SRPX for treatment of cancer
10624951 ยท 2020-04-21
Assignee
Inventors
- Michael R. Green (Boylston, MA)
- Guangping Gao (Westborough, MA)
- Manas Kumar Santra (Pune, IN)
- Sanchita Bhatnagar (Shrewsbury, MA, US)
Cpc classification
C12N9/0065
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
A61K35/12
HUMAN NECESSITIES
International classification
A61K38/16
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
A61K35/12
HUMAN NECESSITIES
Abstract
Methods of treating a tumor in a subject include identifying a subject having, at risk for, or suspected of having a tumor, and administering to the subject an effective amount of an SRPX.
Claims
1. A method of treating a solid tumor in a mammalian subject, the method comprising: identifying a subject having a solid tumor; and systemically administering to the subject an effective amount of a therapeutic composition comprising an SRPX polypeptide that is at least 80% identical to SEQ ID NO:1, thereby treating the tumor.
2. The method of claim 1, wherein the tumor is a cancer.
3. The method of claim 2, wherein the cancer is a carcinoma.
4. The method of claim 2, wherein the cancer is a lung adenocarcinoma.
5. The method of claim 2, wherein the cancer is a breast cancer, bladder cancer, ovarian cancer, pancreatic cancer, colon cancer, colorectal carcinoma, or papillary thyroid carcinoma.
6. The method of claim 2, wherein the SRPX agent comprises a polypeptide at least 90% identical to SEQ ID NO:1.
7. The method of claim 1, wherein the polypeptide is at least 95% identical to SEQ ID NO:1.
Description
DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DETAILED DESCRIPTION
(15) This disclosure includes methods of treating tumors (e.g., cancers), inducing cellular apoptosis, inducing cellular senescence, and inhibiting cellular proliferation with SRPX agents.
(16) SRPX Agents
(17) SRPX agents that can be used with the methods described herein are agents that include an SRPX polypeptide sequence and, alternatively, one or more polypeptide or non-polypeptide moieties, such that the agent has at least 25% (e.g., at least: 30%; 40%; 50%; 60%; 70%; 75%; 80%; 85%; 90%; 95%; 97%; 98%; 99%; 99.5%, or 100% or even greater) of the ability of rSRPX (see Example 1) to inhibit the proliferation of one or more of NCI-H23, EKVX, HOP-62, HOP-92, HCT-15, SW-620, COLO205, HT29, HCT-116, KM-12, CCRF-CEM, K-562, MOLT-4, SR, RPMI-8226, A549-ATCC, NCI-H226, NCI-H322M in vitro. Exemplary agents include fragments and analogs of SRPX (see below). The SRPX polypeptide sequence can include a mature, soluble SRPX polypeptide (e.g., SEQ ID NO:1 or residues 29, 30, 31, 32, 33, 34 or 35 to 464 of SEQ ID NO:2), one or more domains of SRPX, or fragments or variants thereof. Exemplary fragments of SRPX include residues 59 to 115, 59 to 175, 59 to 254, 59 to 317, 120 to 175, 120 to 254, 120 to 317, 175 to 254, 175 to 317, and 262 to 317 of SEQ ID NO:2. An exemplary mature, soluble SRPX polypeptide is provided as:
(18) TABLE-US-00001 (SEQIDNO:1) DSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTR CDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKC VDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRI KCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFP EGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTA AALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVE LVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKE RYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
(19) In certain embodiments, SRPX polypeptides include sequences substantially identical to all or a portion of a naturally occurring SRPX polypeptide. Polypeptides substantially identical to the SRPX polypeptide sequence described herein can contain an amino acid sequence that is at least 65% (e.g., at least 75%, 80%, 85%, 90%, 95%, 98%, or 99%, e.g., 100%), identical to the amino acid sequences of the SRPX polypeptide represented by SEQ ID NO:1, an amino acid sequence of GenBank Accession No. NP_006298.1 (SEQ ID NO:2), NP_001164221.1 (residues 1 to 32 and 53 to 464 of SEQ ID NO:2), NP_001164222.1 (SEQ ID NO:7), or NP_001164223.1 (SEQ ID NO:8), or a fragment as disclosed herein (e.g., residues 29, 30, 31, 32, 33, 34, 35, or 36 to 464 of SEQ ID NO:2 or residues 59 to 115, 59 to 175, 59 to 254, 59 to 317, 120 to 175, 120 to 254, 120 to 317, 175 to 254, 175 to 317, and 262 to 317 of SEQ ID NO:2).
(20) TABLE-US-00002 ThehumanNP_006298.1sequenceisshownbelow. (SEQIDNO:2) MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHP RYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGS SLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYC SPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNK LTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRA ENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGY ELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLL IVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGA KIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNL IDTFPLRKEEMVLQAEMSQTCNT ThehumanNP_001164222.1sequenceisshownbelow. (SEQIDNO:7) MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHP RYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGS SLLICQSNKRWSDKVICKHMEPPRIKCPSVKERIAEPNKLTVRVSWETP EGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRV KVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVC QSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNL LYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQ LRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEE MVLQAEMSQTCNT ThehumanNP_001164223.1sequenceisshownbelow. (SEQIDNO:8) MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHP RYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGS SLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYC SPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNK LTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRA ENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGY ELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLL IVSTPTARNLLYRLQLGMLQAVAANPTLLLQYGASG
(21) Any of the above polypeptides can be provided in mature form without the signal sequence (e.g., residues 1 to 29, 30, 31, 32, 33, 34, or 35 of SEQ ID NO: 2, 7, or 8).
(22) Furthermore, a SRPX polypeptide (e.g., SEQ ID NO:1, an amino acid sequence of GenBank Accession No. NP_006298.1 (SEQ ID NO:2), NP_001164221.1, NP_001164222.1, or NP_006298.1, or a fragment as disclosed herein (e.g., residues 29, 30, 31, 32, 33, 34 or 35 to 464 of SEQ ID NO:2 or residues 59 to 115, 59 to 175, 59 to 254, 59 to 317, 120 to 175, 120 to 254, 120 to 317, 175 to 254, 175 to 317, and 262 to 317 of SEQ ID NO:2)) with up to 50, e.g., 1, 3, 5, 10, 15, 20, 25, 30, or 40, amino acid insertions, deletions, or substitutions (e.g., conservative amino acid substitutions) will be useful in the compositions and methods described herein. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
(23) The percent identity between two amino acid sequences can be determined using the BLAST 2.0 program, which is available to the public at ncbi.nlm.nih.gov/BLAST. Sequence comparison is performed using the default parameters (BLOSUM 62 matrix, gap existence cost of 11, per residue gap cost of 1, and a lambda ratio of 0.85). The mathematical algorithm used in BLAST programs is described in Altschul et al., 1997, Nucleic Acids Research, 25:3389-3402.
(24) SRPX polypeptides useful in the methods described herein can be, but are not limited to, recombinant polypeptides and naturally occurring polypeptides. A SRPX polypeptide can be obtained from any human or mammalian species, and include alternatively spliced forms and other isoforms that have the disclosed activities. Non-human SRPX polypeptides with similarity to human SRPX polypeptides have been identified in chimpanzees (e.g., GenBank Accession No. XP_521003.3), rhesus monkeys (e.g., GenBank Accession Nos. XP_001083979.1, XP_001084091.1), common marmosets (e.g., GenBank Accession Nos. XP_002762821.1, XP_002762820.1), Sumatran orangutans (GenBank Accession Nos. XP_002831567.1, XP_002831566.1), white-cheeked gibbons (GenBank Accession No. XP_003271118.1), cattle (e.g., GenBank Accession Nos. DAA12706.1, NP_001035579.1), horses (e.g., GenBank Accession No. XP_001489693.3), dogs (e.g., GenBank Accession No. XP_548948.3), mice (e.g., GenBank Accession Nos. CAM18748.1, NP_058607.1), and rats (e.g., GenBank Accession Nos. AAH87639.1, NP_071969.1).
(25) Also useful in the new methods are fusion proteins in which a portion of a SRPX polypeptide is fused to an unrelated polypeptide (e.g., a marker polypeptide or purification tag) to create a fusion protein. For example, the polypeptide can be fused to a peptide tag to facilitate purification (e.g., a hexa-histidine tag or a FLAG tag to facilitate purification of bacterially expressed polypeptides or to a hemagglutinin tag or a FLAG tag to facilitate purification of polypeptides expressed in eukaryotic cells). Also useful are, for example, polypeptides that include a first portion and a second portion; the first portion includes, e.g., a SRPX polypeptide, and the second portion includes, e.g., a detectable marker or a serum protein, e.g., an immunoglobulin constant region, or human serum albumin.
(26) SRPX contains three complement control protein (CCP) modules (aka short consensus repeats (SCRs) or SUSHI repeats; Norman et al., J. Mol. Biol., 219:717-725; Kirkitadze et al., 2001, Immunol. Rev., 180:146-161) at residues 59 to 115, 120 to 175, and 262 to 317 of SEQ ID NO:2. Additionally, the protein contains a hyaline repeat (HYR) domain at residues 175 to 254 of SEQ ID NO:2. Exemplary fragments of SRPX can include one or more of residues 59 to 115, 59 to 175, 59 to 254, 59 to 317, 120 to 175, 120 to 254, 120 to 317, 175 to 254, 175 to 317, or 262 to 317 of SEQ ID NO:2. Conserved residues and domains can be used when producing fragments, analogs, and variants of SRPX polypeptides.
(27) A SRPX agent can have one or more chemical modifications (e.g., posttranslational modifications) at one or more sites on the polypeptide, e.g., at the amino or carboxy terminus. Methods of chemical modification are well-known to those of skill in the art, and can be used to alter one or more properties, e.g., activity, stability, retention, or pharmacokinetics of the SRPX agent. Exemplary modifications include glycosylation and PEGylation. SRPX contains a putative O-glycosylation site at residue 383 of SEQ ID NO:2. Pegylation of proteins is described in US 2006/0100144. Similar modifications and methods can be used with SRPX agents.
(28) A SRPX agent can also be a peptidomimetic version of a SRPX polypeptide (e.g., SEQ ID NO:1), functional fragment, or variant thereof. These polypeptides can be modified according to the methods known in the art for producing peptidomimetics. See, e.g., Kazmierski, W. M., ed., Peptidomimetics Protocols, Human Press (Totowa N.J. 1998); Goodman et al., eds., Houben-Weyl Methods of Organic Chemistry: Synthesis of Peptides and Peptidomimetics, Thiele Verlag (New York 2003); and Mayo et al., J. Biol. Chem., 278:45746 (2003). In some cases, these modified peptidomimetic versions of the peptides and fragments disclosed herein exhibit enhanced stability in vivo, relative to the non-peptidomimetic peptides.
(29) Methods for creating a peptidomimetic include substituting one or more, e.g., all, of the amino acids in a peptide sequence with D-amino acid enantiomers. Such sequences are referred to herein as retro sequences. In another method, the N-terminal to C-terminal order of the amino acid residues is reversed, such that the order of amino acid residues from the N-terminus to the C-terminus of the original peptide becomes the order of amino acid residues from the C-terminus to the N-terminus in the modified peptidomimetic. Such sequences can be referred to as inverso sequences.
(30) Peptidomimetics can be both the retro and inverso versions, i.e., the retro-inverso version of a peptide disclosed herein. The new peptidomimetics can be composed of D-amino acids arranged so that the order of amino acid residues from the N-terminus to the C-terminus in the peptidomimetic corresponds to the order of amino acid residues from the C-terminus to the N-terminus in the original peptide.
(31) Other methods for making a peptidomimetics include replacing one or more amino acid residues in a peptide with a chemically distinct but recognized functional analog of the amino acid, i.e., an artificial amino acid analog. Artificial amino acid analogs include -amino acids, -substituted -amino acids (.sup.3-amino acids), phosphorous analogs of amino acids, such as amino phosphonic acids and amino phosphinic acids, and amino acids having non-peptide linkages. Artificial amino acids can be used to create peptidomimetics, such as peptoid oligomers (e.g., peptoid amide or ester analogues), -peptides, cyclic peptides, oligourea or oligocarbamate peptides; or heterocyclic ring molecules.
(32) Also useful in the methods disclosed herein are nucleic acid molecules that encode SRPX agents described herein, e.g., naturally occurring SRPX polypeptides or forms of SRPX polypeptides in which naturally occurring amino acid sequences are altered or deleted (e.g., fragments or analogs of SRPX). Certain nucleic acids can encode polypeptides that are soluble under normal physiological conditions. SRPX agents can be expressed (e.g., exogenously expressed) within a cell by any means known in the art. To generate cells that express SRPX agents, the cells can be transfected, transformed, or transduced using any of a variety of techniques known in the art. Any number of transfection, transformation, and transduction protocols known to those in the art may be used, for example those outlined in Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y., or in numerous kits available commercially (e.g., Invitrogen Life Technologies, Carlsbad, Calif.). Such techniques may result in stable or transient transformants. One suitable transfection technique is electroporation, which can be performed on a variety of cell types, including mammalian cells, yeast cells and bacteria, using commercially available equipment. Optimal conditions for electroporation (including voltage, resistance and pulse length) are experimentally determined for the particular host cell type, and general guidelines for optimizing electroporation can be obtained from manufacturers.
(33) When the polypeptide expressed by a nucleic acid is intended to be secreted, the nucleic acid sequence can encode an N-terminal signal sequence that directs secretion of the polypeptide. In some embodiments, the signal sequence is a heterologous signal sequence. Signal sequences that function in prokaryotes and eukaryotes are well known, and one of ordinary skill can select or design an appropriate signal sequence accordingly. In some embodiments, the nucleic acid can encode a SRPX polypeptide, variant, or fragment as disclosed herein with a SRPX or heterologous signal sequence.
(34) Exemplary methods of administering SRPX agents include introducing into a subject a nucleic acid that encodes an SRPX agent described herein. In some embodiments, the nucleic acid that encodes the SRPX agent is contained within a vector, e.g., as a virus that includes a nucleic acid that expresses the SRPX agent. Exemplary viral vectors include adenoviruses (reviewed in Altaras et al., 2005, Adv. Biochem. Eng. Biotechnol., 99:193-260), adeno-associated viruses (reviewed in Park et al., 2008, Front. Biosci., 13:2653-59; see also Williams, 2007, Mol. Ther., 15:2053-54), parvoviruses, lentiviruses, retroviruses (reviewed in Tai et al., 2008, Front. Biosci., 13:3083-95), and the herpes simplex virus. Methods of delivery of nucleic acids are reviewed in Patil et al., 2005, AAPS J., 7:E61-77, which is incorporated herein by reference in its entirety.
(35) TABLE-US-00003 AnexemplaryAAVvectorcontainingapolypeptide thatincludesSEQIDNO:1isshowninFIG.4Band hasthesequence: (SEQIDNO:3) attaggctgcgcgctcgctcgctcactgaggccgcccgggcaaagcccgg gcgtcgggcgacctttggtcgcccggcctcagtgagcgagcgagcgcgca gagagggagtggccaactccatcactaggggttccttgtagttaatgatt aacccgccatgctacttatctaccagggtaatggggatcctctagaacta tagctagcatgcctgcaggctgaccgcccaacgacccccgcccattgacg tcaataatgacgtatgttcccatagtaacgccaatagggactttccattg acgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatc aagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaa tggcccgcctggcattatgcccagtacatgaccttacgggactttcctac ttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggt tttggcagtacaccaatgggcgtggatagcggtttgactcacggggattt ccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaa tcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaa tgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgttta gtgaaccgtcagatcactagaagctttattgcggtagtttatcacagtta aattgctaacgcagtcagtgcttctgacacaacagtctcgaacttaagct gcagaagttggtcgtgaggcactgggcaggtaagtatcaaggttacaaga caggtttaaggagaccaatagaaactgggcttgtcgagacagagaagact cttgcgtttctgataggcacctattggtcttactgacatccactttgcct ttctctccacaggtgtccactcccagttcaattacagctcttaaggctag agtacttaatacgactcactataggctagcctcgagaattcacgcgtggt acggtaccatgatggagacagacacactcctgctatgggtactgctgctc tgggttccaggttccactggtgacgcggcccagccggccaggcgcgcgcg ccgtacgaagcttgactcaccactagaagacgatgaagtcgggtattcac accctagatataaagataccccgtggtgctcccccatcaaggtgaagtat ggggatgtgtactgcagggcccctcaaggaggatactacaaaacagccct gggaaccaggtgcgacattcgctgccagaagggctacgagctgcatggct cttccctactgatctgccagtcaaacaaacgatggtctgacaaggtcatc tgcaaacaaaagcgatgtcctacccttgccatgccagcaaatggagggtt taagtgtgtagatggtgcctactttaactcccggtgtgagtattattgtt caccaggatacacgttgaaaggggagcggaccgtcacatgtatggacaac aaggcctggagcggccggccagcctcctgtgtggatatggaacctcctag aatcaagtgcccaagtgtgaaggaacgcattgcagaacccaacaaactga cagtccgggtgtcctgggagacacccgaaggaagagacacagcagatgga attcttactgatgtcattctaaaaggcctccccccaggctccaactttcc agaaggagaccacaagatccagtacacagtctatgacagagctgagaata agggcacttgcaaatttcgagttaaagtaagagtcaaacgctgtggcaaa ctcaatgccccagagaatggttacatgaagtgctccagcgacggtgataa ttatggagccacctgtgagttctcctgcatcggcggctatgagctccagg gtagccctgcccgagtatgtcaatccaacctggcttggtctggcacggag cccacctgtgcagccatgaacgtcaatgtgggtgtcagaacggcagctgc acttctggatcagttttatgagaaaaggagactcctcattgtgtccacac ccacagcccgaaacctcctttaccggctccagctaggaatgctgcagcaa gcacagtgtggccttgatcttcgacacatcaccgtggtggagctggtggg tgtgttcccgactctcattggcaggataggagcaaagattatgcctccag ccctagcgctgcagctcaggctgttgctgcgaatcccactctactccttc agtatggtgctagtggataagcatggcatggacaaagagcgctatgtctc cctggtgatgcctgtggccctgttcaacctgattgacacttttcccttga gaaaagaagagatggtcctacaagccgaaatgagccagacctgtaacacc gctcgaggagggcccgaacaaaaactcatctcagaagagaatctgaatag cgccgtcgaccatcatcatcatcatcattgaggtaccctctagagtcgac ccgggcggcctcgaggacggggtgaactacgcctgaggatccgatctttt tccctctgccaaaaattatggggacatcatgaagccccttgagcatctga cttctggctaataaaggaaatttattttcattgcaatagtgtgttggaat tttttgtgtctctcactcggaagcaattcgttgatctgaatttcgaccac ccataatacccattaccctggtagataagtagcatggcgggttaatcatt aactacaaggaacccctagtgatggagttggccactccctctctgcgcgc tcgctcgctcactgaggccgggcgaccaaaggtcgcccgacgcccgggct ttgcccgggcggcctcagtgagcgagcgagcgcgcagccttaattaatta attaaggcctta AnexemplaryAAVvectorcontainingapolypeptide thatincludesSEQIDNO:2isshowninFIG.5Band hasthesequence: (SEQIDNO:4) attaggctgcgcgctcgctcgctcactgaggccgcccgggcaaagcccgg gcgtcgggcgacctttggtcgcccggcctcagtgagcgagcgagcgcgca gagagggagtggccaactccatcactaggggttccttgtagttaatgatt aacccgccatgctacttatctaccagggtaatggggatcctctagaacta tagctagcatgcctgcaggctgaccgcccaacgacccccgcccattgacg tcaataatgacgtatgttcccatagtaacgccaatagggactttccattg acgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatc aagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaa tggcccgcctggcattatgcccagtacatgaccttacgggactttcctac ttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggt tttggcagtacaccaatgggcgtggatagcggtttgactcacggggattt ccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaa tcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaa tgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgttta gtgaaccgtcagatcactagaagctttattgcggtagtttatcacagtta aattgctaacgcagtcagtgcttctgacacaacagtctcgaacttaagct gcagaagttggtcgtgaggcactgggcaggtaagtatcaaggttacaaga caggtttaaggagaccaatagaaactgggcttgtcgagacagagaagact cttgcgtttctgataggcacctattggtcttactgacatccactttgcct ttctctccacaggtgtccactcccagttcaattacagctcttaaggctag agtacttaatacgactcactataggctagcctcgagaattcacgcgtggt acggtaccatggggagccccgcacatcggcccgcgctgctgctgctgctg ccgcctctgctgctgctgctgctgctgcgcgtcccgcccagccgcagctt cccaggatcgggagactcaccactagaagacgatgaagtcgggtattcac accctagatataaagataccccgtggtgctcccccatcaaggtgaagtat ggggatgtgtactgcagggcccctcaaggaggatactacaaaacagccct gggaaccaggtgcgacattcgctgccagaagggctacgagctgcatggct cttccctactgatctgccagtcaaacaaacgatggtctgacaaggtcatc tgcaaacaaaagcgatgtcctacccttgccatgccagcaaatggagggtt taagtgtgtagatggtgcctactttaactcccggtgtgagtattattgtt caccaggatacacgttgaaaggggagcggaccgtcacatgtatggacaac aaggcctggagcggccggccagcctcctgtgtggatatggaacctcctag aatcaagtgcccaagtgtgaaggaacgcattgcagaacccaacaaactga cagtccgggtgtcctgggagacacccgaaggaagagacacagcagatgga attcttactgatgtcattctaaaaggcctccccccaggctccaactttcc agaaggagaccacaagatccagtacacagtctatgacagagctgagaata agggcacttgcaaatttcgagttaaagtaagagtcaaacgctgtggcaaa ctcaatgccccagagaatggttacatgaagtgctccagcgacggtgataa ttatggagccacctgtgagttctcctgcatcggcggctatgagctccagg gtagccctgcccgagtatgtcaatccaacctggcttggtctggcacggag cccacctgtgcagccatgaacgtcaatgtgggtgtcagaacggcagctgc acttctggatcagttttatgagaaaaggagactcctcattgtgtccacac ccacagcccgaaacctcctttaccggctccagctaggaatgctgcagcaa gcacagtgtggccttgatcttcgacacatcaccgtggtggagctggtggg tgtgttcccgactctcattggcaggataggagcaaagattatgcctccag ccctagcgctgcagctcaggctgttgctgcgaatcccactctactccttc agtatggtgctagtggataagcatggcatggacaaagagcgctatgtctc cctggtgatgcctgtggccctgttcaacctgattgacacttttcccttga gaaaagaagagatggtcctacaagccgaaatgagccagacctgtaacacc gaacaaaaactcatctcagaagaggatctgaatagcgccgtcgaccatca tcatcatcatcattgaggtaccctctagagtcgacccgggcggcctcgag gacggggtgaactacgcctgaggatccgatctttttccctctgccaaaaa ttatggggacatcatgaagccccttgagcatctgacttctggctaataaa ggaaatttattttcattgcaatagtgtgttggaattttttgtgtctctca ctcggaagcaattcgttgatctgaatttcgaccacccataatacccatta ccctggtagataagtagcatggcgggttaatcattaactacaaggaaccc ctagtgatggagttggccactccctctctgcgcgctcgctcgctcactga ggccgggcgaccaaaggtcgcccgacgcccgggctttgcccgggcggcct cagtgagcgagcgagcgcgcagccttaattaattaattaaggcctta
(36) In some embodiments, a nucleic acid that expresses a SRPX polypeptide is administered directly to cancer cells or to cells in the vicinity of the cancer cells. In some embodiments, a nucleic acid that expresses a SRPX polypeptide is administered to a cell ex vivo, which is then administered to the subject in the vicinity of the tumor.
(37) A SRPX agent can be produced by any means known in the art, e.g., by chemical synthesis, recombinant methods, or isolation from cells that naturally produce SRPX. Methods of purification and isolation of molecules that include polypeptides are also well known to those of skill in the art.
(38) Production of Fragments and Analogs of SRPX
(39) Generation of Fragments
(40) Fragments of a protein can be produced in several ways, e.g., recombinantly, by proteolytic digestion, or by chemical synthesis. Internal or terminal fragments of a polypeptide can be generated by removing one or more nucleotides from one end (for a terminal fragment) or both ends (for an internal fragment) of a nucleic acid that encodes the polypeptide. Expression of the mutagenized DNA produces polypeptide fragments. Digestion with end-nibbling endonucleases can thus generate DNAs that encode an array of fragments. DNAs that encode fragments of a protein can also be generated by random shearing, restriction digestion or a combination of the above-discussed methods.
(41) Fragments can also be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. For example, peptides of the present invention can be arbitrarily divided into fragments of desired length with no overlap of the fragments, or divided into overlapping fragments of a desired length.
(42) Generation of Analogs: Production of Altered DNA and Peptide Sequences by Random Methods
(43) Amino acid sequence variants of a protein can be prepared by random mutagenesis of DNA which encodes a protein or a particular domain or region of a protein. Useful methods include PCR mutagenesis and saturation mutagenesis. A library of random amino acid sequence variants can also be generated by the synthesis of a set of degenerate oligonucleotide sequences. (Methods for screening proteins in a library of variants are elsewhere herein.)
(44) PCR Mutagenesis
(45) In PCR mutagenesis, reduced Taq polymerase fidelity is used to introduce random mutations into a cloned fragment of DNA (Leung et al., 1989, Technique 1:11-15). This is a very powerful and relatively rapid method of introducing random mutations. The DNA region to be mutagenized is amplified using the polymerase chain reaction (PCR) under conditions that reduce the fidelity of DNA synthesis by Taq DNA polymerase, e.g., by using a dGTP/dATP ratio of five and adding Mn.sup.2+ to the PCR reaction. The pool of amplified DNA fragments is inserted into appropriate cloning vectors to provide random mutant libraries.
(46) Saturation Mutagenesis
(47) Saturation mutagenesis allows for the rapid introduction of a large number of single base substitutions into cloned DNA fragments (Mayers et al., 1985, Science 229:242). This technique includes generation of mutations, e.g., by chemical treatment or irradiation of single-stranded DNA in vitro, and synthesis of a complimentary DNA strand. The mutation frequency can be modulated by modulating the severity of the treatment, and essentially all possible base substitutions can be obtained. Because this procedure does not involve a genetic selection for mutant fragments both neutral substitutions, as well as those that alter function, are obtained. The distribution of point mutations is not biased toward conserved sequence elements.
(48) Degenerate Oligonucleotides
(49) A library of homologs can also be generated from a set of degenerate oligonucleotide sequences. Chemical synthesis of a degenerate sequences can be carried out in an automatic DNA synthesizer, and the synthetic genes then ligated into an appropriate expression vector. The synthesis of degenerate oligonucleotides is known in the art (see for example, Narang, S A (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA, Proc 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp 273-289; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983) Nucleic Acid Res. 11:477. Such techniques have been employed in the directed evolution of other proteins (see, for example, Scott et al. (1990) Science 249:386-390; Roberts et al. (1992) PNAS 89:2429-2433; Devlin et al. (1990) Science 249: 404-406; Cwirla et al. (1990) PNAS 87: 6378-6382; as well as U.S. Pat. Nos. 5,223,409, 5,198,346, and 5,096,815).
(50) Generation of Analogs: Production of Altered DNA and Peptide Sequences by Directed Mutagenesis
(51) Non-random or directed, mutagenesis techniques can be used to provide specific sequences or mutations in specific regions. These techniques can be used to create variants that include, e.g., deletions, insertions, or substitutions, of residues of the known amino acid sequence of a protein. The sites for mutation can be modified individually or in series, e.g., by (1) substituting first with conserved amino acids and then with more radical choices depending upon results achieved, (2) deleting the target residue, or (3) inserting residues of the same or a different class adjacent to the located site, or combinations of options 1-3.
(52) Alanine Scanning Mutagenesis
(53) Alanine scanning mutagenesis is a useful method for identification of certain residues or regions of the desired protein that are preferred locations or domains for mutagenesis, Cunningham and Wells (Science 244:1081-1085, 1989). In alanine scanning, a residue or group of target residues are identified (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine). Replacement of an amino acid can affect the interaction of the amino acids with the surrounding aqueous environment in or outside the cell. Those domains demonstrating functional sensitivity to the substitutions are then refined by introducing further or other variants at or for the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to optimize the performance of a mutation at a given site, alanine scanning or random mutagenesis can be conducted at the target codon or region and the expressed desired protein subunit variants are screened for the optimal combination of desired activity.
(54) Oligonucleotide Mediated Mutagenesis
(55) Oligonucleotide-mediated mutagenesis is a useful method for preparing substitution, deletion, and insertion variants of DNA, see, e.g., Adelman et al., (DNA 2:183, 1983). Briefly, the desired DNA is altered by hybridizing an oligonucleotide encoding a mutation to a DNA template, where the template is the single-stranded form of a plasmid or bacteriophage containing the unaltered or native DNA sequence of the desired protein. After hybridization, a DNA polymerase is used to synthesize an entire second complementary strand of the template that will thus incorporate the oligonucleotide primer, and will code for the selected alteration in the desired protein DNA. Generally, oligonucleotides of at least 25 nucleotides in length are used. An optimal oligonucleotide will have 12 to 15 nucleotides that are completely complementary to the template on either side of the nucleotide(s) coding for the mutation. This ensures that the oligonucleotide will hybridize properly to the single-stranded DNA template molecule. The oligonucleotides are readily synthesized using techniques known in the art such as that described by Crea et al. (Proc. Natl. Acad. Sci. (1978) USA, 75: 5765).
(56) Cassette Mutagenesis
(57) Another method for preparing variants, cassette mutagenesis, is based on the technique described by Wells et al. (Gene (1985) 34:315). The starting material is a plasmid (or other vector) that includes the protein subunit DNA to be mutated. The codon(s) in the protein subunit DNA to be mutated are identified. There must be a unique restriction endonuclease site on each side of the identified mutation site(s). If no such restriction sites exist, they can be generated using the above-described oligonucleotide-mediated mutagenesis method to introduce them at appropriate locations in the desired protein subunit DNA. After the restriction sites have been introduced into the plasmid, the plasmid is cut at these sites to linearize it. A double-stranded oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures. The two strands are synthesized separately and then hybridized together using standard techniques. This double-stranded oligonucleotide is referred to as the cassette. This cassette is designed to have 3 and 5 ends that are comparable with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid. This plasmid now contains the mutated desired protein subunit DNA sequence.
(58) Combinatorial Mutagenesis
(59) Combinatorial mutagenesis can also be used to generate mutants. For example, the amino acid sequences for a group of homologs or other related proteins are aligned, preferably to promote the highest homology possible. All of the amino acids that appear at a given position of the aligned sequences can be selected to create a degenerate set of combinatorial sequences. The variegated library of variants is generated by combinatorial mutagenesis at the nucleic acid level, and is encoded by a variegated gene library. For example, a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential sequences are expressible as individual peptides, or alternatively, as a set of larger fusion proteins containing the set of degenerate sequences.
(60) Primary High-Through-Put Methods for Screening Libraries of Peptide Fragments or Homologs
(61) Various techniques are known in the art for screening generated mutant gene products. Techniques for screening large gene libraries often include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the genes under conditions in which detection of a desired activity, e.g., inhibition of growth of human cancer cell lines (e.g., NCI-H23, EKVX, HOP-62, HOP-92, HCT-15, SW-620, COLO205, HT29, HCT-116, KM-12, CCRF-CEM, K-562, MOLT-4, SR, RPMI-8226, A549-ATCC, NCI-H226, NCI-H322M) is measured. Each of the techniques described below is amenable to high through-put analysis for screening large numbers of sequences created, e.g., by random mutagenesis techniques.
(62) Cancers
(63) The new methods can be used to treat several types of cancer, e.g., lung cancers (e.g., adenocarcinoma, nonsmall cell lung cancer), colorectal cancers, thyroid cancers (e.g., papillary thyroid carcinoma, anaplastic thyroid carcinoma, follicular carcinoma, follicular adenoma), lymphomas (e.g., non-Hodgkin lymphoma), multiple myeloma, leukemias, breast cancers, ovarian cancers, gastric cancers, bladder cancers, pancreatic cancers, gall bladder cancers, bile duct cancers, and other carcinomas. In some embodiments, the present methods can be used to treat a subject having an epithelial cancer, e.g., a solid tumor of epithelial origin, e.g., lung, breast, ovarian, prostate, renal, pancreatic, or colon cancer. Methods of diagnosing cancers are well known to those of skill in the art.
(64) In addition, the methods described herein can include identifying the cancer as lacking SRPX expression. A number of methods for detecting levels of SRPX expression are known in the art. In some embodiments, levels of SRPX mRNA are detected in cells from the tumor; alternatively or in addition, levels or SRPX polypeptide are detected in a sample comprising tissue or cells from the tumor. See, e.g., Yamashita et al. 1999, Oncogene 18:4777; Tambe et al. 2009, Cancer Lett 283:74; Kim et a. 2003, Hum Pathol 34:654; Mukaisho et al. 2002, Jpn J Cancer Res 93:888; Shimakage et al. 2000, Int J Cancer 87:5; Shimakage et al. 2002, Hum Pathol 33:615; Shimakage et al. 2009, Oncol Rep 21:1367; and Tambe et al. 2007, Carcinogenesis 28(4):777-784, all of which are incorporated herein by reference.
(65) Pharmaceutical Formulations
(66) The SRPX agents described herein (all of which can be referred to herein as active compounds), can be incorporated into pharmaceutical compositions. Such compositions typically include the active compound and a pharmaceutically acceptable carrier or excipient. A pharmaceutically acceptable carrier can include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Supplementary active compounds can also be incorporated into the compositions.
(67) There are a number of methods by which the new compositions for use in the new methods can be delivered to subjects, in general, and to specific cells or tissue in those subjects, in particular. For example, a SRPX agent (e.g., a polypeptide or active fragment thereof) as described herein can be injected into a subject or a tissue of the subject. In another example, a vector (e.g., a plasmid or virus) encoding a SRPX agent can be introduced into a cell or tissue of the subject. The vector would then enter the cell or cells in that tissue and express the SRPX agent. Delivery specificity of such plasmids can be enhanced by associating them with organ- or tissue-specific affinity, so that they preferentially enter specified cell types; in preferred embodiments, the vector would enter cells in or near the tumor. Because SRPX can act extracellularly, it is not necessary to deliver the vector directly to tumor cells. The vector can be delivered to the tissue surrounding the tumor, or cells expressing and secreting SRPX can be delivered to a site near the tumor. Similarly, when SRPX polypeptides or active fragments thereof are administered, the active agents need not enter the cells, but are delivered to the extracellular surface. Methods of expressing proteins for tumor therapy are described, e.g., in Cross and Burmester, 2006, Clin. Med. Res., 4:218-227; Lejuene et al., 2007, Expert Rev. Anticancer Ther. 7:701-713; and Bloquel et al., 2004, J. Gene Med., 6:S11-S23.
(68) Compounds and their physiologically acceptable salts and solvates can be formulated for oral, topical, buccal, parenteral or rectal administration or administration by inhalation or insufflation (either through the mouth or the nose).
(69) The compounds will generally be formulated for parenteral administration by injection, for example, by bolus injection or continuous infusion. Formulations for injection can be presented in unit dosage form, for example, in ampoules or in multi-dose containers, with an added preservative. The compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredient can be in powder form for constitution with a suitable vehicle, for example, sterile pyrogen-free water, before use. Where the compositions are intended for use in a specific treatment area, the compositions can be administered by one or more local injections into the tumor site to diminish as much as possible any side effects relating to the compound's activities outside of the treatment area.
(70) In addition to the formulations described previously, the compounds can also be formulated as a depot preparation. Such long acting formulations can be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection. Thus, for example, the compounds can be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt. A depot preparation can include embedded or encapsulated cells or tissue that secrete a SRPX agent, which can be administered, e.g., by implantation or by intramuscular injection.
(71) The compositions can, if desired, be presented in a pack or dispenser device that can contain one or more unit dosage forms containing the active ingredient. The pack can, for example, include metal or plastic foil, such as a blister pack. The pack or dispenser device can be accompanied by instructions for administration.
(72) The therapeutic compositions of the invention can also contain a carrier or excipient, many of which are known to skilled artisans. Methods for making such formulations are well known and can be found in, for example, Remington: The Science and Practice of Pharmacy, University of the Sciences in Philadelphia (USIP), 2005.
(73) The SRPX-encoding nucleic acid compositions can also be formulated for intracellular delivery of the active compounds, using methods known in the art. For example, the compositions can include liposomes or other carriers that deliver the active compound across the plasma membrane. Vesicles that are covered with membrane-permeant peptides, such as Tat or Antennapedia, can also be used. A number of other methods for enhancing intracellular delivery are familiar to those of skill in the art. Such methods are not needed when the SRPX polypeptides or fragments thereof are used, as the SRPX polypeptides act extracellularly, and are thus delivered to the extracellular surface of the tumor cells. Thus in some embodiments, the methods include the use of a composition comprising a SRPX polypeptide or active fragment thereof, but not including any cell membrane permeation-enhancing compounds, e.g., the composition does not include liposomes or membrane-permeant peptides.
(74) It is recognized that the pharmaceutical compositions and methods described herein can be used independently or in combination with one another. That is, subjects can be administered one or more of the pharmaceutical compositions, e.g., pharmaceutical compositions that include a SRPX agent, subjected to one or more of the therapeutic methods described herein, or both, in temporally overlapping or non-overlapping regimens. When therapies overlap temporally, the therapies can generally occur in any order and can be simultaneous (e.g., administered simultaneously together in a composite composition or simultaneously but as separate compositions) or interspersed. By way of example, a subject afflicted with a disorder described herein can be simultaneously or sequentially administered both a cytotoxic agent which selectively kills aberrant cells and an antibody (e.g., an antibody of the invention) which can, in one embodiment, be conjugated or linked with a therapeutic agent, a cytotoxic agent, an imaging agent, or the like.
(75) Effective Doses
(76) Toxicity and therapeutic efficacy of a SRPX agent can be determined by standard pharmaceutical procedures, using either cells in culture or experimental animals to determine the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Inhibitors that exhibit large therapeutic indices are preferred. While inhibitors that exhibit toxic side effects can be used, care can be taken to design a delivery system that targets such compounds to the site of affected tissue to minimize potential damage to non-target cells and, thereby, reduce side effects.
(77) The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the new methods, the therapeutically effective dose can be estimated initially from cell culture assays. A dose can also be calculated in animal models to achieve a circulating plasma concentration range that includes the IC50 (that is, the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
EXAMPLES
Example 1. SRPX Inhibits the Growth of Cancer Cells and Lung Cancer Xenografts
(78) Quantitative reverse transcription-polymerase chain reaction (qRT-PCR) analysis was performed to monitor SRPX expression in 9 normal lung samples, 14 lung adenocarcinoma samples, and 6 lung squamous cell carcinoma samples. Total RNA from the human samples was obtained from the University of Massachusetts Medical School Cancer Center Tissue Bank. Reverse transcription was performed using SuperScript II Reverse Transcriptase (Invitrogen) and an oligo(dT) primer (Invitrogen), followed by quantitative PCR using Fast SYBR Green Master Mix (Applied Biosystems) and gene-specific primers for SRPX. For each sample, expression of glyceraldehyde 3-phosphate dehydrogenase (GAPDH) provided an internal normalization control. For normal lung samples, the average of the 9 samples is shown. Error bars indicate standard deviation. SRPX expression was significantly decreased relative to normal lung tissue in all squamous cell carcinoma samples and at least 13 of 14 lung adenocarcinoma samples (
(79) To determine if SRPX could affect growth of cancer cells, several lung cancer cell lines and, as a control, the normal lung cell line MRC5, were plated in 6-well plates (310.sup.5 cells per well), treated with or without 10 g/ml recombinant SRPX (rSRPX) and stained with crystal violet. To express and purify rSRPX, an SRPXsec expression construct including a nucleic acid encoding SEQ ID NO:1 with a heterologous signal sequence and Myc and His.sub.6 tags was transfected into FreeStyle Chinese Hamster Ovary (CHO) cells (Invitrogen), and conditioned medium was collected 96 hours later and incubated with TALON Metal Affinity Resin (Clontech) to purify the His.sub.6-tagged SRPX protein. The purified protein was dialyzed in phosphate buffered saline (PBS) to remove free salts. rSRPX decreased growth of the cancer cell lines tested but had no effect on the growth of the normal lung cell line (
(80) To investigate the effect of SRPX on tumors in vivo, 510.sup.6 A549 human alveolar adenocarcinoma cells (mixed with Matrigel matrix in a volume of 100 l) were injected subcutaneously into the right flank of female BALB/c nu/nu (nude) mice (n=2 mice per experimental group). Three days later, the mice were injected into the anterior tibialis muscle of the left leg with either 3.010.sup.11 particles of AAV-SRPXwt or, as a control, AAV-LacZ. Tumor dimensions were measured on days 7, 11, 17, 23, 30 and 38 after injection, and tumor volume was calculated using the formula /6(length)(width). Error bars indicate standard deviation. AAV-SRPX significantly reduced tumor growth at days 30 and 38 as compared to the control (
(81) In another experiment, about 10.sup.6 A549 cells were injected in Balb/c Nu/Nu mice, and AAv9-SRPX virus was injected when the tumors reached the size of 250 mm.sup.3. The results, shown in
(82) To determine whether in vivo administration of SRPX was associated with significant toxicity, increasing doses were administered to mice and levels of liver enzymes, aspartate aminotransferase (AST) and alanine aminotransferase (ALT), increases in which are typically associated with toxic insult, were measured. The results, as shown in
(83) The NCI60 panel of human cancer cell lines (see Shoemaker, 2006, Nat. Rev. Cancer, 6:813-823) was obtained from the National Cancer Institute. The panel includes cell lines corresponding to breast (MDA-MB-231, HS 578T, BT-549, T47-D, MCF7), ovarian (NCI-ADR-RES, OVCAR-3, OVCAR-5, OVCAR-8, OVCAR-4, SK-OV-3, IGROV1), prostate (DU-145, PC-3), renal (TK-10, CAKI-1, A496, ACHN, RXF-393, 786-0, SN12C, UO-31), non-small-cell lung (NCI-H460, HOP-62, A549-ATCC, NCI-H226, EKVX, NCI-H322M, HOP-92, NCI-H522), central nervous system (CNS) (SF-295, SF-268, SF-539, SNB-19, SNB-75, U251), colon (HCT-15, SW-620, COLO205, HT29, HCC-2998, HCT-116, KM-12), melanoma (SK-MEL-28, SK-M2L-2, LOX IMVI, M14, MALM-3M, SK-MEL-5, UACC-257, UACC-62, MDA-MB-435), and hematopoietic (CCRF-CEM, K-562, MOLT-4, SR, RPMI-8226) cancers (only a subset of the NCI60 panel is shown). Cells (310.sup.5 for breast, colon, leukemia, lung cell lines, and 2105 for melanoma cell lines) were plated and treated with 30% control CM or SRPX-containing CM (produced as described above for
(84) As a secreted protein, SRPX contains an N-terminal signal sequence that directs its secretion. To determine whether the signal sequence is required for the ability of SRPX to inhibit cancer cell growth, a derivative of full-length SRPX that lacks the N-terminal signal sequence (amino acids 1-35; hereafter called SRPX(1-35)) was constructed and tested for its ability to inhibit growth of A549 human lung adenocarcinoma epithelial cells. Briefly, 310.sup.5 A549 cells were plated in 6-well plates and treated with 30% CM derived from cells expressing either empty vector (control), full-length SRPX or SRPX(1-35). After 3 days, the CM was replaced with complete medium, and the cells were allowed to grow for an additional 4 days before staining with crystal violet. The results show that in contrast to full-length SRPX, SRPX(1-35) does not inhibit growth of A549 cells (
(85) These results strongly support the use of SRPX to treat and prevent a wide range of cancers, including lung cancers, colon cancers, and leukemias.
OTHER EMBODIMENTS
(86) A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.