s981 seq_ID 39 Bacillus cereus EEK77935.1 s987 seq_ID 40 Bacillus cereus EEL81079.1 s960 seq_ID 41 Bacillus cereus EEK88307.1 s979 seq_ID 42 Bacillus cereus EEL63943.1 s974 seq_ID 43 Bacillus cereus EEL59884.1 s956 seq_ID 44 Bacillus cereus EEL69857.1 s951 seq_ID 45 Bacillus cereus EEL92663.1 s986 seq_ID 46 Bacillus cereus EEL49968.1 s227 seq_ID 47 Bacillus cereus AAU16998.1 s224 seq_ID 48 Bacillus cereus AAS42477.1 s212 seq_ID 49 Bacillus cereus ACK95843.1 s289 seq_ID 50 Bacillus coahuilensis 205373680 s219 seq_ID 51 Bacillus cytotoxicus ABS22481.1 s230 seq_ID 52 Bacillus licheniformis AAU23777.1 s955 seq_ID 53 Bacillus mycoides EEL98438.1 s990 seq_ID 54 Bacillus mycoides EEM04821.1 s989 seq_ID 55 Bacillus pseudomycoides EEM16144.1 s247 seq_ID 56 Bacillus pumilus ABV62529.1 s250 seq_ID 57 Bacillus pumilus EDW21137.1 s249 seq_ID 58 Bacillus sp. EAR64404.1 s218 seq_ID 59 Bacillus sp. EDL66148.1 s241 seq_ID 60 Bacillus subtilis Q796C3.1 s284 seq_ID 61 Bacillus subtilis AAB84441.1 s215 seq_ID 62 Bacillus thuringiensis ABK86448.1 s984 seq_ID 63 Bacillus thuringiensis EEM21409.1 s957 seq_ID 64 Bacillus thuringiensis EEM82653.1 s980 seq_ID 65 Bacillus thuringiensis EEM52372.1 s961 seq_ID 66 Bacillus thuringiensis EEM27851.1 s969 seq_ID 67 Bacillus thuringiensis EEM40716.1 s959 seq_ID 68 Bacillus thuringiensis EEM46814.1 s965 seq_ID 69 Bacillus thuringiensis EEM94969.1 s202 seq_ID 70 Bacillus weihenstephanensis ABY44436.1 s63 seq_ID 71 Bacterium Ellin514 EEF57225.1 s72 seq_ID 72 Bacterium Ellin514 EEF59508.1 s87 seq_ID 73 Beijerinckia indica ACB96717.1 s69 seq_ID 74 Blastopirellula marina EAQ81955.1 s543 seq_ID 75 Blastopirellula marina EAQ78122.1 s156 seq_ID 76 Bradyrhizobium japonicum CAA60250.1 s938 seq_ID 77 Acetobacter pasteurianus BAH98349.1 s3 seq_ID 78 Bradyrhizobium sp. CAL79893.1 s201 seq_ID 79 Brevibacillus brevis BAH44778.1 s148 seq_ID 80 Burkholderia ambifaria EDT05097.1 s158 seq_ID 81 Burkholderia ambifaria EDT37649.1 s149 seq_ID 82 Burkholderia ambifaria ACB68303.1 s100 seq_ID 83 Burkholderia ambifaria EDT42454.1 s146 seq_ID 84 Burkholderia cenocepacia EAY66961.1 s139 seq_ID 85 Burkholderia cenocepacia ACA95661.1 s147 seq_ID 86 Burkholderia cenocepacia CAR57099.1 s95 seq_ID 87 Burkholderia cenocepacia CAR56694.1 s102 seq_ID 88 Burkholderia dolosa EAY71311.1 s941 seq_ID 89 Burkholderia glumae ACR32572.1 s945 seq_ID 90 Burkholderia glumae ACR30752.1 s132 seq_ID 91 Burkholderia graminis EDT12320.1 s104 seq_ID 92 Burkholderia mallei ABM48844.1 s140 seq_ID 93 Burkholderia multivorans ABX19650.1 s116 seq_ID 94 Burkholderia multivorans ABX16859.1 s91 seq_ID 95 Burkholderia oklahomensis 167567074 s111 seq_ID 96 Burkholdoria phymatum ACC73258.1 s127 seq_ID 97 Burkholderia phytofirmans ACD21317.1 s120 seq_ID 98 Burkholderia pseudomallei EEC32728.1 s137 seq_ID 99 Burkholderia sp. EEA03553.1 s144 seq_ID 100 Burkholderia sp. ABB06563.1 s98 seq_ID 101 Burkholderia sp. ABB10136.1 s944 seq_ID 102 Burkholderia sp. CCGE1002 EFA54357.1 s89 seq_ID 103 Burkholderia thailandensis 167840988 s113 seq_ID 104 Burkholderia thailandensis 167617352 s154 seq_ID 105 Burkholderia ubonensis 167589807 s93 seq_ID 106 Burkholderia ubonensis 167584986 s96 seq_ID 107 Burkholderia vietnamiensis ABO56791.1 s150 seq_ID 108 Burkholderia xenovorans ABE35912.1 s54 seq_ID 109 Candidates Koribacter ABF40741.1 s171 seq_ID 110 Candidates Kuenenia CAJ71215.1 s79 seq_ID 111 Candidates Solibacter ABJ82180.1 s99 seq_ID 112 Candidates Solibacter ABJ82254.1 s917 seq_ID 113 Catenulispora acidiphila ACU75510.1 s65 seq_ID 114 Chthoniobacter flavus EDY15838.1 s637 seq_ID 115 Chthoniobacter flavus EDY22035.1 s38 seq_ID 116 Crocosphaera watsonii EAM53094.1 s186 seq_ID 117 Cupriavidus taiwanensis CAQ72562.1 s32 seq_ID 118 Cyanothece sp. ACB53858.1 s40 seq_ID 119 Cyanothece sp. ACK71719.1 s30 seq_ID 120 Cyanothece sp. EDY02410.1 s29 seq_ID 121 Cyanothece sp. ACK66841.1 s47 seq_ID 122 Cyanothece sp. EDX97382.1 s35 seq_ID 123 Cyanothece sp. EAZ91809.1 s39 seq_ID 124 Cyanothece sp. ACL45896.1 s925 seq_ID 125 Cyanothece sp. PCC 8802 ACV02092.1 s64 seq_ID 126 Desulfovibrio salexigens EEC62384.1 s74 seq_ID 127 Dryopteris crassirhizoma BAG68223.1 s59 seq_ID 128 Frankia alni CAJ61140.1 s48 seq_ID 129 Frankia alni CAJ60090.1 s56 seq_ID 130 Frankia sp. ABD10207.1 s60 seq_ID 131 Frankia sp. ABW15063.1 s31 seq_ID 132 Frankia sp. ABW14125.1 s948 seq_ID 133 Frankia sp. Eul1c EFA59873.1 s919 seq_ID 134 Frankia sp. Eul1c EFA59089.1 s628 seq_ID 135 Gemmata obscuriglobus 168700710 s209 seq_ID 136 Geobacillus sp. EED61885.1 s206 seq_ID 137 Geobacillus sp. EDY05760.1 s964 seq_ID 138 Geobacillus sp. Y412MC52 EEN95021.1 s993 seq_ID 139 Geobacillus sp. Y412MC61 ACX79399.1 s205 seq_ID 140 Geobacillus ABO67242.1 thermodenitrificans s15 seq_ID 141 Geobacter bemidjiensis ACH40355.1 s8 seq_ID 142 Geobacter lovleyi ACD95949.1 s62 seq_ID 143 Geobacter metallireducens ABB30662.1 s12 seq_ID 144 Geobacter metallireducens ABB33038.1 s73 seq_ID 145 Geobacter sp. ACM21577.1 s10 seq_ID 146 Geobacter sp. EDV72707.1 s11 seq_ID 147 Geobacter sp. ACM22003.1 s913 seq_ID 148 Geobacter sp. M18 EET34621.1 s914 seq_ID 149 Geobacter sp. M21 ACT16952.1 s58 seq_ID 150 Geobacter sulfurreducens AAR36453.1 s7 seq_ID 151 Geobacter sulfurreducens AAR34018.1 s9 seq_ID 152 Geobacter uraniireducens ABQ25226.1 s46 seq_ID 153 Cloeobacter violaceus BAC91998.1 s67 seq_ID 154 Gluconacetobacter ACI51585.1 diazotrophicus s165 seq_ID 155 Gluconacetobacter CAP55563.1 diazotrophicus s68 seq_ID 156 Gluconobacter oxydans AAW61994.1 s80 seq_ID 157 Granulibacter bethesdensis ABI63005.1 s937 seq_ID 158 Hyphomicrobium denitrificans EET65847.1 s932 seq_ID 159 Leptospirillum EES53667.1 ferrodiazotrophum s24 seq_ID 160 Leptospirillum rubarum EAY57382.1 s25 seq_ID 161 Leptospirillum sp. EDZ38599.1 s174 seq_ID 162 Magnaporthe grisea EDK02551.1 s153 seq_ID 163 Magnetospirillum 46203107 magnetotacticum s49 seq_ID 164 Methylacidiphilum infernorum ACD82457.1 s169 seq_ID 165 Methylobacterium ACK83067.1 chloromethanicum s75 seq_ID 166 Methylobacterium ACK86232.1 chloromethanicum s946 seq_ID 167 Methylobacterium extorquens CAX24364.1 s141 seq_ID 168 Methylobacterium nodulans ACL61886.1 s152 seq_ID 169 Methylobacterium populi ACB79998.1 s162 seq_ID 170 Methylobacterium ACB27373.1 radiotolerans s180 seq_ID 171 Methylobacterium sp. ACA20611.1 s175 seq_ID 172 Methylocella silvestris ACK52150.1 s181 seq_ID 173 Methylococcus capsulatus CAA71098.1 s55 seq_ID 174 Microcystis aeruginosa CAO86472.1 s101 seq_ID 175 Neosartorya fischeri EAW20752.1 s129 seq_ID 176 Nitrobacter hamburgensis ABE63461.1 s161 seq_ID 177 Nitrobacter sp. EAQ34404.1 s160 seq_ID 178 Nitrobacter winogradskyi ABA05523.1 s157 seq_ID 179 Nitrococcus mobilis EAR22397.1 s164 seq_ID 180 Nitrosococcus oceani ABA57818.1 s170 seq_ID 181 Nitrosomonas europaea CAD85079.1 s173 seq_ID 182 Nitrosomonas eutropha ABI59752.I s943 seq_ID 183 Nitrosomonas sp. AL212 EET32702.1 s142 seq_ID 184 Nitrosospira multiformis ABB75845.1 s52 seq_ID 185 Nostoc punctiforme ACC84529.1 s45 seq_ID 186 Nostoc sp. BAB72732.1 s122 seq_ID 187 Oligotropha carboxidovorans ACI93782.1 s233 seq_ID 188 Paenibacillus sp. EDS49994.1 s991 seq_ID 189 Paenibacillus sp. ACS99948.1 JDR-2 s950 seq_ID 190 Paenibacillus sp. EES74793.1 oral taxon 786 s1280 seq_ID 191 Paramecium tetraurelia 145542269 s71 seq_ID 192 Pelobacter carbinolicus ABA87701.1 s5 seq_ID 193 Pelobacter carbinolicus ABA87615.1 s66 seq_ID 194 Pelobacter propionicus ABK98395.1 s16 seq_ID 195 Pelobacter propionicus ABK98811.1 s136 seq_ID 196 Penicillium chrysogenum CAP99707.1 s936 seq_ID 197 Planctomyces limnophilus EEO67214.1 s1158 seq_ID 198 Planctomyces limnophilus EEO68341.1 s526 seq_ID 199 Planctomyces maris EDL58855.1 s992 seq_ID 200 Polypodiodes niponica BAI48071.1 s942 seq_ID 201 Polypodiodes niponica BAI48070.1 s1202 seq_ID 202 Populus trichocarpa EEF12098.1 s168 seq_ID 203 Ralstonia eutropha AAZ64302.1 s190 seq_ID 204 Ralstonia eutropha CAJ96989.1 s81 seq_ID 205 Ralstonia metallidurans ABF11015.1 s110 seq_ID 206 Ralstonia metallidurans ABF11268.1 s123 seq_ID 207 Rhizobium sp. P55348.1 s657 seq_ID 208 Rhodopirellula baltica CAD74517.1 s4 seq_ID 209 Rhodopseudomonas palustris ABJ08391.1 s130 seq_ID 210 Rhodopseudomonas palustris CAA71101 1 s155 seq_ID 211 Rhodopseudomonas palustris ABD06434.1 s97 seq_ID 212 Rhodopseudomonas palustris ABD87279.1 s135 seq_ID 213 Rhodopseudomonas palustris ACF02757.1 s84 seq_ID 214 Rhodospirillum rubrum ABC20867.1 s1279 seq_ID 215 Rubrobacter xylanophilus ABG05671.1 s915 seq_ID 216 Saccharomonospora viridis ACU97316.1 s42 seq_ID 217 Saccharopolyspora erythraea CAM03596.1 s82 seq_ID 218 Schizosaccharomyces EEB08219.1 japonicus s923 seq_ID 219 Sphaerobacter thermophilus ACZ39437.1 s924 seq_ID 220 Streptomyces albus 239983547 s23 seq_ID 221 Streptomyces avermitilis BAC69361.1 s44 seq_ID 222 Acaryochloris marina ABW29816.1 s921 seq_ID 223 Streptomyces filamentosus 239945642 s934 seq_ID 224 Streptomyces flavogriseus EEW70811.1 s920 seq_ID 225 Streptomyces ghanaensis 239927462 s922 seq_ID 226 Streptomyces griseoflavus 256812310 s28 seq_ID 227 Streptomyces griseus BAG17791.1 s926 seq_ID 228 Streptomyces hygroscopicus 256775136 s916 seq_ID 229 Streptomyces lividans 256783789 s33 seq_ID 230 Streptomyces peucetius ACA52082.1 s27 seq_ID 231 Streptomyces pristinaespiralis EDY61772.1 s933 seq_ID 232 Streptomyces scabiei CBG68454.1 s37 seq_ID 233 Streptomyces sp. EDX25760.1 s34 seq_ID 234 Streptomyces sp. EDY46371.1 s931 seq_ID 235 Streptomyces sp. AA4 256668250 s918 seq_ID 236 Streptomyces sp. C 256770952 s929 seq_ID 237 Streptomyces sp. Mg1 254385931 s928 seq_ID 238 Streptomyces sp. SPB74 254379682 s930 seq_ID 239 Streptomyces sp. SPB78 256680470 s26 seq_ID 240 Streptomyces sviceus EDY55942.1 s927 seq_ID 241 Streptomyces 256805984 viridochromogenes s61 seq_ID 242 Synechococcus sp. EDX84551.1 s935 seq_ID 243 Synechococcus sp. 254422098 PCC 7335 s53 seq_ID 244 Synechocystis sp. BAA17978.1 s22 seq_ID 245 Syntrophobacter ABK18414.1 fumaroxidans s6 seq_ID 246 Syntrophobacter ABK17672.1 fumaroxidans s912 seq_ID 247 Teredinibacter turnerae ACR13362.1 s57 seq_ID 248 Thermosynechococcus BAC09861.1 elongatus s43 seq_ID 249 Trichodesmium erythraeum ABG50159.1 s1178 seq_ID 250 Uncultured organism ACA58560.1 s1176 seq_ID 251 Uncultured organism ABL07557.1 s1165 seq_ID 252 Uncultured organism ACA58559.1 s1166 seq_ID 253 Uncultured organism ACA58558.1 s1168 seq_ID 254 Uncultured organism ABL07560.1 s1169 seq_ID 255 Uncultured organism ABL07565.1 s1170 seq_ID 256 Uncultured organism ABL07566.1 s1167 seq_ID 257 Uncultured organism ACA58545.1 s1171 seq_ID 258 Uncultured organism ACA58535.1 s1180 seq_ID 259 Uncultured organism ACA58549.1 s1179 seq_ID 260 Uncultured organism ACA58554.1 s1181 seq_ID 261 Uncultured organism ACA58555.1 s1182 seq_ID 262 Uncultured organism ACA58556.1 s1235 seq_ID 263 Uncultured organism ACA58530.1 s1188 seq_ID 264 Uncultured organism ACA58534.1 s1237 seq_ID 265 Uncultured organism ACA58552.1 s1223 seq_ID 266 Uncultured organism ABL07558.1 s1200 seq_ID 267 Uncultured organism ABL07542.1 s1236 seq_ID 268 Uncultured organism ACA58539.1 s1238 seq_ID 269 Uncultured organism ACA58537.1 s1233 seq_ID 270 Uncultured organism ACA58543.1 s1173 seq_ID 271 Uncultured organism ABL07553.1 s1241 seq_ID 272 Uncultured organism ABL07540.1 s1242 seq_ID 273 Uncultured organism ABL07544.1 s1225 seq_ID 274 Uncultured organism ACA58557.1 s1183 seq_ID 275 Uncultured organism ACA58520.1 s1197 seq_ID 276 Uncultured organism ACA58524.1 s1185 seq_ID 277 Uncultured organism ACA58522.1 s1190 seq_ID 278 Uncultured organism ACA58525.1 s1187 seq_ID 279 Uncultured organism ACA58523.1 s1184 seq_ID 280 Uncultured organism ACA58521.1 s1204 seq_ID 281 Uncultured organism ACA58547.1 s1221 seq_ID 282 Uncultured organism ACA58544.1 s1198 seq_ID 283 Uncultured organism ACA58546.1 s1226 seq_ID 284 Uncultured organism ACA58527.1 s1227 seq_ID 285 Uncultured organism ABL07537.1 s1232 seq_ID 286 Uncultured organism ACA58510.1 s1230 seq_ID 287 Uncultured organism ACA58538.1 s1229 seq_ID 288 Uncultured organism ACA68642.1 s1231 seq_ID 289 Uncultured organism ACA58540.1 s1207 seq_ID 290 Uncultured organism ABL07564.1 s1212 seq_ID 291 Uncultured organism ABL07563.1 s1208 seq_ID 292 Uncultured organism ABL07562.1 s1209 seq_ID 293 Uncultured organism ABL07559.1 s1214 seq_ID 294 Uncultured organism ABL07556.1 s1216 seq_ID 295 Uncultured organism ACA58528.1 s1219 seq_ID 296 Uncultured organism ACA58536.1 s1192 seq_ID 297 Uncultured organism ABL07533.1 s1195 seq_ID 298 Uncultured organism ABL07536.1 s1174 seq_ID 299 Uncultured organism ABL07545.1 s1186 seq_ID 300 Uncultured organism ABL07548.1 s1196 seq_ID 301 Uncultured organism ACA58561.1 s1172 seq_ID 302 Uncultured organism ABL07555.1 s1194 seq_ID 303 Uncultured organism ABL07541.1 s1211 seq_ID 304 Uncultured organism ABL07554.1 s1220 seq_ID 305 Uncultured organism ABL07547.1 s1203 seq_ID 306 Uncultured organism ABL07550.1 s1199 seq_ID 307 Uncultured organism ABL07551.1 s1228 seq_ID 308 Uncultured organism ACA58509.1 s1201 seq_ID 309 Uncultured organism ACA58514.1 s1205 seq_ID 310 Uncultured organism ABL07543.1 s1206 seq_ID 311 Uncultured organism ABL07534.1 s1177 seq_ID 312 Uncultured organism ABL07546.1 s1210 seq_ID 313 Uncultured organism ABL07535.1 s1175 seq_ID 314 Uncultured organism ABL07552.1 s1191 seq_ID 315 Uncultured organism ABL07549.1 s1222 seq_ID 316 Uncultured organism ACA58553.1 s1244 seq_ID 317 Uncultured organism ABL07539.1 s1213 seq_ID 318 Uncultured organism ACA58532.1 s1239 seq_ID 319 Uncultured organism ACA58548.1 s1215 seq_ID 320 Uncultured organism ABL07561.1 s1240 seq_ID 321 Uncultured organism ACA58533.1 s1234 seq_ID 322 Uncultured organism ABL07538.1 s1224 seq_ID 323 Uncultured organism ACA58541.1 s1217 seq_ID 324 Uncultured organism ACA58529.1 s596 seq_ID 325 Verrucomicrobium spinosum 171910093 s70 seq_ID 326 Acidiphilium cryplum ABQ30890.1

    [0128] SEQ ID NO:2 is the amino acid sequence of a cyclase which is also known as Zm-SHC-1.

    3. Enzymes and Enzyme Mutants According to the Invention

    [0129] The present invention is not limited to the use of the specifically disclosed lipases and cyclases, but also extends to functional equivalents thereof.

    [0130] Functional equivalents or analogs of the concretely disclosed enzymes are, within the scope of the present invention, various polypeptides thereof, which moreover possess the desired biological function or activity, e.g. enzyme activity.

    [0131] For example, functional equivalents means enzymes, which, in a test used for enzymatic activity, display at least a 1 to 10%, or at least 20%, or at least 50%, or at least 75%, or at least 90% higher or lower activity of an enzyme, as defined herein.

    [0132] Functional equivalents, according to the invention, also means in particular mutants, which, in at least one sequence position of the amino acid sequences stated above, have an amino acid that is different from that concretely stated, but nevertheless possess one of the aforementioned biological activities. Functional equivalents thus comprise the mutants obtainable by one or more, as for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15, amino acid additions, substitutions, insertions, deletions and/or inversions, where the stated changes can occur in any sequence position, provided they lead to a mutant with the profile of properties according to the invention. Functional equivalence is in particular also provided if the reactivity patterns coincide qualitatively between the mutant and the unchanged polypeptide, i.e. if for example the same substrates are converted at a different rate. Examples of suitable amino acid substitutions are shown in the following table:

    TABLE-US-00002 Original residue Examples of the substitution Ala Ser Arg Lys Asn Gln; His Asp Glu Cys Ser Gln Asn Glu Asp Gly Pro His Asn; Gln Ile Leu; Val Leu Ile; Val Lys Arg; Gln; Glu Met Leu; Ile Phe Met; Leu; Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp; Phe Val Ile; Leu

    [0133] Functional equivalents in the above sense are also precursors of the polypeptides described, as well as functional derivatives and salts of the polypeptides.

    [0134] Precursors are in that case natural or synthetic precursors of the polypeptides with or without the desired biological activity.

    [0135] The expression salts means salts of carboxyl groups as well as salts of acid addition of amino groups of the protein molecules according to the invention. Salts of carboxyl groups can be produced in a known way and comprise inorganic salts, for example sodium, calcium, ammonium, iron and zinc salts, and salts with organic bases, for example amines, such as triethanolamine, arginine, lysine, piperidine and the like. Salts of acid addition, for example salts with inorganic acids, such as hydrochloric acid or sulfuric acid and salts with organic acids, such as acetic acid and oxalic acid, are also covered by the invention.

    [0136] Functional derivatives of polypeptides according to the invention can also be produced on functional amino acid side groups or at their N-terminal or C-terminal end using known techniques. Such derivatives comprise for example aliphatic esters of carboxylic acid groups, amides of carboxylic acid groups, obtainable by reaction with ammonia or with a primary or secondary amine; N-acyl derivatives of free amino groups, produced by reaction with acyl groups; or O-acyl derivatives of free hydroxy groups, produced by reaction with acyl groups.

    [0137] Functional equivalents naturally also comprise polypeptides that can be obtained from other organisms, as well as naturally occurring variants. For example, areas of homologous sequence regions can be established by sequence comparison, and equivalent enzymes can be determined on the basis of the concrete parameters of the invention.

    [0138] Functional equivalents also comprise fragments, preferably individual domains or sequence motifs, of the polypeptides according to the invention, which for example display the desired biological function.

    [0139] Functional equivalents are, moreover, fusion proteins, which have one of the polypeptide sequences stated above or functional equivalents derived there from and at least one further, functionally different, heterologous sequence in functional N-terminal or C-terminal association (i.e. without substantial mutual functional impairment of the fusion protein parts). Non-limiting examples of these heterologous sequences are e.g. signal peptides, histidine anchors or enzymes.

    [0140] Functional equivalents that are also included according to the invention are homologues of the concretely disclosed proteins. These possess percent identity values as stated above. Said values refer to the identity with the concretely disclosed amino acid sequences, and may be calculated according to the algorithm of Pearson and Lipman, Proc. Natl. Acad, Sci. (USA) 85(8), 1988, 2444-2448.

    [0141] The % identity values may also be calculated from BLAST alignments, algorithm blastp (protein-protein BLAST) or by applying the Clustal setting as given below.

    [0142] A percentage identity of a homologous polypeptide according to the invention means in particular the percentage identity of the amino acid residues relative to the total length of one of the amino acid sequences concretely described herein.

    [0143] In the case of a possible protein glycosylation, functional equivalents according to the invention comprise proteins of the type designated above in deglycosylated or glycosylated form as well as modified forms that can be obtained by altering the glycosylation pattern.

    [0144] Such functional equivalents or homologues of the proteins or polypeptides according to the invention can be produced by mutagenesis, e.g. by point mutation, lengthening or shortening of the protein.

    [0145] Such functional equivalents or homologues of the proteins according to the invention can be identified by screening combinatorial databases of mutants, for example shortening mutants. For example, a variegated database of protein variants can be produced by combinatorial mutagenesis at the nucleic acid level, e.g. by enzymatic ligation of a mixture of synthetic oligonucleotides. There are a great many methods that can be used for the production of databases of potential homologues from a degenerated oligonucleotide sequence. Chemical synthesis of a degenerated gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic gene can then be ligated in a suitable expression vector. The use of a degenerated genome makes it possible to supply all sequences in a mixture, which code for the desired set of potential protein sequences. Methods of synthesis of degenerated oligonucleotides are known to a person skilled in the art (e.g. Narang, S. A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al., (1984) Science 198:1056; Ike et al. (1983) Nucleic Acids Res. 11:477).

    [0146] In the prior art, several techniques are known for the screening of gene products of combinatorial databases, which were produced by point mutations or shortening, and for the screening of cDNA libraries for gene products with a selected property. These techniques can be adapted for the rapid screening of the gene banks that were produced by combinatorial mutagenesis of homologues according to the invention. The techniques most frequently used for the screening of large gene banks, which are based on a high-throughput analysis, comprise cloning of the gene bank in expression vectors that can be replicated, transformation of the suitable cells with the resultant vector database and expression of the combinatorial genes in conditions in which detection of the desired activity facilitates isolation of the vector that codes for the gene whose product was detected. Recursive Ensemble Mutagenesis (REM), a technique that increases the frequency of functional mutants in the databases, can be used in combination with the screening tests, in order to identify homologues (Arkin and Yourvan (1992) PNAS 89:7811-7815; Delgrave et al. (1993) Protein Engineering 6(3):327-331).

    4. Coding Nucleic Acid Sequences

    [0147] The invention also relates to nucleic acid sequences that code for enzymes and mutants as defined herein.

    [0148] The present invention also relates to nucleic acids with a certain degree of identity to the sequences specifically disclosed herein. Identity between two nucleic acids means identity of the nucleotides, in each case over the entire length of the nucleic acid.

    [0149] For example the identity may be calculated by means of the Vector NTI Suite 7.1 program of the company Informax (USA) employing the Clustal Method (Higgins D G, Sharp P M. Fast and sensitive multiple sequence alignments on a microcomputer. Comput Appl. Biosci. 1989 April; 5(2):151-1) with the following settings:

    [0150] Multiple Alignment Parameter:

    TABLE-US-00003 Gap opening penalty 10 Gap extension penalty 10 Gap separation penalty range 8 Gap separation penalty off % identity for alignment delay 40 Residue specific gaps off Hydrophilic residue gap off Transition weighting 0

    [0151] Pairwise Alignment Parameter:

    TABLE-US-00004 FAST algorithm on K-tuple size 1 Gap penalty 3 Window size 5 Number of best diagonals 5

    [0152] Alternatively the identity may be determined according to Chenna, Ramu, Sugawara, Hideaki, Koike, Tadashi, Lopez, Rodrigo, Gibson, Toby J, Higgins, Desmond G, Thompson, Julie D. Multiple sequence alignment with the Clustal series of programs. (2003) Nucleic Acids Res 31 (13):3497-500, the web page: www.ebi.ac.uk/Tools/clustalw/index.html# and the following settings

    TABLE-US-00005 DNA Gap Open Penalty 15.0 DNA Gap Extension Penalty 6.66 DNA Matrix Identity Protein Gap Open Penalty 10.0 Protein Gap Extension Penalty 0.2 Protein matrix Gonnet Protein/DNA ENDGAP 1 Protein/DNA GAPDIST 4

    [0153] All the nucleic acid sequences mentioned herein (single-stranded and double-stranded DNA and RNA sequences, for example cDNA and mRNA) can be produced in a known way by chemical synthesis from the nucleotide building blocks, e.g. by fragment condensation of individual overlap-ping, complementary nucleic acid building blocks of the double helix. Chemical synthesis of oligonucleotides can, for example, be performed in a known way, by the phosphoamidite method (Voet, Voet, 2nd edition, Wiley Press, New York, pages 896-897). The accumulation of synthetic oligonucleotides and filling of gaps by means of the Klenow fragment of DNA polymerase and ligation reactions as well as general cloning techniques are described in Sambrook et al. (1989), see below.

    [0154] The invention also relates to nucleic acid sequences (single-stranded and double-stranded DNA and RNA sequences, e.g. cDNA and mRNA), coding for one of the above polypeptides and their functional equivalents, which can be obtained for example using artificial nucleotide analogs.

    [0155] The invention relates both to isolated nucleic acid molecules, which code for polypeptides or proteins according to the invention or biologically active segments thereof, and to nucleic acid fragments, which can be used for example as hybridization probes or primers for identifying or amplifying coding nucleic acids according to the invention.

    [0156] The nucleic acid molecules according to the invention can in addition contain non-translated sequences from the 3 and/or 5 end of the coding genetic region.

    [0157] The invention further relates to the nucleic acid molecules that are complementary to the concretely described nucleotide sequences or a segment thereof.

    [0158] The nucleotide sequences according to the invention make possible the production of probes and primers that can be used for the identification and/or cloning of homologous sequences in other cellular types and organisms. Such probes or primers generally comprise a nucleotide sequence region which hybridizes under stringent conditions (see below) on at least about 12, preferably at least about 25, for example about 40, 50 or 75 successive nucleotides of a sense strand of a nucleic acid sequence according to the invention or of a corresponding antisense strand.

    [0159] An isolated nucleic acid molecule is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid and can moreover be substantially free from other cellular material or culture medium, if it is being produced by recombinant techniques, or can be free from chemical precursors or other chemicals, if it is being synthesized chemically.

    [0160] A nucleic acid molecule according to the invention can be isolated by means of standard techniques of molecular biology and the sequence information supplied according to the invention. For example, cDNA can be isolated from a suitable cDNA library, using one of the concretely disclosed complete sequences or a segment thereof as hybridization probe and standard hybridization techniques (as described for example in Sambrook, J., Fritsch, E. F. and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd edition, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989). In addition, a nucleic acid molecule comprising one of the disclosed sequences or a segment thereof, can be isolated by the polymerase chain reaction, using the oligonucleotide primers that were constructed on the basis of this sequence. The nucleic acid amplified in this way can be cloned in a suitable vector and can be characterized by DNA sequencing. The oligonucleotides according to the invention can also be produced by standard methods of synthesis, e.g. using an automatic DNA synthesizer.

    [0161] Nucleic acid sequences according to the invention or derivatives thereof, homologues or parts of these sequences, can for example be isolated by usual hybridization techniques or the PCR technique from other bacteria, e.g. via genomic or cDNA libraries. These DNA sequences hybridize in standard conditions with the sequences according to the invention.

    [0162] Hybridize means the ability of a polynucleotide or oligonucleotide to bind to an almost complementary sequence in standard conditions, whereas nonspecific binding does not occur between non-complementary partners in these conditions. For this, the sequences can be 90-100% complementary. The property of complementary sequences of being able to bind specifically to one another is utilized for example in Northern Blotting or Southern Blotting or in primer binding in PCR or RT-PCR.

    [0163] Short oligonucleotides of the conserved regions are used advantageously for hybridization. However, it is also possible to use longer fragments of the nucleic acids according to the invention or the complete sequences for the hybridization. These standard conditions vary depending on the nucleic acid used (oligonucleotide, longer fragment or complete sequence) or depending on which type of nucleic acidDNA or RNAis used for hybridization. For example, the melting temperatures for DNA:DNA hybrids are approx. 10 C. lower than those of DNA:RNA hybrids of the same length.

    [0164] For example, depending on the particular nucleic acid, standard conditions mean temperatures between 42 and 58 C. in an aqueous buffer solution with a concentration between 0.1 to 5SSC (1SSC=0.15 M NaCl, 15 mM sodium citrate, pH 7.2) or additionally in the presence of 50% formamide, for example 42 C. in 5SSC, 50% formamide. Advantageously, the hybridization conditions for DNA:DNA hybrids are 0.1SSC and temperatures between about 20 C. to 45 C., preferably between about 30 C. to 45 C. For DNA:RNA hybrids the hybridization conditions are advantageously 0.1SSC and temperatures between about 30 C. to 55 C., preferably between about 45 C. to 55 C. These stated temperatures for hybridization are examples of calculated melting temperature values for a nucleic acid with a length of approx. 100 nucleotides and a G+C content of 50% in the absence of formamide. The experimental conditions for DNA hybridization are described in relevant genetics textbooks, for example Sambrook et al., 1989, and can be calculated using formulae that are known by a person skilled in the art, for example depending on the length of the nucleic acids, the type of hybrids or the G+C content. A person skilled in the art can obtain further information on hybridization from the following textbooks: Ausubel et al. (eds), 1985, Current Protocols in Molecular Biology, John Wiley & Sons, New York; Hames and Higgins (eds), 1985, Nucleic Acids Hybridization: A Practical Approach, IRL Press at Oxford University Press, Oxford; Brown (ed), 1991, Essential Molecular Biology: A Practical Approach, IRL Press at Oxford University Press, Oxford.

    [0165] Hybridization can in particular be carried out under stringent conditions. Such hybridization conditions are for example described in Sambrook, J., Fritsch, E. F., Maniatis, T., in: Molecular Cloning (A Laboratory Manual), 2nd edition, Cold Spring Harbor Laboratory Press, 1989, pages 9.31-9.57 or in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.

    [0166] Stringent hybridization conditions mean in particular: Incubation at 42 C. overnight in a solution consisting of 50% formamide, 5SSC (750 mM NaCl, 75 mM tri-sodium citrate), 50 mM sodium phosphate (pH 7.6), 5Denhardt Solution, 10% dextran sulfate and 20 g/ml denatured, sheared salmon sperm DNA, followed by washing of the filters with 0.1SSC at 65 C.

    [0167] The invention also relates to derivatives of the concretely disclosed or derivable nucleic acid sequences.

    [0168] Thus, further nucleic acid sequences according to the invention can be derived from the sequences specifically disclosed herein and can differ from it by addition, substitution, insertion or deletion of individual or several nucleotides, and furthermore code for polypeptides with the desired profile of properties.

    [0169] The invention also encompasses nucleic acid sequences that comprise so-called silent mutations or have been altered, in comparison with a concretely stated sequence, according to the codon usage of a special original or host organism, as well as naturally occurring variants, e.g. splicing variants or allelic variants, thereof.

    [0170] It also relates to sequences that can be obtained by conservative nucleotide substitutions (i.e. the amino acid in question is replaced by an amino acid of the same charge, size, polarity and/or solubility).

    [0171] The invention also relates to the molecules derived from the concretely disclosed nucleic acids by sequence polymorphisms. These genetic polymorphisms can exist between individuals within a population owing to natural variation. These natural variations usually produce a variance of 1 to 5% in the nucleotide sequence of a gene.

    [0172] Derivatives of nucleic acid sequences according to the invention mean for example allelic variants, having at least 60% homology at the level of the derived amino acid, preferably at least 80% homology, quite especially preferably at least 90% homology over the entire sequence range (regarding homology at the amino acid level, reference should be made to the details given above for the polypeptides). Advantageously, the homologies can be higher over partial regions of the sequences.

    [0173] Furthermore, derivatives are also to be understood to be homologues of the nucleic acid sequences according to the invention, for example animal, plant, fungal or bacterial homologues, shortened sequences, single-stranded DNA or RNA of the coding and noncoding DNA sequence. For example, homologues have, at the DNA level, a homology of at least 40%, preferably of at least 60%, especially preferably of at least 70%, quite especially preferably of at least 80% over the entire DNA region given in a sequence specifically disclosed herein.

    [0174] Moreover, derivatives are to be understood to be, for example, fusions with promoters. The promoters that are added to the stated nucleotide sequences can be modified by at least one nucleotide exchange, at least one insertion, inversion and/or deletion, though without impairing the functionality or efficacy of the promoters. Moreover, the efficacy of the promoters can be increased by altering their sequence or can be exchanged completely with more effective promoters even of organisms of a different genus.

    5. Constructs According to the Invention

    [0175] The invention also relates to expression constructs, containing, under the genetic control of regulatory nucleotide sequences, a nucleotide sequence coding for a polypeptide or fusion protein according to the invention; as well as vectors comprising at least one of these expression constructs.

    [0176] Expression unit means, according to the invention, a nucleic acid with expression activity, which comprises a promoter as defined herein and, after functional association with a nucleic acid that is to be expressed or a gene, regulates the expression, i.e. the transcription and the translation of this nucleic acid or of this gene. In this context, therefore, it is also called a regulatory nucleic acid sequence. In addition to the promoter, other regulatory elements may be present, e.g. enhancers.

    [0177] Expression cassette or expression construct means, according to the invention, an expression unit, which is functionally associated with the nucleic acid that is to be expressed or the gene that is to be expressed. In contrast to an expression unit, an expression cassette thus comprises not only nucleic acid sequences, which regulate transcription and translation, but also the nucleic acid sequences, which should be expressed as protein as a result of the transcription and translation.

    [0178] The terms expression or overexpression describe, in the context of the invention, the production or increase of intracellular activity of one or more enzymes in a microorganism, which are encoded by the corresponding DNA. For this, it is possible for example to insert a gene in an organism, replace an existing gene by another gene, increase the number of copies of the gene or genes, use a strong promoter or use a gene that codes for a corresponding enzyme with a high activity, and optionally these measures can be combined.

    [0179] Preferably such constructs according to the invention comprise a promoter 5-upstream from the respective coding sequence, and a terminator sequence 3-downstream, and optionally further usual regulatory elements, in each case functionally associated with the coding sequence.

    [0180] A promoter, a nucleic acid with promoter activity or a promoter sequence mean, according to the invention, a nucleic acid that, functionally associated with a nucleic acid that is to be transcribed, regulates the transcription of this nucleic acid.

    [0181] Functional or operative association means, in this context, for example the sequential arrangement of one of the nucleic acids with promoter activity and of a nucleic acid sequence that is to be transcribed and optionally further regulatory elements, for example nucleic acid sequences that enable the transcription of nucleic acids, and for example a terminator, in such a way that each of the regulatory elements can fulfill its function in the transcription of the nucleic acid sequence. This does not necessarily require a direct association in the chemical sense. Genetic control sequences, such as enhancer sequences, can also exert their function on the target sequence from more remote positions or even from other DNA molecules. Arrangements are preferred in which the nucleic acid sequence that is to be transcribed is positioned behind (i.e. at the 3 end) the promoter sequence, so that the two sequences are bound covalently to one another. The distance between the promoter sequence and the nucleic acid sequence that is to be expressed transgenically can be less than 200 bp (base pairs), or less than 100 bp or less than 50 bp.

    [0182] Apart from promoters and terminators, examples of other regulatory elements that may be mentioned are targeting sequences, enhancers, polyadenylation signals, selectable markers, amplification signals, replication origins and the like. Suitable regulatory sequences are described for example in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).

    [0183] Nucleic acid constructs according to the invention comprise in particular sequences selected from those, specifically mentioned herein or derivatives and homologues thereof, as well as the nucleic acid sequences that can be derived from amino acid sequences specifically mentioned herein which are advantageously associated operatively or functionally with one or more regulating signal for controlling, e.g. increasing, gene expression.

    [0184] In addition to these regulatory sequences, the natural regulation of these sequences can still be present in front of the actual structural genes and optionally can have been altered genetically, so that natural regulation is switched off and the expression of the genes has been increased. The nucleic acid construct can also be of a simpler design, i.e. without any additional regulatory signals being inserted in front of the coding sequence and without removing the natural promoter with its regulation. Instead, the natural regulatory sequence is silenced so that regulation no longer takes place and gene expression is increased.

    [0185] A preferred nucleic acid construct advantageously also contains one or more of the aforementioned enhancer sequences, functionally associated with the promoter, which permit increased expression of the nucleic acid sequence. Additional advantageous sequences, such as other regulatory elements or terminators, can also be inserted at the 3 end of the DNA sequences. One or more copies of the nucleic acids according to the invention can be contained in the construct. The construct can also contain other markers, such as antibiotic resistances or auxotrophy-complementing genes, optionally for selection on the construct.

    [0186] Examples of suitable regulatory sequences are contained in promoters such as cos-, tac-, trp-, tet-, trp-tet-, lpp-, lac-, lpp-lac-, lacl.sup.q-, T7-, T5-, T3-, gal-, trc-, ara-, rhaP (rhaP.sub.BAD)SP6-, lamb-da-P.sub.R- or in the lambda-P.sub.L promoter, which find application advantageously in Gram-negative bacteria. Other advantageous regulatory sequences are contained for example in the Gram-positive promoters ace, amy and SPO2, in the yeast or fungal promoters ADC1, MFalpha, AC, P-60, CYC1, GAPDH, TEF, rp28, ADH. Artificial promoters can also be used for regulation.

    [0187] For expression, the nucleic acid construct is inserted in a host organism advantageously in a vector, for example a plasmid or a phage, which permits optimum expression of the genes in the host. In addition to plasmids and phages, vectors are also to be understood as meaning all other vectors known to a person skilled in the art, e.g. viruses, such as SV40, CMV, baculovirus and adenovirus, transposons, IS elements, phasmids, cosmids, and linear or circular DNA. These vectors can be replicated autonomously in the host organism or can be replicated chromosomally. These vectors represent a further embodiment of the invention.

    [0188] Suitable plasmids are, for example in E. coli, pLG338, pACYC184, pBR322, pUC18, pUC19, pKC30, pRep4, pHS1, pKK223-3, pDHE19.2, pHS2, pPLc236, pMBL24, pLG200, pUR290, pIN-III.sup.113-B1, gt11 or pBdCl; in nocardioform actinomycetes pJAM2; in Streptomyces pIJ101, pIJ364, pIJ702 or pIJ361; in bacillus pUB110, pC194 or pBD214; in Corynebacterium pSA77 or pAJ667; in fungi pALS1, pIL2 or pBB116; in yeasts 2alphaM, pAG-1, YEp6, YEp13 or pEMBLYe23 or in plants pLGV23, pGHlac.sup.+, pBIN19, pAK2004 or pDH51. The aforementioned plasmids represent a small selection of the possible plasmids. Other plasmids are well known to a person skilled in the art and will be found for example in the book Cloning Vectors (Eds. Pouwels P. H. et al. Elsevier, Amster-dam-New York-Oxford, 1985, ISBN 0 444 904018).

    [0189] In a further embodiment of the vector, the vector containing the nucleic acid construct according to the invention or the nucleic acid according to the invention can be inserted advantageously in the form of a linear DNA in the microorganisms and integrated into the genome of the host organism through heterologous or homologous recombination. This linear DNA can comprise a linearized vector such as plasmid or just the nucleic acid construct or the nucleic acid according to the invention.

    [0190] For optimum expression of heterologous genes in organisms, it is advantageous to alter the nucleic acid sequences in accordance with the specific codon usage employed in the organism. The codon usage can easily be determined on the basis of computer evaluations of other, known genes of the organism in question.

    [0191] The production of an expression cassette according to the invention is based on fusion of a suitable promoter with a suitable coding nucleotide sequence and a terminator signal or polyadenylation signal. Common recombination and cloning techniques are used for this, as described for example in T. Maniatis, E. F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1989) as well as in T. J. Silhavy, M. L. Berman and L. W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1984) and in Ausubel, F. M. et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley Interscience (1987).

    [0192] The recombinant nucleic acid construct or gene construct is inserted advantageously in a host-specific vector for expression in a suitable host organism, to permit optimum expression of the genes in the host. Vectors are well known to a person skilled in the art and will be found for example in Cloning Vectors (Pouwels P. H. et al., Publ. Elsevier, Amsterdam-New York-Oxford, 1985).

    6. Hosts that can be Used According to the Invention

    [0193] Depending on the context, the term microorganism means the starting microorganism (wild-type) or a genetically modified microorganism according to the invention, or both.

    [0194] The term wild-type means, according to the invention, the corresponding starting microorganism, and need not necessarily correspond to a naturally occurring organism.

    [0195] By means of the vectors according to the invention, recombinant microorganisms can be produced, which have been transformed for example with at least one vector according to the invention and can be used for production of the polypeptides according to the invention. Advantageously, the recombinant constructs according to the invention, described above, are inserted in a suitable host system and expressed. Preferably, common cloning and transfection methods that are familiar to a person skilled in the art are used, for example co-precipitation, protoplast fusion, electroporation, retroviral transfection and the like, in order to secure expression of the stated nucleic acids in the respective expression system. Suitable systems are described for example in Current Protocols in Molecular Biology, F. Ausubel et al., Publ. Wiley Interscience, New York 1997, or Sambrook et al. Molecular Cloning: A Laboratory Manual. 2nd edition, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.

    [0196] In principle, all prokaryotic organisms can be considered as recombinant host organisms for the nucleic acid according to the invention or the nucleic acid construct. Bacteria are used advantageously as host organisms. Preferably they are selected from native or recombinant bacteria having the ability to produce inclusion bodies of the PHA-, TAG- or WE-type, as in particular the TAG-producing nocardioform actinomycetes, in particular of the genus Rhodococcus, Mycobacterium, Nocardia, Gordonia, Skermania and Tsukamurella; as well as TAG-producing Streptomycetes; WE-producing genera Acinetobacter and Alcanivorax; as well as recombinant strains of the genus Escherichia, especially E. coli, Corynebacterium, especially C. glutamicum und Bacillus, especially B. subtilis.

    [0197] The host organism or host organisms according to the invention then preferably contain at least one of the nucleic acid sequences, nucleic acid constructs or vectors described in this invention, which code for an enzyme activity according to the above definition.

    [0198] The organisms used in the method according to the invention are grown or bred in a manner familiar to a person skilled in the art, depending on the host organism. As a rule, microorganisms are grown in a liquid medium, which contains a source of carbon, generally in the form of sugars, a source of nitrogen generally in the form of organic sources of nitrogen such as yeast extract or salts such as ammonium sulfate, trace elements such as iron, manganese and magnesium salts and optionally vitamins, at temperatures between 0 C. and 100 C., preferably between 10 C. to 60 C. with oxygen aeration. The pH of the liquid nutrient medium can be maintained at a fixed value, i.e. regulated or not regulated during growing. Growing can be carried out batch wise, semi-batch wise or continuously. Nutrients can be supplied at the start of fermentation or can be supplied subsequently, either semi-continuously or continuously.

    7. Recombinant Production of Enzymes of the Invention

    [0199] The invention also relates to methods for production of enzymes used in methods according to the invention by cultivating a microorganism which expresses said enzyme, and isolating the desired product from the culture.

    [0200] The microorganisms as used according to the invention can be cultivated continuously or discontinuously in the batch process or in the fed batch or repeated fed batch process. A review of known methods of cultivation will be found in the textbook by Chmiel (Bioprocesstechnik 1. Einfuhrung in die Bioverfahrenstechnik (Gustav Fischer Verlag, Stuttgart, 1991)) or in the textbook by Storhas (Bioreaktoren und periphere Einrichtungen (Vieweg Verlag, Braunschweig/Wiesbaden, 1994)).

    [0201] The culture medium that is to be used must satisfy the requirements of the particular strains in an appropriate manner. Descriptions of culture media for various microorganisms are given in the handbook Manual of Methods for General Bacteriology of the American Society for Bacteriology (Washington D. C., USA, 1981).

    [0202] These media that can be used according to the invention generally comprise one or more sources of carbon, sources of nitrogen, inorganic salts, vitamins and/or trace elements.

    [0203] Preferred sources of carbon are sugars, such as mono-, di- or polysaccharides. Very good sources of carbon are for example glucose, fructose, mannose, galactose, ribose, sorbose, ribulose, lactose, maltose, sucrose, raffinose, starch or cellulose. Sugars can also be added to the media via complex compounds, such as molasses, or other by-products from sugar refining. It may also be advantageous to add mixtures of various sources of carbon. Other possible sources of carbon are oils and fats such as soybean oil, sunflower oil, peanut oil and coconut oil, fatty acids such as palmitic acid, stearic acid or linoleic acid, alcohols such as glycerol, methanol or ethanol and organic acids such as acetic acid or lactic acid.

    [0204] Sources of nitrogen are usually organic or inorganic nitrogen compounds or materials containing these compounds. Examples of sources of nitrogen include ammonia gas or ammonium salts, such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate or ammonium nitrate, nitrates, urea, amino acids or complex sources of nitrogen, such as corn-steep liquor, soybean flour, soybean protein, yeast extract, meat extract and others. The sources of nitrogen can be used separately or as a mixture.

    [0205] Inorganic salt compounds that may be present in the media comprise the chloride, phosphate or sulfate salts of calcium, magnesium, sodium, cobalt, molybdenum, potassium, manganese, zinc, copper and iron.

    [0206] Inorganic sulfur-containing compounds, for example sulfates, sulfites, dithionites, tetrathionates, thiosulfates, sulfides, but also organic sulfur compounds, such as mercaptans and thiols, can be used as sources of sulfur.

    [0207] Phosphoric acid, potassium dihydrogenphosphate or dipotassium hydrogenphosphate or the corresponding sodium-containing salts can be used as sources of phosphorus.

    [0208] Chelating agents can be added to the medium, in order to keep the metal ions in solution. Especially suitable chelating agents comprise dihydroxyphenols, such as catechol or protocatechuate, or organic acids, such as citric acid.

    [0209] The fermentation media used according to the invention may also contain other growth factors, such as vitamins or growth promoters, which include for example biotin, riboflavin, thiamine, folic acid, nicotinic acid, pantothenate and pyridoxine. Growth factors and salts often come from complex components of the media, such as yeast extract, molasses, corn-steep liquor and the like. In addition, suitable precursors can be added to the culture medium. The precise composition of the compounds in the medium is strongly dependent on the particular experiment and must be decided individually for each specific case. Information on media optimization can be found in the textbook Applied Microbiol. Physiology, A Practical Approach (Publ. P. M. Rhodes, P. F. Stanbury, IRL Press (1997) p. 53-73, ISBN 0 19 963577 3). Growing media can also be obtained from commercial suppliers, such as Standard 1 (Merck) or BHI (Brain heart infusion, DIFCO) etc.

    [0210] All components of the medium are sterilized, either by heating (20 min at 1.5 bar and 121 C.) or by sterile filtration. The components can be sterilized either together, or if necessary separately. All the components of the medium can be present at the start of growing, or optionally can be added continuously or by batch feed.

    [0211] The temperature of the culture is normally between 15 C. and 45 C., preferably 25 C. to 40 C. and can be kept constant or can be varied during the experiment. The pH value of the medium should be in the range from 5 to 8.5, preferably around 7.0. The pH value for growing can be controlled during growing by adding basic compounds such as sodium hydroxide, potassium hydroxide, ammonia or ammonia water or acid compounds such as phosphoric acid or sulfuric acid. Anti-foaming agents, e.g. fatty acid polyglycol esters, can be used for controlling foaming. To maintain the stability of plasmids, suitable substances with selective action, e.g. antibiotics, can be added to the medium. Oxygen or oxygen-containing gas mixtures, e.g. the ambient air, are fed into the culture in order to maintain aerobic conditions. The temperature of the culture is normally from 20 C. to 45 C. Culture is continued until a maximum of the desired product has formed. This is normally achieved within 10 hours to 160 hours.

    [0212] The cells can be disrupted optionally by high-frequency ultrasound, by high pressure, e.g. in a French pressure cell, by osmolysis, by the action of detergents, lytic enzymes or organic solvents, by means of homogenizers or by a combination of several of the methods listed.

    8. Reaction Conditions for Biocatalytic Methods of the Invention

    [0213] The at least one enzyme which is present during a method of the invention or an individual step of a multistep-method as defined herein above, can be present in living cells naturally or recombinantly producing the enzyme or enzymes, in harvested cells, in dead cells, in permeabilized cells, in crude cell extracts, in purified extracts, or in essentially pure or completely pure form. The at least one enzyme may be present in solution or as an enzyme immobilized on a carrier. One or several enzymes may simultaneously be present in soluble and immobilised form.

    [0214] The methods according to the invention can be performed in common reactors, which are known to those skilled in the art, and in different ranges of scale, e.g. from a laboratory scale (few millilitres to dozens of liters of reaction volume) to an industrial scale (several liters to thousands of cubic meters of reaction volume). If the lipase is used in a form encapsulated by non-living, optionally permeabilized cells, in the form of a more or less purified cell extract or in purified form, a chemical reactor can be used. The chemical reactor usually allows controlling the amount of the at least one enzyme, the amount of the at least one substrate, the pH, the temperature and the circulation of the reaction medium. When the at least one enzyme is present in living cells, the process will be a fermentation. In this case the biocatalytic production will take place in a bioreactor (fermenter), where parameters necessary for suitable living conditions for the living cells (e.g. culture medium with nutrients, temperature, aeration, presence or absence of oxygen or other gases, antibiotics, and the like) can be controlled. Those skilled in the art are familiar with chemical reactors or bioreactors, e.g. with procedures for up-scaling chemical or biotechnological methods from laboratory scale to industrial scale, or for optimizing process parameters, which are also extensively described in the literature (for biotechnological methods see e.g. Crueger und Crueger, BiotechnologieLehrbuch der angewandten Mikrobiologie, 2. Ed., R. Oldenbourg Verlag, Mnchen, Wien, 1984).

    [0215] Cells containing the at least one enzyme can be permeabilized by physical or mechanical means, such as ultrasound or radiofrequency pulses, French presses, or chemical means, such as hypotonic media, lytic enzymes and detergents present in the medium, or combination of such methods. Examples for detergents are digitonin, n-dodecylmaltoside, octylglycoside, Triton X-100, Tween 20, deoxycholate, CHAPS (3-[(3-Cholamidopropyl)dimethylammonio]-1-propansulfonate), Nonidet 6 P40 (Ethylphenolpoly(ethyleneglycolether), and the like.

    [0216] If the at least one enzyme is immobilised, it is attached to an inert carrier. Suitable carrier materials are known in the art and are, e.g., disclosed in EP-A-1149849, EP-A-1 069 183 and DE-OS 100193773 as well as the literature references cited therein (all of which are specifically enclosed with regard to carrier materials). Examples for suitable carrier materials are clays, clay minerals such as kaolinite, diatomeceous earth, perlite, silica, alumina, sodium carbonate, calcium carbonate, cellulose powder, anion exchanger materials, synthetic polymers, such as polystyrene, acrylic resins, phenol formaldehyde resins, polyurethanes and polyolefins, such as polyethylene and polypropylene. For preparing carrier-bound enzymes the carrier materials usually are used in the form of fine powders, wherein porous forms are preferred. The particle size of the carrier material usually does not exceed 5 mm, in particular 2 mm. In case the at least one enzyme is present in a whole-cell-preparation, said whole-cell-preparation may be present in a free or immobilised form. Suitable carrier materials are e.g. Ca-alginate or Carrageenan. Enzymes as well as cells may directly be linked by glutaraldehyde. A wide range of immobilisation methods is known in the art (e.g. J. Lalonde and A. Margolin Immobilization of Enzymes in K. Drauz und H. Waldmann, Enzyme Catalysis in Organic Synthesis 2002, Vol.III, 991-1032, Wiley-VCH, Weinheim).

    [0217] The conversion reaction can be carried out batch wise, semi-batch wise or continuously. Reactants (and optionally nutrients) can be supplied at the start of reaction or can be supplied subsequently, either semi-continuously or continuously.

    [0218] The reaction of the invention, depending on the particular reaction type, may be performed in an aqueous or non-aqueous reaction medium. Ester cleavage reaction are preferably performed in the presence of water, in particular in the present of an aqueous-organic solvent system, preferably a 2-phase system. Esterification reactions are predereably performed in the absence of water, more particularly in the presence of an organic solvent which is free or substantially free of water.

    [0219] An aqueous medium may contain a suitable buffer in order to adjust the pH to a value in the range of 5 to 9, like 6 to 8.

    [0220] The non-aqueous medium may contain is substantially free of water, i.e. will contain less that about 1 wt.-% or 0.5 wt.-% of water.

    [0221] In particular, biocatalytic methods are performed in an organic non-aqueous medium. As suitable organic solvents there may be mentioned aliphatic hydrocarbons having for example 5 to 8 carbon atoms, like pentane, cyclopentane, hexane, cyclohexane, heptane, octane or cyclooctane; aromatic carbohydrates, like benzene, toluene, xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic and ethers, like diethylether, methyl-tert.-butylether, ethyl-tert.-butylether, dipropylether, diisopropylether, dibutylether; or mixtures thereof. Preferably an organic solvent is applied which has the ability to form a biphasic solvent system with water The concentration of the reactants/substrates may be adapted to the optimum reaction conditions, which may depend on the specific enzyme applied. For example, the initial substrate concentration may be in the 0.1 to 0.5 M, as for example 10 to 100 mM.

    [0222] The reaction temperature may be adapted to the optimum reaction conditions, which may depend on the specific enzyme applied. For example, the reaction may be performed at a temperature in a range of from 0 to 70 C., as for example 20 to 50 or 25 to 40 C. Examples for reaction temperatures are about 30 C., about 35 C., about 37 C., about 40 C., about 45 C., about 50 C., about 55 C. and about 60 C.

    [0223] The process may proceed until equilibrium between the substrate and then product(s) is achieved, but may be stopped earlier. Usual process times are in the range from 1 minute to 25 hours, in particular 10 min to 6 hours, as for example in the range from 1 hour to 4 hours, in particular 1.5 hours to 3.5 hours.

    8.1 Selective Enzymatic Esterification of a 3-Unsaturated Carboxylic Acid, Likehomofarnesylic Acid

    [0224] In a preferred embodiment, a mixture of (3E/Z) isomers of the 3-unsaturated carboxylic acid, like in particular of (3E,7E)- and (3Z,7E)-homofarnesylic acid, an aliphatic alcohol and optionally an organic solvent is treated with the lipase enzyme for performing an esterification reaction.

    [0225] Non-limiting examples of suitable lipases are Candida antarctica lipase (CALB), and the immobilized analog thereof, like Novozym 435.

    [0226] Non-limiting examples of suitable alcohols are aliphatic C.sub.1-C.sub.20-alcohols, as for example methanol, ethanol, n-propanol, i-propanol, n-butanol, i-butanol, sec.-butanol, n-pentanol, n-hexanol, n-heptanol and n-octanol.

    [0227] Non-limiting examples of suitable solvents are in particular aliphatic hydrocarbons, as for example hexane, cyclohexane, heptane, octane; aromatic hydrocarbons, as for example toluene, xylene; dialkyl ethers, as for example MTBE and diisopropyl ether.

    [0228] In a preferred embodiment, one equivalent alcohol is used per one equivalent of (3E)-carboxylic acid, in particular (3E,7E)-isomer of homofarnesylic acid, in order to obtain an essentially complete conversion. Applying low amounts of alcohol limits the ester yield.

    [0229] The reaction is suitably performed in a temperature range of about 0 C. and +80 C. The progress of the reaction may be controlled by means of GC or HPLC analytics.

    [0230] A separable acid/ester mixture of the carboxylic acid isomers is obtained.

    8.2 Selective Enzymatic Saponification of 3-Unsaturated Carboxylic Acid Ester, Like Homofarnesylic Acid Esters

    [0231] In another embodiment a separable mixture of isomers is obtained by applying an enzyme catalyzed ester cleavage of an 3E/Z-isomer mixture of the 3-unsaturated carboxylic acid, in particular of a mixture of (3E,7E)- and (3Z,7E)-isomers of homofarnesylic acid alkyl esters. In a reaction the free 3E-acid, in particular (3E,7E)-homofarnesylic acid isomer and the non-reacted 3Z ester, in particular the non-reacted (3Z,7E)-homofarnesylic acid ester are obtained.

    [0232] In a preferred embodiment an isomer mixture of the carboxylic acid alkyl esters, optionally dissolved in an organic solvent, is converted by applying a lipase enzyme in the presence of water.

    [0233] Non-limiting examples of suitable lipases are Candida antarctica lipase (CALB), and the immobilized analog thereof, like Novozym 435.

    [0234] Non-limiting examples of suitable alkyl residues of the ester are: methyl, ethyl, n-propyl, i-propyl, n-butyl, i-butyl and sec-butyl

    [0235] Non-limiting examples of suitable solvents are aliphatic hydrocarbons as, for example, hexane cyclohexane, heptane; aromatic hydrocarbons, like toluene and xylene; ethers as, for example, MTBE and diisopropyl ether, THF.

    8.3 Preparation of ()-Ambrox

    [0236] The preparation may be performed starting out from the stereoisomerically pure (3E/7E) homofarnesylic acid as obtained according to the present invention by applying known methods as depicted in the above Scheme 1.

    [0237] The disclosure of EP16156410 and WO2010/139719 as stated in Scheme 1 as well as of WO2012/066059 describing the biocatalytic conversion of unsaturated substrates by applying cyclase enzymes of different origin is incorporated by reference.

    [0238] Sclareolide, as for example obtained by the cyclase-catalyzed conversion of (3E/7E)-homofarnesylic acid of the invention which then is chemically reduced (for example by means of LiAlH.sub.4 or NaBH4) to form a mbrox-1,4-diol [Mookherjee et al.; Perfumer and Flavourist (1990), 15: 27]. Ambrox-1,4-diol may then be chemically converted by means of different processes to ()-ambrox. (see for example U.S. Pat. No. 5,274,134).

    [0239] The biocatalytic synthesis of compound ()-ambrox is also described in the literature [Neumann et al.; Biol Chem Hoppe Seyler (1986), 367: 723]. The molecule is obtained from homofarnesol ((3Z,7E)-4,8,12-trimethyltrideca-3,7,11-trien-1-ol and the squalene-hopen cyclase (SHC) from Alicyclobacillus acidocaldarius (formerly Bacillus acidocaidarius) was used as the catalyst.

    9. Product Isolation

    [0240] The methodology of the present invention can further include a step of recovering an end or intermediate product, optionally in stereoisomerically or enantiomerically substantially pure form. The term recovering includes extracting, harvesting, isolating or purifying the compound from culture or reaction media. Recovering the compound can be performed according to any conventional isolation or purification methodology known in the art including, but not limited to, treatment with a conventional resin (e.g., anion or cation exchange resin, non-ionic adsorption resin, etc.), treatment with a conventional adsorbent (e.g., activated charcoal, silicic acid, silica gel, cellulose, alumina, etc.), alteration of pH, solvent extraction (e.g., with a conventional solvent such as an alcohol, ethyl acetate, hexane and the like), distillation, dialysis, filtration, concentration, crystallization, recrystallization, pH adjustment, lyophilization and the like.

    [0241] Identity and purity of the isolated product may be determined by known techniques, like High Performance Liquid Chromatography (HPLC), gas chromatography (GC), Spektroskopy (like IR, UV, NMR), Colouring methods, TLC, NIRS, enzymatic or microbial assays. (see for example: Patek et al. (1994) Appl. Environ. Microbiol. 60:133-140; Malakhova et al. (1996) Biotekhnologiya 11 27-32; und Schmidt et al. (1998) Bioprocess Engineer. 19:67-70. Ullmann's Encyclopedia of Industrial Chemistry (1996) Bd. A27, VCH: Weinheim, S. 89-90, S. 521-540, S. 540-547, S. 559-566, 575-581 und S. 581-587; Michal, G (1999) Biochemical Pathways: An Atlas of Biochemistry and Molecular Biology, John Wiley and Sons; Fallon, A. et al. (1987) Applications of HPLC in Biochemistry in: Laboratory Techniques in Biochemistry and Molecular Biology, Bd. 17.)

    [0242] The following examples only serve to illustrate the invention. The numerous possible variations that are obvious to a person skilled in the art also fall within the scope of the invention.

    Experimental Part

    A. Materials

    (1) Enzymes

    [0243] Lipase: Novozym 435; commercial product of Novozymes; [0244] immobilized Candida antarctica lipase B

    Amino Acid Sequence:

    [0245]

    TABLE-US-00006 1 MKLLSLTGVAGVLATCVAATPLVKRLPSGSDPAFSQPKSVLDAGLTCQGASPSSVSKPIL 61 LVPGTGTTGPQSFDSNWIPLSTQLGYTPCWISPPPFMLNDTQVNTEYMVNAITALYAGSG 121 NNKLPVLTWSQGGLVAQWGLTFFPSIRSKVDRLMAFAPDYKGTVLAGPLDALAVSAPSVW 181 QQTTGSALTTALRNAGGLTQIVPTTNLYSATDEIVQPQVSNSPLDSSYLFNGKNVQAQAV 241 CGPLFVIDHAGSLTSQFSYVVGRSALRSTTGQARSADYGITDCNPLPANDLTPEQKVAAA 301 ALLAPAAAAIVAGPKQNCEPDLMPYARPFAVGKRTCSGIVTP

    Cyclase: Zm-SHC-1 See Below

    [0246] Unless otherwise specified, recombinant proteins are cloned and expressed by standard methods, such as, for example, as described by Sambrook, J., Fritsch, E. F. and Maniatis, T., Molecular cloning: A Laboratory Manual, 2.sup.nd Edition, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.

    (2) Chemicals

    [0247] Isomer mixtures of homofarnesylic acid are for example obtained by a method as described in European Patent Application, application Number EP 17157950.1 filed on Feb. 24, 2017.

    [0248] Isomer mixtures of homofarnesylic acid esters have been prepared (e.g. in accordance with the generally known add-catalyzed esterification of carboxylic acids with alcohols (so-called Fischer esterificationChemische Berichte 28, 1895, 3252-3258) from isomeric mixtures of homofarnesylic acid.

    [0249] All other chemical as applied were of laboratory grade.

    B. Methods:

    1. HPLC Parameters for the Analysis of Homofarnesylic Acid Compounds

    Apparatus: Agilent Series 1100

    Column: Chiralpak AD-RH 5 m 150*4.6 mm von Daicel

    [0250] Eluent: A: Water with 0.1 Vol % H.sub.3PO.sub.4 [0251] B: Acetonitrile mit 0.1 Vol % H.sub.3PO.sub.4

    TABLE-US-00007 Time in min % B Flow 0.0 30 1.2 25.0 70 1.2 30.0 100 1.2 30.1 30 1.2

    Detector: UV-Detector X=205 nm, BW=5 nm

    [0252] Flow rate: 1.2 ml/min

    Injection: 5

    Temp.: 40 C.

    Duration: 35 min

    [0253] Pressure: approx. 70 bar

    TABLE-US-00008 Retention time Homofamesylic acid Ester [min] 3Z,7E 10.31 3E,7E 11.73 3Z,7E Methyl ester 17.33 3E,7E Methyl ester 19.37 3Z,7E Ethyl ester 18.87 3E,7E Ethyl ester 21.28 3Z,7E iso-Propyl ester 20.06 3E,7E iso-Propyl ester 21.73 3Z,7E Butyl ester 23.25 3E,7E Butyl ester 26.24 3Z,7E Octyl ester 29.77 3E,7E Octyl ester 30.88

    2. GC Parameters for the Analysis of Sclareolide

    [0254] The conversion of homofarnesylic acid into sclareolide can be determined with the following GC system:

    Column: 10 m Optima 1

    [0255] Temperature profile: [0256] 0 min: 100 C. [0257] 5 C./min to 200 C. [0258] After 5 min [0259] 30 C./min to 320 C. [0260] thereafter constant [0261] Duration of the method: 30 min
    Injector temperature: 280 C.
    Retention times (RT):

    [0262] Homofarnesylic acid: peak 1 at 11.7 min, peak 2 at 12.1 min; [0263] Sclareolide: approx. 13.5 min

    [0264] A calibration series, with the aid of which the concentration of unknown samples was determined, is established using authentic material (Sigma, catalog No.: 358002).

    2. Lipase Activity Measurement

    [0265] Tributyrin Assay according to Beisson, F. et al. Eur. J. Lipid Sci. Technol. 2000, 133-153.

    B. Examples

    Reference Example 1: Cloning of the Zm-SHC-1 and Expression in E. coli

    [0266] The gene of the cyclase may be amplified from Zymomonas mobilis with the aid of the oligonucleotides Zm-SHC_fw and Zm-SHC_rev.

    TABLE-US-00009 Primer: PrimerNo. sequence(5->3) Position Zm-SHC_fw gcgctgtttcatatgggtattgaca N-termprimer (SEQIDNO:327) Zm-SHC_rev gcgcttaccctggatcctcgaaaat C-termprimer (SEQIDNO:328)

    [0267] In each case 100 ng of primers Zm-SHC_fw and Zm-SHC_rev were mixed in an equimolar ratio. The PCR with genomic DNA from Z. mobilis (ATCC31821) was carried out following the manufacturer's instructions using Pwo-polymerase (Roche Applied Science) and the following temperature gradient program: 95 C. for 3 min; 30 cycles at 95 C. for 30 sec., 50 C. for 30 sec and 72 C. for 3 min; 72 C. for 10 min.; 4 C. until used. The PCR product (2.2 kb) was isolated by agarose gel electrophoresis (1.2% electrophoresis gel, Invitrogen) and column chromatography (GFX Kit, Amersham Pharmacia) and subsequently sequenced (sequencing primer: Zm-SHC_fw and Zm-SHC_rev). The sequence obtained matches the published sequence.

    [0268] The PCR product was digested with the restriction endonucleases NdeI and BamHI and ligated into suitably digested vector pDHE19.2 [9]. Sequencing the resulting plasmids gave the nucleic acid sequence shown in SEQ ID NO: 1. The corresponding amino acid sequence is shown in the following text/(SEQ ID NO:2):

    TABLE-US-00010 MetGlyIleAspArgMetAsnSerLeuSerArgLeuLeuMetLysLys 151015 IlePheGlyAlaGluLysThrSerTyrLysProAlaSerAspThrIle 202530 IleGlyThrAspThrLeuLysArgProAsnArgArgProGluProThr 354045 AlaLysValAspLysThrIlePheLysThrMetGlyAsnSerLeuAsn 505560 AsnThrLeuValSerAlaCysAspTrpLeuIleGlyGlnGlnLysPro 65707580 AspGlyHisTrpValGlyAlaValGluSerAsnAlaSerMetGluAla 859095 GluTrpCysLeuAlaLeuTrpPheLeuGlyLeuGluAspHisProLeu 100105110 ArgProArgLeuGlyAsnAlaLeuLeuGluMetGlnArgGluAspGly 115120125 SerTrpGlyValTyrPheGlyAlaGlyAsnGlyAspIleAsnAlaThr 130135140 ValGluAlaTyrAlaAlaLeuArgSerLeuGlyTyrSerAlaAspAsn 145150155160 ProValLeuLysLysAlaAlaAlaTrpIleAlaGluLysGlyGlyLeu 165170175 LysAsnIleArgValPheThrArgTyrTrpLeuAlaLeuIleGlyGlu 180185190 TrpProTrpGluLysThrProAsnLeuProProGluIleIleTrpPhe 195200205 ProAspAsnPheValPheSerIleTyrAsnPheAlaGlnTrpAlaArg 210215220 AlaThrMetValProIleAlaIleLeuSerAlaArgArgProSerArg 225230235240 ProLeuArgProGlnAspArgLeuAspGluLeuPheProGluGlyArg 245250255 AlaArgPheAspTyrGluLeuProLysLysGluGlyIleAspLeuTrp 260265270 SerGlnPhePheArgThrThrAspArgGlyLeuHisTrpValGlnSer 275280285 AsnLeuLeuLysArgAsnSerLeuArgGluAlaAlaIleArgHisVal 290295300 LeuGluTrpIleIleArgHisGlnAspAlaAspGlyGlyTrpGlyGly 305310315320 IleGlnProProTrpValTyrGlyLeuMetAlaLeuHisGlyGluGly 325330335 TyrGlnLeuTyrHisProValMetAlaLysAlaLeuSerAlaLeuAsp 340345350 AspProGlyTrpArgHisAspArgGlyGluSerSerTrpIleGlnAla 355360365 ThrAsnSerProValTrpAspThrMetLeuAlaLeuMetAlaLeuLys 370375380 AspAlaLysAlaGluAspArgPheThrProGluMetAspLysAlaAla 385390395400 AspTrpLeuLeuAlaArgGlnValLysValLysGlyAspTrpSerIle 405410415 LysLeuProAspValGluProGlyGlyTrpAlaPheGluTyrAlaAsn 420425430 AspArgTyrProAspThrAspAspThrAlaValAlaLeuIleAlaLeu 435440445 SerSerTyrArgAspLysGluGluTrpGlnLysLysGlyValGluAsp 450455460 AlaIleThrArgGlyValAsnTrpLeuIleAlaMetGlnSerGluCys 465470475480 GlyGlyTrpGlyAlaPheAspLysAspAsnAsnArgSerIleLeuSer 485490495 LysIleProPheCysAspPheGlyGluSerIleAspProProSerVal 500505510 AspValThrAlaHisValLeuGluAlaPheGlyThrLeuGlyLeuSer 515520525 ArgAspMetProValIleGlnLysAlaIleAspTyrValArgSerGlu 530535540 GlnGluAlaGluGlyAlaTrpPheGlyArgTrpGlyValAsnTyrIle 545550555560 TyrGlyThrGlyAlaValLeuProAlaLeuAlaAlaIleGlyGluAsp 565570575 MetThrGlnProTyrIleThrLysAlaCysAspTrpLeuValAlaHis 580585590 GlnGlnGluAspGlyGlyTrpGlyGluSerCysSerSerTyrMetGlu 595600605 IleAspSerIleGlyLysGlyProThrThrProSerGlnThrAlaTrp 610615620 AlaLeuMetGlyLeuIleAlaAlaAsnArgProGluAspTyrGluAla 625630635640 IleAlaLysGlyCysHisTyrLeuIleAspArgGlnGluGlnAspGly 645650655 SerTrpLysGluGluGluPheThrGlyThrGlyPheProGlyTyrGly 660665670 ValGlyGlnThrIleLysLeuAspAspProAlaLeuSerLysArgLeu 675680685 LeuGlnGlyAlaGluLeuSerArgAlaPheMetLeuArgTyrAspPhe 690695700 TyrArgGlnPhePheProIleMetAlaLeuSerArgAlaGluArgLeu 705710715720 IleAspLeuAsnAsn 725

    [0269] The plasmid pDHE-Zm-SHC-1 was transformed into the strain E. coli TG10 pAgro4 pHSG575 [Takeshita et al., Gene 1987, 61:63-74; Tomoyasu et al., Mol Microbiol 2001, 40:397-413]. The recombinant E. coli were named E. coli LU15568.

    Reference Example 2: Provision of Recombinant Homofarnesol Cyclase from Z. mobilis

    [0270] Inoculated from a suitable 2 ml preculture, E. coli LU15568 was grown for 16 h at 37 C. in 20 ml LB-Amp/Spec/Cm (100 g/l ampicillin; 100 g/l spectinomycin; 20 g/l chloramphenicol), 0.1 mM IPTG, 0.5 g/l rhamnose in 100 ml Erlenmeyer flasks (with baffles), centrifuged at 5000*g/10 min and stored at 4 C. Protein extract was prepared by suspending the cell pellet in 15 ml disruption buffer (0.2 M Tris/HCl, 0.5 M EDTA, pH 8.0), 375 U benzonase (for example Novagen, 25 U/L), 40 L PMSF (100 mM, dissolved in i-PropOH), 0.8 g sucrose and approx. 0.5 mg of lysozyme. The reaction mixture was mixed and incubated on ice for 30 min. Thereafter, the mixture was frozen at 20 C.

    [0271] After the reaction mixture had defrosted, it was made up to approx. 40 ml with distilled water and again incubated on ice for 30 min.

    [0272] Thereafter, the cells were disrupted 3 times for 3 min using ultrasound (HTU-Soni 130, by G. Heinemann, Schwbisch-Hall, amplitude 80%, 15 pulse/15 pause). After the disruption, the cell debris was removed by centrifugation for 60 min at 4 C. and 26 900*g. The supernatant was discarded and the pellet was resuspended in 100 ml solubilization buffer (50 mM Tris/HCl, 10 mM MgCl26H2O, 1% Triton X-100, pH 8.0) and comminuted in a Potter for approx. 5 min. Thereafter, the suspension was maintained on ice for 30 min.

    [0273] The homogenized extract was recentrifuged for 1 h at 4 C. and 26 900*g, and the pellet was discarded. The extract was employed for the enzyme assays and may be stored over several weeks at 20 C. without suffering activity losses. The protein content was in the range of 1 mg/ml.

    Reference Example 3: Activity Determination of the Recombinant Cyclase from E. coli LU15568

    [0274] Homofarnesylic acid ((3E,7E)-4,8,12-trimethyltrideca-3,7,11-trienoic acid) was incubated with the protein preparation described in Reference Example 2. Specifically, 0.0412 g of homofarnesylic acid were weighed (20 mM in the reaction mixture; purity 85.1% composed of Z,Z 0.44%, E,Z 10.13%, E,E 74.93%), 2.913 ml of water; 0.350 ml of sodium citrate buffer (1 M sodium citrate pH 5.4), 0.560 ml MgCl2 (0.5M solution) were pipetted in, and the mixture was warmed for 30 min at 37 C., with stirring. The reaction started with the addition of E. coli LU15568 homogenate (protein content 35 mg/ml), warmed to 37 C. The reaction mixture was stirred on a magnetic stirrer in an oil bath for 24 h at pH 5.0 at 37 C. at maximum stirring speed. The pH was adjusted during the reaction using 0.5M HCl. After incubation for 24 hours, 0.500 ml from the reaction mixture were extracted by vortexing for 30 seconds with 1000 ml of n-heptane/n-propanol 3:2. The organic supernatant after the phase separation was employed in the GC analysis (cf. FIG. 1).

    [0275] Using the analyses described herein below in greater detail, a conversion rate of 74.5% in total of 82.7% from the E,E isomer was determined.

    Example 1: Preparation of (3E,7E)-Homofarnesylic Acid Butyl Ester

    [0276] 71 g (283 mmol) of a mixture of (3E,7E)-homofarnesylic acid and (3Z,7E)-homofarnesylic acid in a molar ratio of 56:44 were dissolved in 360 ml of n-heptane. 21 g (283 mmol) of n-butanol and 470 mg Novozym 435 were added. The mixture was stirred for 48 h at 23 C. The enzyme was separated by filtration. At a temperature of 0 C., 115 ml of methanol and 5 ml of water were added. The pH of the mixture was adjusted to pH=12 by adding aqueous sodium hydroxide (25%) at a temperature of <10 C. and under agitation.

    [0277] The stirrer was stopped and the lower phase was separated off. After removal of the solvent, 43.5 g (119 mmol) of the homofarnesylic acid butyl ester having a (3E,7E)-content of >97% were obtained.

    Example 2: Influence of Different Alcohols on Selectivity of Enzymatic Esterification of Homofarnesylic Acid in the Absence of a Solvent

    [0278] 2 g (8 mmol) of a 57:43 mixture of (3E,7E)-homofarnesylic acid and (3Z,7E)-homofarnesylic acid were dissolved in 15 ml of different alcohols and were stirred at 23 C. in the presence of 20 mg Novozym 435. At particular time intervals the composition of the reaction mixture was analyzed by HPLC. The results are summarized in the subsequent Table 1.

    TABLE-US-00011 TABLE 1 HFS Alcohol Novozynne 3Z, 7E 3E, 7E 3Z, 7E 3E, 7E Mixture ROH Solvent 435 Time Acid Acid Ester Ester [mmol] [g] Type mL Type mL mg [h] Fl% Fl% Fl% Fl% 8 2 EtOH 15 none 20 0 43 57 5 43 49 <1 9 8 42 44 <1 13 24 42 27 <1 30 32 42 21 1 36 8 2 iPrOH 15 none 20 0 43 57 5 43 52 <1 5 8 43 49 <1 9 24 43 35 <1 22 32 42 29 <1 29 8 2 BuOH 15 none 20 0 43 57 5 43 52 <1 5 8 43 49 <1 9 24 43 34 <1 23 32 42 28 1 29 8 2 tBuOH 15 none 20 0 43 57 5 43 57 8 43 57 24 43 57 32 43 57

    Example 3: The Influence of a Combination of Different Alcohols and the Solvent Heptane on the Selectivity of Enzymatic Esterification of Homofarnesylic Acid

    [0279] 2 g (8 mmol) of a 57:43 mixture of (3E,7E)-homofarnesylic acid and (3Z,7E)-homofarnesylic acid were dissolved in 15 ml of heptane. 8 mmol of different alcohols and 20 mg Novozym 435 were added and the mixture was stirred at 23 C. At predetermined time intervals the composition of the reaction mixture was analyzed via HPLC. The results are shown in Table 2.

    TABLE-US-00012 TABLE 2 HFS Alcohol Novozyme 3Z, 7E 3E, 7E 3Z, 7E 3E, 7E Mixture ROH Solvent 435 Time Acid Acid Ester Ester [mmole] [g] Type mg Type mL mg [h] Fl% Fl% Fl% Fl% 8 2 MeOH 256 Heptane 15 20 0 43 57 7.5 41 22 1 35 24 37 2 6 55 32 33 2 10 55 8 2 EtOH 370 Heptane 15 20 0 43 57 7.5 42 23 1 35 24 40 4 3 53 32 38 3 5 54 8 2 iPrOH 480 Heptane 15 20 0 43 57 7.5 43 44 <1 13 24 43 27 <1 30 32 43 20 <1 38 8 2 BuOH 600 Heptane 15 20 0 43 57 7.5 42 30 1 27 24 41 4 1 53 32 40 3 2 55 8 2 1- 1050 Heptane 15 20 0 43 57 Octanol 7.5 43 22 1 35 24 41 2 3 52 32 41 1 5 54

    Example 4: The Influence of a Combination of Butanol and Different Solvents on the Selectivity, of Enzymatic Esterification of Homofarnesylic Acid

    [0280] 2 g (8 mmol) of a 57:43 mixture of (3E,7E)-homofarnesylic acid and (3Z,7E)-homofarnesylic acid were dissolved in 15 ml of different solvents. 8 mmol butanol and 20 mg Novozym 435 were added and the mixture was stirred at 23 C. At predetermined time intervals the composition of the reaction mixture was analyzed via HPLC. The results are shown in Table 3.

    TABLE-US-00013 TABLE 3 HFS Alcohol Novozyme 3Z,7E 3E,7E 3Z,7E 3E,7E Mixture ROH Solvent 435 Time Acid Acid Ester Ester [mmole] [g] Type mg Type mL mg [h] Fl% Fl% Fl% Fl% 8 2 BuOH 600 Toluene 15 20 0 43 57 7 42 36 <1 22 24 42 9 1 48 31 41 5 2 52 8 2 BuOH 600 THF 15 20 0 43 57 7 43 57 0 0 24 43 57 0 0 31 43 55 0 2 8 2 BuOH 600 MTBE 15 20 0 43 57 7 42 42 <1 16 24 42 16 1 42 31 41 12 1 45 8 2 BuOH 600 CH2Cl2 15 20 0 43 57 7 43 56 0 1 24 43 53 0 4 31 43 52 0 5

    Example 5: Preparation of Free (3E,7E)-Homofarnesylic Acid Via Enzymatic Ester Cleavage

    [0281] 2 g (7.56 mmol) of (3E,7E)- and (3Z,7E)-homofarnesylic acid methyl ester (ratio of (3E,7E):(3Z,7E)=51:49) were dissolved in 50 ml of toluene. 10 ml of water and 50 mg of Novozym 435 were added. The mixture was stirred at 23 C. After 6 hours the composition of the reaction mixture was analyzed to be as follows:

    [0282] 36% (3E,7E)-homofarnesylic acid methyl ester,

    [0283] 49% (3Z,7E)-homofarnesylic acid methyl ester,

    [0284] 15% (3E,7E)-homofarnesylic acid and

    [0285] <0.1% (3Z,7E)-homofarnesylic acid.

    [0286] The enzyme was removed by filtration and the reaction mixture is adjusted to pH>9 by means of sodium carbonate. The aqueous lower phase was separated. The pH of the aqueous phase was adjusted to a value of <4 by means of an acid (10% hydrochloric acid). Afterwards the phase is extracted with toluene. The obtained toluene phase contains more than 95% of pure (3E,7E)-homofarnesylic acid.

    Sequences:

    [0287] SEQ ID NO: 1-326 Nucleic acid/amino acid sequences of various SHC genes
    SEQ ID NO: 327-328 PCR primer
    SEQ ID NO: 329, 330 Nucleic acid/amino acid sequences of lipase CALB

    [0288] It is explicitly referred to the references as cited herein.