TREATMENT OF DISEASES CAUSED BY FRAME SHIFT MUTATIONS
20230024301 · 2023-01-26
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
A01K67/0275
HUMAN NECESSITIES
C12N9/22
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2800/40
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
A01K2217/077
HUMAN NECESSITIES
C07K2319/92
CHEMISTRY; METALLURGY
A61K48/0075
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates a vector system and a vector system for use in a method of treating a disease, each comprising a first vector and a second vector. The present invention further relates to the first vector, the second vector and a combination of the first vector and the second vector. In addition, the present invention relates to a pharmaceutical composition comprising the vector system of the invention or the combination of the invention.
Claims
1. A method of treating a disease in a subject in need thereof, the method comprising administering a vector system to said subject, the vector system comprising (a) a first vector comprising a nucleic acid sequence encoding: (i) a first fragment of an endonuclease, (ii) a first fragment of an intein, and (ii) a first guide RNA (gRNA); and (b) a second vector comprising a nucleic acid sequence encoding: (i) a second fragment of the endonuclease, (ii) a second fragment of the intein, and (ii) a second guide RNA (gRNA); wherein the first gRNA binds to a region, which is located 5′ to a sequence of interest comprised in a nucleic acid sequence in the genome, optionally DNA, of a target cell, wherein the second gRNA binds to a region located 3′ to the sequence of interest comprised in the nucleic acid sequence in the genome, optionally DNA, of a target cell; wherein the first fragment and the second fragment of the intein are capable of associating into a functional intein, wherein the functional intein is capable of ligating the first and the second fragment of the endonuclease to form a functional endonuclease; wherein the functional endonuclease is capable of excising the sequence of interest.
2. The vector system for use of any of the preceding claims, wherein the endonuclease is Cas9, optionally Streptococcus pyogenes Cas9 (SpCas9), further optionally the Cas9 comprises an amino acid sequence as set forth in SEQ ID NO: 1 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 1.
3. The method of claim 1, wherein i) the first fragment of the endonuclease comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 and 3 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 2 and 3, ii) the second fragment of the endonuclease comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 4 and 5 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 4 and 5, or both i) and ii).
4. (canceled)
5. The method of claim 1, wherein the intein is selected from the group consisting of i) Npu of SEQ ID 6 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 6, ii) NrdJ-1 of SEQ ID 7 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 7 and a) gp-41 of SEQ ID 8 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 8.
6. The method of claim 1, wherein i) the first fragment of the intein comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9-11 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 9-11, ii) wherein the second fragment of the intein comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12-14 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 12-14, or both i) and ii).
7. (canceled)
8. The method of claim 1, wherein the first and/or the second vector is a viral vector, optionally wherein the viral vector is an adeno-associated virus (AAV) or lentivirus.
9. (canceled)
10. (canceled)
11. The method of claim 8, wherein the AAV is selected from the group consisting of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, and AAV11, or any combination thereof.
12. (canceled)
13. The method of claim 1, wherein the viral vector is coated with a dendrimer, optionally wherein the dendrimer is a PAMAM (poly(amidoamine)), further optionally wherein the dendrimer is a 2.sup.nd generation PAMAM.
14. (canceled)
15. (canceled)
16. The method of claim 1, wherein the nucleic acid of the first and/or the second vector further comprises: (iv) a nuclear localization signal, optionally comprising a sequence selected from the list group consisting of SEQ ID NOs: 15-20 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 15-20.
17. The method of claim 1, wherein the first fragment of the nuclease and/or the second fragment of the intein and the nucleic acid(s) encoding the first and/or the second gRNA are operatively coupled to a promoter, wherein the promoter(s) optionally is/are inducible, optionally wherein i) the promoter that is operatively coupled to the first fragment of the nuclease and/or the second fragment of the intein is selected from the group consisting of CBH, B29 promoter, CD14 promoter, CD43 promoter, CD45 promoter, CD68 promoter, desmin promoter, elastase-1 promoter, endoglin promoter, fibronectin promoter, Flt-1 promoter, GFAP promoter, GPIIb promoter, ICAM-2 promoter, Mb promoter, NphsI promoter, SP-B promoter, SYN1 promoter and WASP promoter; ii) wherein the promotor that is operatively coupled to the first and/or the second gRNA is an RNA polymerase III promoter, further optionally selected from the group consisting of U6, H1 and 7SK; or both i) and ii).
18. (canceled)
19. (canceled)
20. The method of claim 1, wherein the method further comprises one or more of the following: administering to the subject the first vector; administering to the subject the second vector; excising the sequence of interest.
21. (canceled)
22. The method of claim 1, wherein the first and the second vector are administered to the patient simultaneously or sequentially, optionally sequentially with a time delay of at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, of at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours, at least 1 week or at least 2 weeks.
23. (canceled)
24. The method of claim 1, wherein the subject is a mammal, optionally a human or a pig.
25. The method of claim 1, wherein the first and the second vectors are administered systemically, enterally, parenterally, intravenously, intra-arterially, topically, intraperitoneally, intramuscularly, intradermally, intrathecally, intravitreally, subcutaneously, transdermally and/or transmucosally.
26. The method of claim 1, wherein the disease is selected from the group consisting of Duchenne muscular dystrophy, hereditary myopathy with early respiratory failure, early-onset myopathy with fatal cardiomyopathy, core myopathy with heart disease, centronuclear myopathy, limb-girdle muscular dystrophy type 2J, familial dilated cardiomyopathy 9, hypertrophic cardiomyopathy and tibial muscular dystrophy, optionally Duchenne muscular dystrophy, further optionally Duchenne muscular dystrophy characterized by a deletion of exon 52 of the dystrophin gene.
27. (canceled)
28. The method of claim 1, wherein i) the nucleic acid sequence of interest is exon 51 of the dystrophin gene, optionally the exon 51 comprises a sequence of 23 or 24 or a nucleic acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 23 or 24, ii) wherein the first gRNA comprises a nucleic acid sequence as set forth in any of SEQ ID NOs: 25 or 26 or a nucleic acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID NOs: 25 or 26 and/or the second gRNA comprises a nucleic acid sequence as set forth in any of SEQ ID NOs: 27 or 28 or a nucleic acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID NOs: 27 or 28, or both i) and ii).
29. (canceled)
30. (canceled)
31. A vector system comprising (a) a first vector comprising a nucleic acid sequence encoding: (i) a first fragment of an endonuclease, (ii) a first fragment of an intein, and (ii) a first guide RNA (gRNA); and (b) a second vector comprising a nucleic acid sequence encoding: (i) a second fragment of the endonuclease, (ii) a second fragment of the intein, and (ii) a second guide RNA (gRNA); wherein the first gRNA binds to a region, which is located 5′ to a sequence of interest comprised in a nucleic acid sequence in the genome, optionally DNA, of a target cell, wherein the second gRNA binds to a region located 3′ to the sequence of interest comprised in the nucleic acid sequence in the genome, optionally DNA, of a target cell; wherein the first fragment and the second fragment of the intein are capable of associating into a functional intein, wherein the functional intein is capable of ligating the first and the second fragment of the endonuclease to form a functional endonuclease; wherein the functional endonuclease is capable of excising the sequence of interest.
32. The first vector, the second vector, or both the first and the second vector, as defined in claim 31.
33. (canceled)
34. (canceled)
35. A pharmaceutical composition comprising the vector system of claim 31.
36. A method for excising a sequence of interest from the genome, optionally DNA, of a subject, the method comprising administering the vector system of claim 31 thereby excising the sequence of interest from the genome, optionally DNA, of a subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0053] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings, in which:
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
DETAILED DESCRIPTION OF THE INVENTION
[0070] The present invention is described in detail in the following and will also be further illustrated by the appended examples and figures.
[0071] Large genes such as dystrophin or titin comprise a high number of exons. Not all of these exons comprise a number of nucleotides that can be divided by 3, i.e. a deletion of one of these exons might lead to a frameshift mutation. This would then result in a truncated and/or non-functional protein. Alternatively, an exon may also be duplicated, triplicated etc. and could thus induce, e.g. a frameshift mutation or lead otherwise to a non-functional expression product. In addition, a stop codon can occur due to point mutation or small mutations in an exon, also leading to complete dystrophin deficiency. Both, dystrophin and titin are large proteins of the muscle and are involved in the movement of muscles. Thus, nonsense mutations of these proteins lead to severe diseases, which are potentially deadly when organs such as the heart or lung are affected. A prominent example for such a disease is Duchenne muscular dystrophy (DMD).
[0072] DMD is very often characterized by deletions of one exon such as exon 52. Exon 52 consists of a number of nucleotide that cannot divided by 3, i.e. a deletion of exon 52 leads to a frameshift mutation. This is shown in
[0073] The present inventors found an inventive solution for deleting exons of genes that result in a frame shift mutation. In contrast to prior art technologies, such as that disclosed in Amoasii et al..sup.15, the inventors applied an improved technology. While Amoasii et al. use one AAV for the Cas9 nuclease and another AAV for overexpressing the sgRNA, the present inventors employed a system making use of a split-intein Cas9 vector system that shows efficacy and safety (see Example 1).
[0074] In an exemplary embodiment (see example 1), the inventors make use of a split intein Cas9 system: A first AAV comprises the N-terminal fragment of Cas9 fused to a split intein and a second AAV comprises the C-terminal fragment of Cas9 fused to the second split intein fragment. If only one of these AAVs is administered, no functional endonuclease can be generated, which shows the intrinsic safety of this approach. If both, the first and the second AAV are administered, both Cas9-split intein fragments will associate after expression in the host cell. The split intein will then excise itself and thereby fuse the N- and the C-terminal fragment of Cas9 to a functional protein. The Cas9 endonuclease is guided by a sgRNA, which can be comprised in either or both of the first and the second AAV. In Example 1, one sgRNA targets the Cas9 to the 5′ end of exon 51 of DMD and another on the other AAV to the 3′ prime end of exon 51 of DMD. This finally leads to the excision of exon 51 and restores the frame of dystrophin. The inventors successfully applied this approach in DMD-pigs that were genetically altered to miss exon 52. As shown by the inventors, the pigs that were treated with the vector system of the present invention had an improved survival and reduced arrhythmogenic vulnerability. The Inventors could further show the efficacy of this approach in human cells.
[0075] This vector system can be easily transferred to other diseases of the same type that e.g. are related to a deletion or mutation (including, but not limited to, duplication, triplication etc.) of an exon that leads to a frameshift and other endonucleases.
[0076] Accordingly, the present invention relates to a vector system for use in a method of treating a disease, the vector system comprising (a) a first vector comprising a nucleic acid sequence encoding: (i) a first fragment of an endonuclease, (ii) a first fragment of an intein, and (ii) a first guide RNA (gRNA); and (b) a second vector comprising a nucleic acid sequence encoding: (i) a second fragment of the endonuclease, (ii) a second fragment of the intein, and (ii) a second guide RNA (gRNA); wherein the first gRNA binds to a region, which is located 5′ to a sequence of interest comprised in a nucleic acid sequence in the genome of a target cell, preferably in the DNA, wherein the second gRNA binds to a region located 3′ to a sequence of interest comprised in the nucleic acid sequence in the genome of a target cell, preferably in the DNA; wherein the first fragment and the second fragment of the intein are capable of associating into a functional intein, wherein the functional intein is capable of ligating the first and the second fragment of the endonuclease to form a functional endonuclease; wherein the functional endonuclease is capable of excising the sequence of interest.
[0077] A “genome” as used herein may be described as the genetic material of an organism. As such, it may consist of DNA and/or may relate to the total DNA content of a host cell, organism or subject. The genome preferably includes genes (coding regions) and noncoding DNA as well as mitochondrial DNA. The DNA of the genome usually comprises two strands. Genes can be present on each of the two strands, are however always transcribed in 5′ to 3′ direction (in relation to the coding strand). Thus, when relating to the 5′ or 3′ end of the sequence of interest, the present disclosure relates to the 5′ or 3′ end of the coding strand of the sequence of interest. In this context, it is noted that is irrelevant which of the two strands (coding or template strand) the guideRNA is directed, since the endonucleases induce a double strand break. Thus, the first guideRNA may bind to a region located 5′ to the sequence of interest on the coding strand or to a region located 3′ to the sequence of interest on the template strand. Additionally, the second guideRNA may bind to a region located 3′ to the sequence of interest on the coding strand or to a region located 5′ to the sequence of interest on the template strand.
[0078] It is obvious to a person skilled in the art that the case in which the first gRNA binds to a region located 3′ to the sequence of interest and the second gRNA binds to a region located 5′ to the sequence of interest is equivalent to the case in which the first gRNA binds to a region located 5′ to the sequence of interest and the second gRNA binds to a region located 3′ to the sequence of interest.
[0079] As described herein, the vector system of the present invention comprises two separate vectors, a first vector and a second vector. In principle it is irrelevant on which of the vectors which fragment is comprised. Importantly, there should not be the first and the second fragment of the endonuclease or the first fragment and the second fragment of the intein on the same vector. Which of the both vectors is termed first vector and second vector is not relevant for the scope of the invention. The vector system of the present invention may be used to excise an exon of a gene comprising at least two exons. In a preferred embodiment, the first vector comprises the first fragment of the endonuclease an N-terminal fragment of the endonuclease fused to the first fragment of the intein, which is an N-terminal fragment of the intein, and the second vector comprises as second fragment of the intein an C-terminal fragment of the intein fused to the C-terminal fragment of the endonuclease. Such a domain arrangement is exemplarily shown in
[0080] “Inteins” as used in the context of the present invention and as used throughout the whole description, can be described as protein introns, which are able to auto catalytically splice themselves posttranslationally out of a protein resulting in covalently linked exteins as a scar less gene product. This process may be termed protein splicing. Exteins on the other hand are the remaining portions of the protein after the intein has excised itself out. Within the context of the present invention, the exteins can be described as the first and the second fragment of the endonuclease.
[0081] The term “split intein” means in the context of this present invention and as used throughout the whole description, a subset of inteins that are expressed in two separate halves, named in the context of the present invention “first fragment of the intein” and “second fragment of the intein” or alternatively “N-intein” and “C-intein” and catalyze splicing in trans upon association of the two domains. The term “two separate halves” does not mean in this context that the two separated domains of the split intein are even or equally split. Instead, the term also includes any split ratio between the two domains of the split intein, which a person skilled in the art can conceive of. The “split intein” may occur naturally and may also been artificially generated by splitting of contiguous ones. With their unique properties, split-inteins offer improved controllability, flexibility and capability to existing tools based on contiguous inteins.
[0082] A “functional intein” as used herein is capable of ligating the first and the second fragment of a protein—a process referred to as intein-mediated protein splicing. Intein-mediated protein splicing typically occurs after the intein-containing mRNA has been translated into a protein. The process begins with an N—O or N—S shift, when the side chain of the first residue (preferably a serine, threonine, or cysteine) of the (N-terminal split) intein portion of the expression product of the specific splice product nucleophilically attacks the peptide bond of the residue immediately upstream (that is, the final residue of the N-extein) to form a linear ester (or thioester) intermediate. A transesterification occurs when the side chain of the first residue of the C-extein, i.e. the amino acid C-terminal to the C-terminal split intein, attacks the newly formed (thio)ester to free the N-terminal end of the intein. This forms a branched intermediate, in which the N-extein and C-extein are attached, albeit not through a peptide bond. The last residue of the intein preferably is an asparagine, and the amide nitrogen atom of this side chain might cleave apart the peptide bond between the intein and the C-extein, resulting in a free intein segment with a terminal cyclic imide. Finally, the free amino group of the C-extein may now attack the (thio)ester linking the N- and C-exteins together. An O—N or S—N shift therefore preferably produces a peptide bond and the functional, ligated protein.
[0083] As soon as N- and C-exteins (flanking the intein) are in spatial proximity to each other, the excision process can be initialized by forming a succinimide intermediate. For this process, the presence of several amino acids in fixed positions may be required: Either a cysteine or a serine residue at the N-terminal side of the intein, an asparagine at the C-terminal side of the intein and another cysteine at the beginning of the C-terminal extein may exist. After splicing has taken place, the resulting protein contains the N-extein linked to the C-extein; this splicing product may be also termed an extein.
[0084] The ligation activity of the intein can be determined by a person skilled in the art, e.g. by using a Western blot against one terminus of the Cas9 protein, e.g. the N-terminus or the C-terminus. In case, an antibody-binding Cas9 protein larger than the expected terminus size, intein-mediated ligation of the protein halves is viewed as a proof of reassembly. A “functional intein” thus may be seen as an intein that is considered to have ligation activity as determined by said assay.
[0085] Examples for split inteins include the Npu intein, the NrdJ-1 intein or the gp41-1 intein, which may all be split and excise the polypeptide that has been fused between the N- and the C-terminus of the split intein.
[0086] In one embodiment of the method of the present invention, the first fragment of the split intein comprises or consists of the Npu N-terminal region (SEQ ID NO: 9), the NrdJ-1 N-terminal region (SEQ ID NO: 10), or the gp41-1 N-terminal region (SEQ ID NO: 11) or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID NOs 9-11, and/or the second fragment of the split intein comprises or consists of the Npu C-terminal region (SEQ ID NO: 12), the NrdJ-1 C-terminal region (SEQ ID NO: 13) or the gp41-1 C-terminal region (SEQ ID NO: 14) or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID NOs 12-14. In one embodiment of the method of the present invention, the first fragment of the split intein comprises or consists of the Npu N-terminal region (SEQ ID NO: 9) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 9. In one embodiment of the method of the present invention, the first fragment of the split intein comprises or consists of the NrdJ-1 N-terminal region (SEQ ID NO: 10) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 10. In one specific embodiment of the method of the present invention, the first fragment of the split intein comprises or consists of the gp41-1 N-terminal region (SEQ ID NO: 11) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 11. In another embodiment of the method of the present invention, the second fragment of the split intein comprises or consists of the Npu C-terminal region (SEQ ID NO: 12) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 12. In another embodiment of the method of the present invention, the second fragment of the split intein comprises or consists of the NrdJ-1 C-terminal region (SEQ ID NO: 13) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 13. In one further embodiment of the method of the present invention, the second fragment of the split intein comprises or consists of the gp41-1 C-terminal region (SEQ ID NO: 14) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 14. In one further embodiment of the method of the present invention, the first fragment of the split intein consists of the Npu N-terminal region (SEQ ID NO: 9) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 9. In one further embodiment of the method of the present invention, the first fragment of the split intein consists of the NrdJ-1 N-terminal region (SEQ ID NO: 10) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 10. In another embodiment of the method of the present invention, the first fragment of the split intein consists of the gp41-1 N-terminal region (SEQ ID NO: 11) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 11. In one further embodiment of the method of the present invention, the second fragment of the split intein consists of the Npu C-terminal region (SEQ ID NO: 12) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 12. In one further embodiment of the method of the present invention, the second fragment of the split intein consists of the NrdJ-1 C-terminal region (SEQ ID NO: 13) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 13. In one embodiment of the method of the present invention, the second fragment of the split intein consists of the gp41-1 C-terminal region (SEQ ID NO: 14) or comprises or consists of an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 14.
[0087] A variety of sequence based alignment methodologies, which are well known to those skilled in the art, can be used to determine identity among sequences. These include, but are not limited to, the local identity/homology algorithm of Smith, F. and Waterman, M. S. (1981) Adv. Appl. Math. 2: 482-89, homology alignment algorithm of Peason, W. R. and Lipman, D. J. (1988) Proc. Natl. Acad. Sci. USA 85: 2444-48, Basic Local Alignment Search Tool (BLAST) described by Altschul, S. F. et al. (1990) J. Mol. Biol. 215: 403-10, or the Best Fit program described by Devereau, J. et al. (1984) Nucleic Acids. Res. 12: 387-95, and the FastA and TFASTA alignment programs, preferably using default settings or by inspection. Alternatively, an alignment may be done manually/visually for amino acids sequences as follows: the percent identity between an amino acid sequence in question (query sequence) and an amino acid sequence of the invention/disclosed in the sequence listing (reference sequence), respectively, as defined herein is determined by pairwise alignment in such a way that the maximum identity is obtained between both amino acid sequences. The identical amino acid residues between both amino acid sequences are counted and divided by the total number of residues of the reference sequence (including positions that do not contain amino acid residues, e.g. one or more gaps) yielding the percentage of identity.
[0088] An “endonuclease” as used herein relates to an RNA-guided enzyme that cleaves the phosphodiester bond within a DNA polynucleotide chain. A “functional endonuclease” preferably has said activity of cleaving the phosphodiester bond within a DNA polynucleotide chain. Within the context of the present invention, the endonuclease preferably excises the sequence of interest from the genome, preferably DNA, of a host cell, such as an exon to restore the reading frame of a gene. The endonuclease used in the present invention preferably is a Cas9 endonuclease. The endonuclease used by the present invention may be split into two fragments, a first fragment of the endonuclease and a second fragment of the endonuclease. “Fragment” as used in this context relates to a portion of the endonuclease that is split into two parts or portions (fragments). The term “fragment” does not mean in this context that the two separated parts or portions (fragments) of the endonuclease are even or equally split. Instead, the term also includes any split ratio between the two parts or portions (fragments) of the endonuclease, which a person skilled in the art can conceive of. Both fragments of the endonuclease are ligated by the intein to the functional or “complete” endonuclease. A person skilled in the art knows how to determine whether an endonuclease has the activity of cleaving the phosphodiester bond within a DNA polynucleotide chain or not. Within the context of the invention, a “functional endonuclease” preferably mediates the excision of a sequence of interest, preferably in the genome (DNA) of a host cell. In an exemplary assay, a sample comprising the genome, i.e. nucleic acids such as DNA, obtained from the subject can be analyzed for the presence or absence of the sequence of interest. If the sequence of interest is no longer present in the sample, the endonuclease can be seen as functional. Methods suitable for this assay include, but are not limited to, PCR, qPCR or sequencing.
[0089] Various different endonucleases are known to a person skilled in the art. In a preferred embodiment, the endonuclease is Cas9 from Streptococcus pyogenes exemplified in SEQ ID NO: 1. The endonuclease may further be a Cas9 protein having an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 1. The endonuclease may be split at a specified position leading to two fragments, the first fragment of the endonuclease and the second fragment of the endonuclease. When used within the embodiments of the invention, the endonuclease is divided in two fragments. In one embodiment of the invention, the Cas9 from Streptococcus pyogenes may be split between amino acid positions 573 and 574. In another embodiment of the invention, the Cas9 from Streptococcus pyogenes may be split between amino acid positions 637 and 638.
[0090] Accordingly, the first fragment of the endonuclease may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 and 3 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 2 and 3. In a specific embodiment, the first fragment of the nuclease consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 and 3 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 2 and 3.
[0091] Accordingly, the second fragment of the endonuclease may comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 4 and 5 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as selected from the group consisting of SEQ ID NOs: 4 and 5. In a specific embodiment, the second fragment of the nuclease consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 4 and 5 or an amino acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 4 and 5.
[0092] “Vector” as used herein relates to nucleic acid suitable for transfer and expression of proteins or RNAs encoded by the nucleic acid in a target cell. Vector as used herein may also relate to a virus comprising a nucleic acid suitable for transfer and expression of proteins or RNAs encoded by the nucleic acid in a target cell.
[0093] Accordingly, one mode of administration for the vector system of the invention may be in the form of viral particles. Accordingly, the first and/or the second vector of the invention may be a viral vector. The viral vector may be a virus particle comprising a vector encoding the first or the second vector of the invention. Examples for a viral vector include, but are not limited to, adeno-associated virus (AAV) or lentivirus. Preferably, the lentivirus does not integrate into the genome of the target cell. Accordingly, the viral vector may be an AAV. Alternatively, the viral vector may be a lentivirus.
[0094] AAV is a small virus that infects humans and some other primate species. The virus causes a very mild immune response. Gene therapy vectors using AAV can infect both dividing and quiescent cells and persist in an extrachromosomal state without integrating into the genome of the host cell. AAV belongs to the genus Dependoparvovirus, which in turn belongs to the family Parvoviridae. The virus is a small (20 nm) replication-defective, nonenveloped virus. Several serotypes of AAV are known to a person skilled in the art. The different serotypes of AAV show different tropism. Accordingly, the AAV may be selected according to the cell type or tissue that is to be genetically modified. Table 1 shows an overview of the tropisms of different AAV serotypes.
TABLE-US-00001 TABLE 1 Tropism of AAV Serotypes. Tissue Optimal Serotype CNS AAV1, AAV2, AAV4, AAV5, AAV8, AAV9 Heart AAV1, AAV8, AAV9 Kidney AAV2 Liver AAV7, AAV8, AAV9 Lung AAV4, AAV5, AAV6, AAV9 Pancreas AAV8 Photoreceptor Cells AAV2, AAV5, AAV8 RPE (Retinal Pigment Epithelium) AAV1, AAV2, AAV4, AAV5, AAV8 Skeletal Muscle AAV1, AAV2, AAV5, AAV6, AAV8, AAV9
[0095] In a preferred embodiment, the AAV is AAV1, AAV2, AAV5, AAV6, AAV8, AAV9 or any combination thereof. In a more preferred embodiment, the AAV is AAV1. In a more preferred embodiment, the AAV is AAV2. In a more preferred embodiment, the AAV is AAV5. In a more preferred embodiment, the AAV is AAV6. In a more preferred embodiment, the AAV is AAV8. In a more preferred embodiment, the AAV is AAV9. The first vector and the second vector do not necessarily be the same AAV but may be different. Preferably however, the first and the second vector are the same AAV such as AAV9.
[0096] Thus, the tropism of the (viral) vector determines the target cells that are genetically modified by the vector system of the invention.
[0097] As shown by the Inventors (see
[0098] A “disease” within the meaning of the present invention relates to any disease that may be treated by the deletion of a sequence of interest such as an exon. The disease may relate to a disease that is caused by the deletion of an exon of a gene, which induces a frameshift mutation. This frameshift mutation may lead to a non-functional protein or to a protein that is not expressed, e.g. because of a stop codon induced by the frameshift mutation. Non-limiting examples for genes that may be affected by such a mutation are titin and dystrophin. Both of which are important for the function of muscles. Diseases caused by frameshift mutations of titin or dystrophin may include Duchenne muscular dystrophy, hereditary myopathy with early respiratory failure, early-onset myopathy with fatal cardiomyopathy, core myopathy with heart disease, centronuclear myopathy, limb-girdle muscular dystrophy type 2J, familial dilated cardiomyopathy 9, hypertrophic cardiomyopathy and tibial muscular dystrophy. In addition or alternatively, also proteins characterized by repetitive protein domains such as immunoglobulins may be affected. The disease within the meaning of the invention may further relate to diseases that are caused by the presence of an exon, which is not present in a healthy subject, e.g. a duplication, triplication etc. of an exon. Such a duplication, triplication etc. may be present in the dystrophin gene and/or may also lead to Duchenne muscular dystrophy.
[0099] In a preferred embodiment, the disease is Duchenne muscular dystrophy (DMD). DMD is a severe type of muscular dystrophy characterized by muscle weakness usually beginning around the age of four in boys and worsens quickly. Typically muscle loss occurs first in the thighs and pelvis followed by those of the arms. Most patients are unable to walk by the age of 12. The disorder is X-linked recessive. About two thirds of cases are inherited from a person's mother, while one third of cases are due to a new mutation. It is caused by a mutation in the dystrophin gene at locus Xp21, located on the short arm of the X chromosome and is inherited in an X-linked recessive pattern. Dystrophin is responsible for connecting the cytoskeleton of each muscle fiber to the underlying basal lamina (extracellular matrix), through a protein complex containing many subunits. The absence of dystrophin permits excess calcium to penetrate the sarcolemma (the cell membrane). Alterations in calcium and signaling pathways cause water to enter into the mitochondria, which then burst.
[0100] The present invention makes use genome-targeting nucleic acids that can direct the activities of an associated endonuclease to a specific target sequence within a target nucleic acid. The genome-targeting nucleic acid can be RNA. A genome-targeting RNA is referred to as a “guide RNA” or “gRNA” herein. A guide RNA can comprise at least a spacer sequence that hybridizes to a target nucleic acid sequence of interest, and a CRISPR repeat sequence. In Type II systems, the gRNA also comprises a second RNA called the tracrRNA sequence. In the Type II guide RNA (gRNA), the CRISPR repeat sequence and tracrRNA sequence hybridize to each other to form a duplex. In the Type V guide RNA (gRNA), the crRNA forms a duplex. In both systems, the duplex can bind a site-directed polypeptide, such that the guide RNA and site-direct polypeptide form a complex. The genome-targeting nucleic acid can provide target specificity to the complex by virtue of its association with the site-directed polypeptide. The genome-targeting nucleic acid thus can direct the activity of the site-directed polypeptide. The functionality of a genome-targeting nucleic acid can be tested by analyzing the DNA that should have been modified. If the desired modification is present, the genome-targeting nucleic acid(s) target the endonuclease to the correct position and excises the correct sequence of interest from the genome. Suitable methods include, but are not limited to, Mismatch cleavage assay, Sequence trace decomposition analysis, Indel Detection by Amplicon Analysis (IDAA), Digital PCR, Immunofluorescence analysis or Clonal analysis.
[0101] Each guide RNA can be designed to include a spacer sequence complementary to its genomic target sequence. Exemplary spacers are shown in SEQ ID NO: 25-28 (see also Table 2). For example, each of the spacer sequences in the Sequence Listing can be put into a single strand guide RNA (sgRNA) (e.g., an RNA chimera) or a crRNA (along with a corresponding tracrRNA). See Jinek et al., Science, 337, 816-821 (2012) and Deltcheva et al., Nature, 471, 602-607 (2011). The genome-targeting nucleic acid can be a double-molecule guide RNA. The genome-targeting nucleic acid can be a single-molecule guide RNA.
[0102] A double-molecule guide RNA can comprise two strands of RNA. The first strand comprises in the 5′ to 3′ direction, an optional spacer extension sequence, a spacer sequence and a minimum CRISPR repeat sequence. The second strand can comprise a minimum tracrRNA sequence (complementary to the minimum CRISPR repeat sequence), a 3′ tracrRNA sequence and an optional tracrRNA extension sequence.
[0103] A single-molecule guide RNA (sgRNA) in a Type II system can comprise, in the 5′ to 3′ direction, an optional spacer extension sequence, a spacer sequence, a minimum CRISPR repeat sequence, a single-molecule guide linker, a minimum tracrRNA sequence, a 3′ tracrRNA sequence and an optional tracrRNA extension sequence. The optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA. The single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure. The optional tracrRNA extension can comprise one or more hairpins.
[0104] A single-molecule guide RNA (sgRNA) in a Type V system can comprise, in the 5′ to 3′ direction, a minimum CRISPR repeat sequence and a spacer sequence.
[0105] The sgRNA of the present invention may comprise an optimized backbone, e.g. as disclosed in Dang et al. (2015), Genome Biology, 16:280, hereby incorporated by reference. Optimizing in this context may e.g. relate to the deletion the 4×T sequence termination signal comprised in the wild type sgRNA sequence that may cause premature termination (see in this context Gao et al. 2017, Mol Ther Nucleic Acids, 10:36-44). An example for such an optimized backbone is further shown in SEQ ID NO: 29. Thus, in one embodiment, a spacer disclosed herein is combined with an optimized sgRNA backbone, e.g. SEQ ID NO: 29, preferably the spacer is upstream of the optimized sgRNA backbone sequence, i.e. the spacer sequence is 5′ of the sgRNA backbone sequence.
[0106] For example, the sgRNA may comprise or consist of a sequence of any one of SEQ ID No. 25-28 and/or 29. Likewise the gRNA may comprise a sequence as shown in SEQ ID No. 25 and 29. The gRNA can also comprise a sequence as shown in SEQ ID No. 26 and 29, 27 and 29 or 28 and 29.
[0107] By way of illustration, guide RNAs used herein or other smaller RNAs can be readily synthesized by chemical means, as illustrated below and described in the art. While chemical synthetic procedures are continually expanding, purifications of such RNAs by procedures such as high performance liquid chromatography (HPLC, which avoids the use of gels such as PAGE) tends to become more challenging as polynucleotide lengths increase significantly beyond a hundred or so nucleotides. One approach used for generating RNAs of greater length is to produce two or more molecules that are ligated together.
[0108] “Sequence of interest” as used herein relates to a nucleotide sequence, preferably of the genome of a target cell that is to be excised, i.e. removed, from a gene to restore the reading frame or to repair any other type of mutation that renders the gene non-functional. One example of a gene that is affected by a frameshift leading to a truncated and non-functional protein is dystrophin. Dystrophin is a very large protein comprising many exons. Deletion of one exon may lead to a frameshift mutation. As outlined herein, a prominent example is the deletion of exon 52 of dystrophin, which could be treated by deletion of exon 51 of dystrophin. Accordingly, the sequence of interest may be exon 51 of the dystrophin gene. Preferably, the exon 51 of the dystrophin gene has a nucleic acid sequence as depicted in SEQ ID NO: 23 or 24 or a nucleic acid sequence having at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID 23 or 24.
[0109] Within the context of the invention, the first vector comprises a first gRNA and the second vector comprises a second gRNA. Both gRNAs are designed to excise a sequence of interest such as an exon of a gene, preferably exon 51 of dystrophin. Exon 51 of human dystrophin that may be excised by the vector system of the invention may have the nucleic acid sequence depicted in SEQ ID NO: 23. Exon 51 of porcine dystrophin that may be excised by the vector system of the invention may have the nucleic acid sequence depicted in SEQ ID NO: 24. Accordingly, at least two different sgRNAs have to be used to achieve excision of the sequence of interest—one comprised in the first vector and one comprised in the second vector. In other words, two sgRNA designed for the excision of the sequence of interest constitute a sgRNA pair. One sgRNA of the sgRNA pair may comprise a spacer complementary to the 5′ end of the sequence of interest, wherein the other sgRNA of the sgRNA pair may comprise a spacer complementary to the 3′ end of the sequence of interest. Accordingly, for excision of exon 51 of human dystrophin, the first gRNA may comprise a nucleic acid sequence as set forth in any of SEQ ID NOs: 26 and/or the second gRNA may comprise a nucleic acid sequence as set forth in any of SEQ ID NOs: 28 or vice versa. Accordingly, for excision of exon 51 of porcine dystrophin, the first gRNA may comprise a nucleic acid sequence as set forth in any of SEQ ID NOs: 25 and/or the second gRNA may comprise a nucleic acid sequence as set forth in any of SEQ ID NOs: 27 or vice versa.
[0110] Deletion of exon 51 of the dystrophin gene may restore the reading frame of the dystrophin gene and thereby enables the translation of a truncated but functional dystrophin.
[0111] The endonuclease modifies the genome of the target cell, preferably the DNA comprised in the target cell. In case, the target cell is a eukaryotic cell, the genome is localized in the nucleus. To support the function of the nuclease, the endonuclease can be fused to a nuclear localization signal (NLS) that directs the endonuclease to the nucleus.
[0112] The elements encoded by the vector system of the invention may be operatively coupled to the promoter. An exemplary organization of the vector system of the invention is shown in
[0113] Medical treatments may require the administration of the active ingredient. Accordingly, the method of the vector system for use of the present invention (i.e. in a method of treatment) may further comprise administering to the subject the first vector; and administering to the subject the second vector. The method may further comprise excising the sequence of interest.
[0114] The splitting the nuclease in two different vectors increases the safety. Until both, the first vector and the second vector, are brought in contact or are both administered to the patient, no functional endonuclease can be generated or—expressed differently—only the first and the second vector of the vector system of the invention can combine together to a functional endonuclease. The first and the second vector of the vector system of the present invention may be administered to the patient simultaneously or sequentially. Both, the first vector or the second vector could be administered first and the other one second. If the first and the second vector are administered to the patient sequentially, the time delay between the administration of the first and the second vector or the second and the first vector may be at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, of at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours, at least 1 week or at least 2 weeks. The time delay further allows monitoring whether a patient shows any adverse reactions before administering the other vector.
[0115] The subject or patient may be a mammal, preferably a human or a pig, more preferably a human.
[0116] Several modes of administration for the vector system of the invention are known to a person skilled in the art. Exemplary modes of administration include, but are not limited to, systemic, enteral, parenteral, intravenous, intra-arterial, topical, intraperitoneal, intramuscular, intradermal, intrathecal, intravitreal, subcutaneous, transdermal and/or transmucosal administration. Pharmaceutical compositions comprising the vector system of the present invention, the first vector of the invention or the second vector of the invention may be adapted to the route of administration as described herein. Preferably, the vector system of the invention is administered parenterally.
[0117] As shown in Example 2, the first and the second vector can be administered to heart vessels (see also
[0118] The present invention further relates to a vector system as defined herein. Accordingly, the present invention further relates to a vector system comprising (a) a first vector comprising a nucleic acid sequence encoding: (i) a first fragment of an endonuclease, (ii) a first fragment of an intein, and (ii) a first guide RNA (gRNA); and (b) a second vector comprising a nucleic acid sequence encoding: (i) a second fragment of the endonuclease, (ii) a second fragment of the intein, and (ii) a second guide RNA (gRNA); wherein the first gRNA binds to a region, which is located 5′ to a sequence of interest comprised in a nucleic acid sequence in the genome of a target cell, wherein the second gRNA binds to a region located 3′ to a sequence of interest comprised in the nucleic acid sequence in the genome of a target cell; wherein the first fragment and the second fragment of the intein are capable of associating into a functional intein, wherein the functional intein is capable of ligating the first and the second fragment of the endonuclease to form a functional endonuclease; wherein the functional endonuclease is capable of excising the sequence of interest.
[0119] The present invention further relates to a first vector as defined herein. Accordingly, the present invention relates to a first vector comprising a nucleic acid sequence encoding: (i) a first fragment of an endonuclease, (ii) a first fragment of an intein, and (ii) a first guide RNA (gRNA).
[0120] The present invention further relates to a second vector as defined herein. Accordingly, the present invention relates to a second vector comprising a nucleic acid sequence encoding: (i) a second fragment of an endonuclease, (ii) a second fragment of an intein, and (ii) a first guide RNA (gRNA).
[0121] The present invention further relates to a combination of the first vector and the second vector of the invention.
[0122] The present invention further relates to a pharmaceutical composition comprising the vector system of the invention or comprising the combination of the invention. Such a pharmaceutical composition may be manufactured in a manner that is itself known, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
[0123] Pharmaceutical compositions for use in accordance with the present invention thus may be formulated in conventional manner using one or more physiologically acceptable carriers including excipients and auxiliaries that facilitate processing of the active compound or combination into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
[0124] For injection, the agents disclosed herein may be formulated in aqueous solutions, for instance in physiologically compatible buffers such as Hanks's solution, Ringer's solution, or physiological saline buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
[0125] The vector system or combination of the invention may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
[0126] Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compound or combination in water-soluble form. Additionally, a suspension of the active compound or combination may be prepared as an appropriate oily injection suspension. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances that increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
[0127] The pharmaceutical compositions also may include suitable solid or gel phase carriers or excipients. Examples of such carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatine, and polymers such as polyethylene glycols.
[0128] Pharmaceutical compositions suitable for use in the context of the present invention include compositions where the active ingredients are contained in an amount effective to achieve its intended purpose. More specifically, a therapeutically effective amount means an amount of compound effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated. Determination of a therapeutically effective amount is well within the capability of those skilled in the art.
[0129] The present invention further relates to a general method of excising a sequence of interest making use the vector system of the invention. Accordingly, the present invention relates to a method for excising a sequence of interest from the genome, preferably DNA, of a subject, comprising the administration of the vector system of the invention, the combination of the invention or the pharmaceutical composition of the invention and thereby excising the sequence of interest from the genome, preferably DNA, of a subject.
[0130] The present invention is not intended to be used to modify the human germline. Accordingly, in one embodiment of the vector system, the first vector, the second vector, the combination of the first and the second vector, the pharmaceutical composition and the vector system for use of the invention does not modify the human germline.
[0131] It is noted that as used herein, the singular forms “a”, “an”, and “the”, include plural references unless the context clearly indicates otherwise. Thus, for example, reference to “a reagent” includes one or more of such different reagents and reference to “the method” includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0132] Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0133] The term “and/or” wherever used herein includes the meaning of “and”, or and “all or any other combination of the elements connected by said term”.
[0134] The term “less than” or in turn “more than” does not include the concrete number.
[0135] For example, less than 20 means less than the number indicated. Similarly, more than or greater than means more than or greater than the indicated number, e.g. more than 80% means more than or greater than the indicated number of 80%.
[0136] Throughout this specification and the claims which follow, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term “comprising” can be substituted with the term “containing” or “including” or sometimes when used herein with the term “having”. When used herein “consisting of” excludes any element, step, or ingredient not specified.
[0137] The term “including” means “including but not limited to”. “Including” and “including but not limited to” are used interchangeably.
[0138] It should be understood that this invention is not limited to the particular methodology, protocols, material, reagents, and substances, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
[0139] All publications cited throughout the text of this specification (including all patents, patent application, scientific publications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.
[0140] The content of all documents and patent documents cited herein is incorporated by reference in their entirety.
TABLE-US-00002 SEQUENCE LISTING The following sequences are disclosed herein: SEQ ID NO Description Sequence 1 Cas9 from S. MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIK pyogenes KNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNE MAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYP TIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNS DVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLEN LIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKD TYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKA PLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGY AGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIP YYVGPLARGNSRFAWMTRKSEETITPWNFEEWDKGASAQSFI ERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMR KPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLF EDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLING IRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVS GQGDSLHEHIANLAGSPAIKKGILQTVKWDELVKVMGRHKPEN IVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVE NTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQS FLKDDSIDNKVLTRSDKNRGKSDNVPSEEWKKMKNYWRQLLN AKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVA QILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVRE INNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKM IAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNG ETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESIL PKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLWAKVEKGKS KKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYE KLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLD KVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD 2 N-split-Cas9-v1 MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIK (split between 573 KNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNE and 574) MAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYP TIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNS DVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLEN LIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKD TYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKA PLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGY AGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIP YYVGPLARGNSRFAWMTRKSEETITPWNFEEWDKGASAQSFI ERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMR KPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIE 3 N-split-Cas9-v2 MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIK (split between 637 KNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNE and 638) MAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYP TIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNS DVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLEN LIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKD TYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKA PLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGY AGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIP YYVGPLARGNSRFAWMTRKSEETITPWNFEEWDKGASAQSFI ERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMR KPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEI SGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLF EDREMIEERLK 4 C-split-Cas9-v1 CFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDI (split between 573 VLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRL and 574) SRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKED IQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVM GRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDV DHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEWKKMKN YWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETR QITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDF QFYKVREINNYHHAHDAYLNAWGTALIKKYPKLESEFVYGDYK VYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRK RPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTG GFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLWA KVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKK DLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLY LASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVIL ADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYF DTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD 5 C-split-Cas9-v2 TYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTIL (split between 637 DFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHI and 638) ANLAGSPAIKKGILQTVKWDELVKVMGRHKPENIVIEMARENQ TTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKV LTRSDKNRGKSDNVPSEEWKKMKNYWRQLLNAKLITQRKFDN LTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKY DENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDA YLNAWGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGK ATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDK GRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLI ARKKDWDPKKYGGFDSPTVAYSVLWAKVEKGKSKKLKSVKEL LGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENG RKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDN EQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKH RDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL DATLIHQSITGLYETRIDLSQLGGD 6 Intein from N. CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQ punctiforme WHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFE RELDLMRVDNLPNMIKIATRKYLGKQNVYDIGVERDHNFALKNG FIASN 7 NrdJ-1 Intein CLVGSSEIITRNYGKTTIKEWEIFDNDKNIQVLAFNTHTDNIEWA PIKAAQLTRPNAELVELEIDTLHGVKTIRCTPDHPVYTKNRGYVR ADELTDDDELWAIMEAKTYIGKLKSRKIVSNEDTYDIQTSTHNF FANDILVHN 8 Gp41-1 Intein CLDLKTQVQTPQGMKEISNIQVGDLVLSNTGYNEVLNVFPKSKK KSYKITLEDGKEIICSEEHLFPTQTGEMNISGGLKEGMCLYVKE MMLKKILKIEELDERELIDIEVSGNHLFYANDILTHN 9 N-terminal CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQ splicing region of WHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFE N. punctiforme RELDLMRVDNLPN 10 N-terminal CLVGSSEIITRNYGKTTIKEWEIFDNDKNIQVLAFNTHTDNIEWA splicing region of PIKAAQLTRPNAELVELEIDTLHGVKTIRCTPDHPVYTKNRGYVR NrdJ-1 ADELTDDDELWAI 11 N-terminal CLDLKTQVQTPQGMKEISNIQVGDLVLSNTGYNEVLNVFPKSKK splicing region of KSYKITLEDGKEIICSEEHLFPTQTGEMNISGGLKEGMCLYVKE gp41-1 12 C-terminal MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN splicing region of N. punctiforme 13 C-terminal MEAKTYIGKLKSRKIVSNEDTYDIQTSTHNFFANDILVHN splicing region of NrdJ-1 14 C-terminal MMLKKILKIEELDERELIDIEVSGNHLFYANDILTHN splicing region of g41-1 15 SV40 NLS PKKKRKV 16 2xSV40 NLS PKKKRKVEDPKKKRKVD 17 Nucleoplasmin AVKRPAATKKAGQAKKKKLD NLS 18 ELG-13 NLS MSRRRKANPTKLSENAKKLAKEVEN 19 c-Myc NLS PAAKRVKLD 20 TUS protein NLS KLKIKRPVK 21 U6 promoter AAGGTCGGGCAGGAAGAGGGCCTATTTCCCATGATTCCTTC ATATTTGCATATACGATACAAGGCTGTTAGAGAGATAATTAG AATTAATTTGACTGTAAACACAAAGATATTAGTACAAAATACG TGACGTAGAAAGTAATAATTTCTTGGGTAGTTTGCAGTTTTAA AATTATGTTTTAAAATGGACTATCATATGCTTACCGTAACTTG AAAGTATTTCGATTTCTTGGCTTTATATATCTTGTGGAAAGGA CG 22 CHB promoter CGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGC (composed of CCAACGACCCCCGCCCATTGACGTCAATAGTAACGCCAATA CMV enhancer, GGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAA chicken actin core ACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGT promoter, 5′- ACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTG splice site from GCATTGTGCCCAGTACATGACCTTATGGGACTTTCCTACTTG chicken actin and GCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTCGA 3′-splice site from GGTGAGCCCCACGTTCTGCTTCACTCTCCCCATCTCCCCCC minute virus from CCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTT mice (MVM).) TGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGC See e.g. Gray et GCCAGGCGGGGCGGGGCGGGGCGAGGGGCGGGGCGGGG al. (2011). Hum CGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCG Gene Ther. 2011 CGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCG Sep; 22(9): 1143- GCGGCCCTATAAAAAGCGAAGCGCGCGGCGGGCGGGAGTC 1153, hereby GCTGCGACGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCC incorporated by GCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTAC reference. TCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGG CTGTAATTAGCTGAGCAAGAGGTAAGGGTTTAAGGGATGGT TGGTTGGTGGGGTATTAATGTTTAATTACCTGGAGCACCTGC CTGAAATCACTTTTTTTCAGGTTGG 23 Human exon 51 of AACAGGATTGTCTACCAGACATTTTAATTCTAGTACTATGCAT DMD CTTAACCATTACCATAGGCTGACTTACTCTACAGTGTCCAAC ACTATTCATATTAAGATTTATTTAATGACTTTGAAACAGTATTT CATGTCTAAATAGAAAAACTACTAACTCGCATTTTTAAGAAAA TATTGTATCTTGGTTTTTCTTCACTGCTGGCCAGTTTACTAAC AATCTGAAATAAAAAGAAAAAAATATGATAAACTGCTCCCAGT ATAAAATACAGAGCTAAGACAAGAACGTTTCATTGGCTTTGA TTTCCCTAGGGTCCAGCTTCAAATTAATTTACTTCCTATTCAA GGGAATTTTAAATCAGAAAGAAGATCTTATCCCATCTTGTTTT GCCTTTGTTTTTTCTTGAATAAAAAAAAAATAAGTAAAATTTAT TTCCCTGGCAAGGTCTGAAAACTTTTGTTTTCTTTACCACTTC CACAATGTATATGATTGTTACTGAGAAGGCTTATTTAACTTAA GTTACTTGTCCAGGCATGAGAATGAGCAAAATCGTTTTTTAA AAAATTGTTAAATGTATATTAATGAAAAGGTTGAATCTTTTCAT TTTCTACCATGTATTGCTAAACAAAGTATCCACATTGTTAGAA AAAGATATATAATGTCATGAATAAGAGTTTGGCTCAAATTGTT ACTCTTCAATTAAATTTGACTTATTGTTATTGAAATTGGCTCTT TAGCTTGTGTTTCTAATTTTTCTTTTTCTTCTTTTTTCCTTTTTG CAAAAACCCAAAATATTTTAGCTCCTACTCAGACTGTTACTCT GGTGACACAACCTGTGGTTACTAAGGAAACTGCCATCTCCAA ACTAGAAATGCCATCTTCCTTGATGTTGGAGGTACCTGCTCT GGCAGATTTCAACCGGGCTTGGACAGAACTTACCGACTGGC TTTCTCTGCTTGATCAAGTTATAAAATCACAGAGGGTGATGG TGGGTGACCTTGAGGATATCAACGAGATGATCATCAAGCAG AAGGTATGAGAAAAAATGATAAAAGTTGGCAGAAGTTTTTCT TTAAAATGAAGATTTTCCACCAATC 24 Porcine exon 51 GAGAGGAATTCTCTGCCAGCTATTTTTACTCTGGAACTTCAG DMD GTCTTAACCATTACCTTGTGTTCCCTTACACCACAATGTTCAA CACTATTAACATTAATTTAATATTTCTTAAGAGCCTTGAAATG GTGTCTCATTATCCAAGTGGAAAAACTTTACTAGCTCTGATTT TCCAAGAATAATATAGCTTGGGTTTTCTTTACTGCTAGCCACT TTATTATCAGTCTGAAAGAAAAAGAAAAAAAATATATAAACTG CTACCAATATAAAATAAAGAGCAAAGGCAAGAACATTTCATT GGTTTTGATTTCCCTAGAGTCCACTTCCAAAGCAATTTACCT CTTATTCAAGGAAATTGTAAGTTTGAAATAAGATCTTATCCAA TTTTTACTTTTTTCCCCTTGAACAAAAAAAAAAGTAAAACATTC ACCTTATCAAAGTTTGAATACTTTATATTTTTCTTTACCAGTTC AGCAACTGTATAATTGTTATTGAGGGCTTTTTAGGTTAAATTA ATTGCTCACCTATAGGAATAATCAAAATGGTTTTGAAAGATTG TTAAATATGTATTAATGAAAAATTTGAATCTTTGAATTATTCTA CCATGTAGTACTCATGTTTCTAGGAGAAAAACATGTAATGTC ATAAAAAATACTTTGGCTCAAATTGTTGCCCTTTAATTAGTTT TATTGTTATTGAAACTGGCTTCTTAGCTTGTGTTTCTAATTTT CCTTTTTTCTTTTTCCCTTTTTGAAAAAAAAAATTTAGCTACTA GTCAGACTGTTACTCTGGTGACACAACCCACAGTTACCAAG GAAACTGCCATCTCCAAACCAGAAATGCCATCTTCCTTGCTG TTGGAGGTACCTGCTCTGGCAGATTTCAACAGGGCTTGGAC AGAACTTACCGACTGGCTGTCTCTGCTTGATCGAGTTATAAA ATCACAGAGGGTGATGGTGGGTGATCTTGAAGACATCAACG AGATGATCATCAAGCAGAAGGTATGGGGGGAATAAAGATAA GAGCTGG 25 first spacer GAGAGTTCCTAAGGTAGAGAG sequence pig 26 first spacer GATAAAGATAAGAGCTGGCAG sequence human 27 second spacer GTAATTTGAAGCTGGACCCTA sequence pig 28 second spacer GTCTAGGAGAGTAAAGTGAT seguence human 29 sgRNA backbone GTTTAAGAGCTATGCTGGAAACAGCATAGCAAGTTTAAATAA sequence GGCTAGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGG TGCTTTTTTT 30 Sequence from TAGAACAAAAGGTGACAATCTGAATGTATTTGTGTGAAA FIG. 11A 31 Sequence from CTAAAGTAGCCTGCTATGATAAGTTGAAAAAGGGTTTGTA FIG. 11A 32 Sequence from TAGAACAAAAGGTGACAAATAAGTTGAAAAAGGGTTTGTA FIG. 11A 33 oligonucleotide 5′ TAATTTGAAGCTGGACCCTA 34 oligonucleotide 5′ GTCTAGGAGAGTAAAGTGAT
EXAMPLES
[0141] An even better understanding of the present invention and of its advantages will be evident from the following examples, offered for illustrative purposes only. The examples are not intended to limit the scope of the present invention in any way.
Methods
[0142] All animal experiments were approved by the Bavarian Animal Care and Use Committee and conform to the Guide for the Care and Use of Laboratory Animals published by the US National Institutes of Health (NIH Publication No. 85-23, revised 1996, Approved Institution #A5637-01)
DMDΔ52 Animal Generation
[0143] Animals were produced by breeding from a herd comprising heterozygous female DMD.sup.+/− pigs. The breeding herd was established from a single sow with a heterozygous DMD exon 52 deletion (DMDΔ52). Exon 52 of the porcine DMD gene was deleted according to.sup.32. In brief, BAC CH242-9G11 was modified to carry a neomycin selection cassette in place of exon 52; the BAC was nucleofected into a female primary kidney cell line (PKCf) and single cell clones were generated.sup.33. Genomic DNA was isolated from a batch of each cell clone and the copy number of the DMD exon 52 was compared to the copy numbers of two reference loci within the NANOG and the POU5F1 genes for identifying cell clones with a heterozygous DMD exon 52 deletion.sup.34. A total of 258 cell clones was screened and 9 of them had one modified allele as well as an intact one (3.49% efficacy). These cell clones were used in somatic cell nuclear transfer (SCNT) to produce heterozygous DMDΔ52 carrier sows.sup.35. A total of 14 SCNT was performed including DMD.sup.+/− cells and within 3 litters delivered 4 offspring were proven to retain the desired DMD.sup.+/− genotype. One animal was raised and inseminated with wild-type sperm. Male DMD.sup.Y/− offspring were used as experimental animals and female DMD.sup.+/−animals were used to expand the breeding capacity. Genotyping of the offspring was performed by PCR. In total, 73 affected DMD.sup.Y/− pigs were produced by breeding, of which 28 were used in this study.
gRNA Design and Off-Target Analysis
[0144] Specific gRNAs in intron 50 and 51 (listed in below Table 2 were cloned into the N-Cas9_N-Intein_v2 and C-Intein_C-Cas9_v2 vector respectively.sup.37 and transfected into a porcine or human cell line for testing editing efficacy. The gRNA combination showing highest activity has been chosen. Sequences of the spacers chosen for the sgRNAs are listed in Table 2. These spacers are then combined with the backbone sequence of e.g. SEQ ID NO. 29
TABLE-US-00003 TABLE 2 Sequences of spacers comprised in the sgRNAs. SEQ Name Spacer Sequence ID NO Ss_DMD_gRNA_Intron50 5′ GAGAGTTCCTAAGGTAGAGAG 25 Ss_DMD_gRNA_Intron51 5′ GATAAAGATAAGAGCTGGCAG 27 Hs_DMD_gRNA_Intron50 5′ GTAATTTGAAGCTGGACCCTA 26 Hs_DMD_gRNA_Intron51 5′ GTCTAGGAGAGTAAAGTGAT 28
[0145] Potential off-targets have been predicted using the CRISPOR and the CHOPCHOP web tool.sup.51 and ranked according to their CFD and MIT score. The top five predicted off-targets for both the intron 50 and intron 51 gRNA were amplified by PCR using Q5 polymerase (NEB) with standard conditions on genomic DNA from one control pig, two intramuscular treated animals and one systemically injected pig. A total of 400 ng of genomic DNA has been used per reaction. PCR products subsequently were analyzed by deep sequencing.
Sequencing for Off-Target Analysis
[0146] Libraries were sequenced in paired end mode with 100 bases read length in a HiSeq 1500. Data analysis was performed with the Bioconductor package CrispRVariants. For each off target region, the reference sequence shows the gRNAs and PAM sequence marked by a black rectangle and additional 5 nucleotide up- and downstream.
[0147] Position referred to the cut site and type of detected INDELs or INDEL combinations found in a dedicated read were listed at the left. Deletions were marked with ‘-’ and distinct colored symbols indicate the position of insertions. The tables show in the first line the number of sequence reads matching the reference sequence and in the following lines the number of INDELS found in each sample.
Levenshtein Distance of gRNA Around Genomic SNP/INDELs.
[0148] Genome-wide sequencing of human DMDΔ52 iPSCs and an isogenic edited DMDΔ51-52 iPSC clone was achieved using an Illumine HiSeq 1500 sequencer. The reads were sequenced in paired-end mode with a length of 100 nt. SNPs and INDELs in each sample were called using the GATK somatic SNV+INDEL pipeline.sup.47 and filtered for SNPs/INDELs specific to the edited DMDΔ51-52 iPSC clone. In total, 769 SNPs and 88 INDELs were identified. To clarify if these variants represent off-target effects or occurred randomly during the clonal expansion of the edited DMDΔ51-52 iPSCs, a minimal Levenshtein distance analysis was performed. The two guide RNAs were aligned in a sliding window starting 25 bp upstream and ending 25 bp downstream of each variant and the alignment with the smallest difference was determined.
Virus Preparation
[0149] Recombinant adeno-associated viruses of the serotype 9 and 6 were produced with the triple transfection method as described previously.sup.38. Briefly, the packaging cell line HEK 293T was transfected with the vector Cbh-N-Cas9/CRISPR 5-1 or Cbh-C-Cas9/CRISPR 3-1, a plasmid encoding the cap sequences of AAV9 (pigs) and AAV6 (hiPSCs) and rep AAV2 sequences and the helper plasmid delta F6 (Puresyn, Pa.) using PEI Max (Polysciences). After 72 hours, cells were harvested and virus was purified by iodixanol-gradient centrifugation. The virus was further purified by a gravity flow size exclusion purification using Sepharose G100 SF resin (Sigma-Aldrich) in Econopac colums (Biorad). Virus was concentrated in PBS using Amicon Ultra-15 Centrifugal Filter Units (Merck) and stored at 4° C. Viral titer was quantified by ITR-Probe qPCR.
AAV9-Cas9-gE51 Transduction and Follow Up
[0150] For intramuscular transduction, the right side of the animal was treated by injections of 200 μl each (100 μl of each virus subsequently) in 15 injection sites (9× thigh and 6× upper arm) at day 14 after birth. Of each Cas9-intein-half (N-Cas9 and C-Cas9), 2.5×10.sup.13 vg/kg bodyweight were injected in total in 5 animals. At the end of the experiment, tissue was recovered from injected and contralateral muscles and remote organs and analyzed for dystrophin expression.
[0151] For systemic application, 4 weeks old piglets were injected 2×10.sup.13 vg/kg for each, N-Cas9 and C-Cas9 into the ear vein (low dose) or 2×10.sup.14 vg/kg for each strain, totaling e.g. 2×10.sup.15 vg for a 5 kg piglet.
Mortality and Termination of Experiments
[0152] In total, 73 affected DMD.sup.Y/− piglets could be produced in our DMD pig breeding herd, of which 45 newborn pigs died within the first week despite intense nursing and adjuvant feeding and were excluded from further studies. 28 male DMD.sup.Y/− were used in this study. Of these, 3 animals (1 i.m., 1 i.v. animal) were observed for a pre-specified period (69 days and 77 days, respectively) to investigate protein expression. Other DMD pigs were followed until physical deterioration (tachypnea, exhaustion, stridor), triggering termination of the experiment due to animal protection regulation. Alternately, DMD animals succumbed to sudden cardiac death, which occurred at rest (with video documentation in place for all i.v. treated animals) or during individual and veterinarian-accompanied transportation (2 i.m. treated DMD animals and 1 high-dose treated DMD animal), such that transportation of the last 7 DMD animals was performed after intubation under anesthesia with 1 animal was lost before measurements once intubated.
[0153] The investors investigated 4 high dose i.v. treated animals, 3 DMD animals with untreated hearts (2 i.m. and 1 untreated heart) and 3 wildtype siblings of DMD pigs by cardiac catheterization (cf.
Functional Behavior Measurement
[0154] Behavioral observation methods were used according to Martin, P. and Bateson, P. 1995. Measuring Behaviour: An introductory guide. Cambridge University Press. Instantaneous sampling records the state of an individual animal at predetermined time intervals. Animals were observed at every 5th minute for 24 hours. In order to ensure a reliable measurement the second before and after was involved in the evaluation but only the centisecond of the instant was graded. Blue color indicates a lying or sitting posture, orange color indicates action. Gray color indicates no sight to the animal. Continuous recording enabled the observation of total activity and resting periods in 24 hours. Two states (upright and lying posture) were recorded to the second. Frequency and duration of standing and lying postures were evaluated.
Cardiac Catheterization and High-Resolution 3D Mapping
[0155] Pigs were anesthetized and instrumented as previously described.sup.39,40. Briefly, global myocardial function was assessed by pressure-tip catheter placement in the left ventricle (for LV enddiastolic and systolic pressures, dP/dt.sub.max, dP/dt.sub.min) at rest and rapid atrial pacing (150/min), whereas analysis of ejection fraction was performed after LV angiography in anterior-posterior position (yielding slightly smaller control values than a right anterior oblique view).
[0156] The Rhythmia mapping system was used for high-resolution 3D-mapping (Boston Scientific, Natick, Mass.), as described before.sup.41. Bipolar activation maps were created in 3 wildtype hearts, an untreated DMD heart, and 3 high-dose treated hearts (
[0157] Maximal, minimal and mean bipolar electrogram voltage was calculated for each LV-map. Quantification of low voltage scar areas—defined as bipolar voltage <1.3 mV—was done using the paraView open-source, multi-platform data analysis and visualization application (Kitware, Clifton Park, N.Y., USA) (
Tibiotarsal Joint Force Measurements
[0158] The physiology rig was set up as described by Childers et al..sup.42 using a bridge interface and load cell obtained from Phidgets Inc., Calgary, Canada. Anesthetized pigs were placed on the rig in dorsal recumbent position and hoof was strapped to foot pedal with maintaining a 90° angle for the coxofemoral, knee and tibiotarsal joints. Needle electrodes were placed on either side of the common peroneal nerve to stimulate tibiotarsal flexion. Isometric twitches were triggered with individual 150 V, 100 μsec pulses, tetanic contraction was obtained with 1% sec train of pulses at 50 Hz.
Histology
[0159] Fibrosis was detected by Sirius red staining of paraffin-embedded tissues. Pictures were taken at a 20-fold magnification. Fibrosis quantity was determined from 10 independent images each with Image J Software. Dystrophin was detected in frozen tissues with antibodies directed against the C-terminus (Novocastra NCL-DYS2, Wetzlar, Germany). A CD14 antibody (Biorad MCA1218F, Munich, Germany) was used for detection of immunological cells (
[0160] For DGC analysis, all images were recorded from 7 μm sections of muscle tissue frozen in isopentane chilled in liquid nitrogen using identical confocal imaging parameters (Olympus FluoView F1000).
Hydroxyproline Assay
[0161] Hydroxyproline in porcine tissue samples was quantified via Colorimetric Hydroxyproline Assay Kit (ab222941, Abcam, Cambridge, UK). 100 mg of each sample was homogenized in 300 μl and subjected to alkaline lysis at 121° C. for 2 hours. 10 μl of the lysates was assayed as per manufacturer's protocol.
Gel Electrophoresis, Immunoblotting and Preparation of Bands for Mass Spectrometry Analysis
[0162] Muscle tissue sample were homogenized in lysis buffer (125 mm Tris pH 8.8, 40% glycerol, 4% SDS, 0.5 mm PMSF, 100 mm DTT) using an ultrasonic device (46 kJ, Sonoplus GM3200 with BR30 cup booster, Bandelin, Berlin, Germany). Protein concentration was determined using the Pierce 660 nm Protein Assay (Thermo Fisher Scientific, Rockford, Ill., USA). SDS gel electrophoresis was performed using a 4-20% Mini-PROTEAN® TGX™ precast gel (Bio-Rad, Hercules, Calif., USA).sup.32. After separation the gel was Coomassie stained using Roti-Blue (Carl Roth, Karlsruhe, Germany). Immunblotting was performed with a C-terminus dystrophin antibody (Abcam ab15277, Cambridge, UK).
Mass Spectrometry-Based Identification of Dystrophin from Gel Bands
[0163] The Coomassie stained gel slice was excised and de-stained using 50% acetonitrile (ACN) in 50 mM NH.sub.4HCO.sub.3. Proteins were subjected to in-gel digestion. For reduction the gel piece was incubated in 45 mM DTT/50 mM NH4HCO3 for 30 min at 55° C. Alkylation of sulfhydryl (—SH) groups was done by incubation of the gel slice in 100 mM iodoacetamide/50 mM NH4HCO3 at RT in the dark for 30 min. Digestion was carried out using 70 ng LysC (FUJIFILM Wako Chemicals Europe, Neuss, Germany) for 4 h at 37° C. followed by a second digestion step using 70 ng porcine trypsin (Promega, Fitchburg, Wis., USA) overnight. Peptides were extracted using 70% ACN. Prior to mass spectrometry analysis the samples were dried using a SpeedVac vacuum concentrator. The tryptic peptides were separated on an Ultimate 3000 nano-LC system (Thermo Fisher Scientific, MA, USA) and identified on an online coupled Q Exactive HF-X mass spectrometer (Thermo Fisher Scientific). For separation, a 50 cm column was used (Column: PepMap RSLC C18, 75 μm×50 cm, 2 μm particles, Thermo Scientific) and a 160 min gradient from 5% solvent A (0.1% formic acid in water) to 25% solvent B (0.1% formic acid in acetonitrile) followed by a 10 min gradient from 25% to 40% solvent B. For MS measurement a top 15 data dependent CID method was used. MS data were searched using MASCOT V2.6.1 (Matrix Science, London, UK) against the porcine subset of the NCBI refseq database and filtered for an FDR <1%. Data were further validated using Scaffold V4 (Proteome Software, Portland, Oreg.).
Selected Reaction Monitoring (SRM) Analysis
[0164] Sample preparation for selected reaction monitoring was carried out as for the mass spectrometry-based identification of dystrophin described in the chapters before, with the difference that 50 fmol of the synthetic heavy peptides (JPT, Berlin, Germany) were spiked in prior to digestion. SRM runs were performed on a nanoACQUITY UPLC system (Waters, Milford, Mass., USA) coupled to a triple-quadrupole linear ion trap mass spectrometer (QTRAP 5500, AB SCIEX, Framingham, Mass., USA). Tryptic peptides were transferred to a trap column (PepMap100 C18, 5 μm, 300 μm i.d.×5 mm, Thermo Scientific) at a flow rate of 10 μl/min and separated at 280 nl/min on a reversed-phase C18 nano-LC column (ReproSil-Pur 120 C18-AQ, 2.4 μm, 75 μm i.d.×15 cm, Dr. Maisch, Ammerbuch-Entringen, Germany). The following consecutive linear gradients were used: 1-5% B (0.1% formic acid in acetonitrile) in 1 min, 5-35% B in 45 min and 35-85% B in 5 min. For every peptide, three transitions were measured and chromatograms were evaluated using Analyst V 1.5.1. (AB SCIEX, Framingham, Mass., USA).
Holistic Proteome Analysis of Skeletal Muscle Samples:
[0165] Protein concentration of the lysates was adjusted to a concentration of 2.3 μg/μl using 8 M Urea/0.4 M NH4HCO3. 250 μg of total protein was reduced using DTE at a final concentration of 5 mM for 30 min at 37° C. Cysteins were alkylated at room temperature for 30 min in the dark with iodoacetamide (final concentration 15 mM). Proteins were digested for 4 h at 37° C. using 2.5 μg LysC (FUJIFILM Wako Pure Chemicals, Osaka, Japan). The samples were diluted with water to 1 M urea and digested overnight with 5 μg porcine trypsin (Promega, Madison, Wis., USA) at 37° C. 1.5 μg of tryptic peptides were subjected to LC-MS/MS analysis as described above. For protein identification (FDR <1%) and label free quantification, the acquired spectra were analyzed using the MaxQuant software platform (V1.6.1) in combination with the porcine subset of the NCBI refseq database. Hierarchical clustering, principal component analysis and Student's t-test were calculated with Perseus (V 1.5.3.2) part of the MaxQuant proteomics pipeline.sup.45. The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE.sup.46 partner repository with the dataset identifier PXD014893.
hiPSC Reprogramming and Culture
[0166] The DMDΔ52 human iPSC line was reprogrammed with the CytoTune-iPS 2.0 Sendai Reprogramming kit (Invitrogen A16517), as previously described.sup.43, using the peripheral blood mononuclear cells (PBMCs) of a male Duchenne muscular dystrophy patient carrying a deletion of DMD exon 52 leading to a premature stop codon. The healthy hiPSC line was reprogrammed from the PBMCs of a young, male volunteer following the same protocol. All recruitment and consenting procedures were done under institutional review board-approved protocols of both the Klinikum rechts der Isar, Technical University of Munich, and the Klinikum of the Ludwig-Maximilian University, Munich. Written informed consent was obtained from the affected patient and healthy volunteer.
[0167] Pluripotency was assessed after reprogramming via alkaline phosphatase staining (Roche 11681451001), immunofluorescence analysis of the pluripotency markers Nanog and TRA-1-81 (all antibodies listed in Table 3) and qPCR analysis of the pluripotency markers OCT4, SOX2, NANOG, REX1 and TDGF-1, as previously described.sup.22. Germ-layer differentiation potential was tested via spontaneous embryoid body differentiation in DMEM/F12 medium containing 20% FBS, 50 μg/mL L-ascorbic acid (Sigma-Aldrich A5960), 1% L-glutamine, 1% non-essential amino acids and 0.5% Penicillin-Streptomycin for 21 days followed by qPCR analysis of markers of endoderm (SOX7, AFP), mesoderm (CD31, DES, ACTA2, SCL, CDH5) and ectoderm (KRT14, NCAM1, TH, GABRR2) using GAPDH as an endogenous control. Loss of Sendai virus was confirmed after 13 passages via immunofluorescence analysis and RT-PCR of the Sendai vector and viral transgenes OCT4, SOX2, KLF4 and c-MYC using GAPDH as an endogenous control.
[0168] Karyotyping was performed by the Institute of Human Genetics of the Klinikum rechts der Isar, Technical University of Munich. hiPSCs were maintained in mTeSR1 medium (Stemcell Technologies 85850) on Matrigel-coated plates (Corning 354277).
TABLE-US-00004 TABLE 3 Antibodies. Target Host Reference Concentration Nanog Rabbit Abcam ab21624 1:500 (IF) TRA-1-81 Mouse BD Pharmingen 560174 1:20 (IF) Sendai virus Rabbit MBL PD029 1:1000 (IF) Dystrophin Rabbit Abcam ab15277 1:100 (IF), 1:12.5 (Wes) α-actin Mouse Abcam ab3280 .sup. 1:25 (Wes) α-actinin Mouse Sigma-Aldrich A7811 1:250 (IF) Myosin heavy chain β Mouse Chemicon MAB1548 1:50 (IF) Anti-Mouse IgG A488 Goat Invitrogen A32723 1:500 (IF) Anti-Mouse IgG A647 Goat Invitrogen A32728 1:500 (IF) Anti-Rabbit IgG A488 Goat Invitrogen A32731 1:500 (IF)
RNP-Mediated CRISPR/Cas9 Deletion of DMD Exon 51 in DMDΔ52 hiPSCs (DMDΔ51-52 Line)
[0169] For CRISPR/Cas9-mediated deletion of DMD exon 51 in DMDΔ52 hiPSCs, the Alt-R CRISPR-Cas9 system (IDT) was used according to the manufacturer's instructions. Briefly, crRNA oligonucleotides targeting the human DMD exon 51 locus (TAATTTGAAGCTGGACCCTA (SEQ ID NO: 33) and GTCTAGGAGAGTAAAGTGAT (SEQ ID NO: 34)) were purchased from IDT and duplexed with fluorescently labeled tracrRNA (IDT 1075927). The obtained gRNAs (Table 2) were then each used to generate equimolar ribonucleoprotein (RNP) complexes with the S. pyogenes Cas9 protein (IDT 1074181) in Opti-MEM medium (Gibco 31985062). The RNP complexes were then reverse transfected into DMDΔ52 hiPSCs dissociated with TrypLE Express (Gibco 12604013) using Lipofectamine Stem Transfection reagent (Invitrogen STEM00003). A final RNP concentration of 10 nM was applied for 4×10.sup.5 cells per well of a Matrigel-coated 96 well plate. Transfected cells were dissociated into single cells 24 hours after transfection with a 10-minute Accutase treatment (Gibco A1110501) and 1000 cells were seeded into a Matrigel-coated 10 cm plate in mTeSR1 containing 10 μM Y27632 (Calbiochem 688000). mTeSR1 was replaced every day until colonies were large enough to cut in half for clone screening and passaging. Deletion of exon 51 was verified by PCR and Sanger sequencing by Eurofins Genomics. The generated DMDΔ51-52 line was confirmed to have a normal karyotype by the Institute of Human Genetics of the Klinikum rechts der Isar, Technical University of Munich.
hiPSC Muscle Differentiation
[0170] Skeletal muscle differentiation of hiPSCs was induced using a commercially available kit (Amsbio SKM-KITM). Briefly, hiPSCs were dissociated with Accutase on day 0 and seeded into plates coated with 5 μg/cm.sup.2 type I collagen (Cell applications 122-20) at a density of 5000 cells/cm.sup.2 in Skeletal Muscle Induction Medium (Amsbio SKM01). Myogenic precursors were obtained within 6-8 days, at which point the cells were dissociated with TrypLE Express (Gibco 12604013) and replated into type I collagen coated plates at a density of 5000 cells/cm.sup.2 in Skeletal Myoblast Medium (Amsbio SKM02). The cells reached the myoblast stage within 6-8 days, after which the medium was replaced with Myotube Medium (Amsbio SKM03) to induce the formation of skeletal muscle myotubes. After 5 days, the Myotube Medium was replaced with Skeletal Muscle Cell Differentiation Medium containing 2% horse serum (Promocell C-23061; C-39366). Myotubes were maintained in culture a total of 7 or 14 days from the switch to Myotube Medium.
[0171] Differentiation into cardiomyocytes was induced by modulation of Wnt/β-catenin signaling, following a protocol described by Lian and colleagues, with some modifications.sup.44. Briefly, hiPSCs were seeded onto 12-well plates coated with 2 μg/cm.sup.2 fibronectin (Sigma-Aldrich F1141) at a density of 2×10.sup.5 cells/well. Upon reaching 90%, confluence after 3-4 days, cardiac differentiation was induced on day 0 by changing to RPM11640 (Gibco 21875091) with B27 minus insulin (Gibco A1895601) (defined as basal cardiac differentiation medium) supplemented with 6 μM CHIR99021 (Axon Medchem 1386). On day 2, medium was replaced with basal cardiac differentiation medium supplemented with 5 μM IWR1 (Tocris 3132). After maintaining the cells in basal cardiac differentiation medium another 14 days, beating areas were mechanically transferred to fibronectin-coated plates and cultured in DMEM/F-12 (Gibco 11320033) with 2% FBS, 1% non-essential amino acids (Gibco 11140050), 1% Penicillin-Streptomycin-Glutamine (Gibco 10378016) and 0.1 mM β-mercaptoethanol.
AAV-Mediated CRISPR/Cas9 Deletion of DMD Exon 51 in Patient-Derived Muscle Cells
[0172] Skeletal myoblasts and cardiomyocytes derived from DMDΔ52 patient hiPSCs were transduced with a dual AAV system (AAV2/6-Cas9/gE51) carrying the sequences for the split-intein Cas9 protein used in the pig model and two gRNAs targeting the human DMD exon 51 locus (Table 2 and
Immunofluorescence Analysis
[0173] Immunofluorescence staining was performed as previously described.sup.45 using the primary antibodies listed in Table 3 herein. Sample imaging was performed with an inverted or confocal laser scanning microscope (DM16000B and TCS SP8, Leica Microsystems, Wetzlar, Germany).
PCR, RT-PCR and Quantitative Real-Time PCR
[0174] PCR analysis to study genomic editing in DMD pigs was performed on genomic DNA extract from various tissues using the Wizard® Genomic DNA Purification Kit (Promega) and Q5 polymerase (NEB). RT-PCR was performed on Trizol (Invitrogen, #15596-026) or RNeasy Mini Kit (Quiagen) extracted RNA samples from snap frozen tissue. Reverse transcription was performed using random hexamers and SuperScript®-VILO (Invitrogen, #11904-018) according to the manufacturers instructions. Quantitative DMD analysis was performed using genomic DNA from different regions and the ABI PRISM 7900 Sequence Detection System (Applied Biosystems) and TaqMan® reaction mixes for detecting unedited (APKA34W, Applied Biosystems) versus exon 51 deleted DMD (APMFXPU, Applied Biosystems). All samples were measured in triplicates in a 20 μl reaction contained 10 μl of TaqMan® Universal PCR Master Mix (Applied Biosystems), 60 ng of HindIII fragmented gDNA template, 300 nmol/L of each primer and 200 nmol/L of the specific FAM-labeled probe. The fluorescent signal intensities were recorded and analyzed during PCR amplification using the Sequence Detection Software (SDS, Applied Biosystems) software. Following, the ratio of unedited versus edited DMD was determined (2.sup.−[ΔCT_del-ΔCT_WT]). Data was analyzed using Sigma Plot 12.0 (Systat Software, Inc, Chicago, USA) and GraphPad Prism 6.0 (GraphPad Software, La Jolla, USA). Differences between two independent groups were analyzed using the t-test or the Mann-Whitney U test. For comparing more than two groups a two-way ANOVA was performed. For post hoc tests the Holm-Sidak Test was applied. The chosen level of significance was p≤0.05; results with p-values between 0.05 and 0.1 were described as tendencies not reaching statistical significance.
[0175] For analyses in cells, genomic DNA was isolated from cells with the Gentra Puregene kit (Qiagen 158722) and PCR was performed with the Q5 High-Fidelity DNA Polymerase (NEB M0491S). For RT-PCR and Real-time qPCR, total RNA was extracted with the Absolutely Microprep kit (Agilent 400805) and cDNA was produced with the High Capacity cDNA RT kit (Applied Biosystems 4368814). PCR was performed with the FIREPol DNA Polymerase (Solis Biodyne 01-01-00500). Real-time qPCR was performed with a 7500 Fast Real-time PCR system (Applied Biosystems, Germany) using the Power SYBR Green PCR Master Mix (Applied Biosystems 4367659) and primers. Data was analyzed using the 2.sup.−ΔΔCt method with normalization to GAPDH expression.
Capillary Western Immunoassay
[0176] Cells were lysed in RIPA buffer (Sigma-Aldrich R0278) containing proteinase inhibitor (Roche 11836170001) and total protein concentration was determined via Pierce BCA assay (Thermo Fisher 23225). Dystrophin levels were analyzed with the size-based Wes system (ProteinSimple) using an antibody targeting the C-terminus of human dystrophin and an antibody targeting a-actin as a loading control. Samples were loaded at a protein concentration of 0.05 mg/mL or 0.1 mg/mL for hiPSC-derived skeletal myotubes and cardiomyocytes, respectively.
Ex Vivo Myocardial Cultivation
[0177] For ex vivo heart slice cultivation, porcine myocardial tissue was obtained from left mid-ventricular transmural sections and immediately placed in a 30 mM 2,3-butadione-2-monoxime solution (BDM, Sigma-Aldrich B0753) at 4° C. The sections were embedded in 5% agarose and further processed to 300 μm thick tissue slices by vibratome cutting (VT1200S, Leica Biosystems, Germany). Slices were anchored in biomimetic culture chambers via small plastic triangles attached to the slices with tissue adhesive (Histoacryl, B. Braun 69390) according to the fiber direction and immediately subjected to physiological preload of 1 mN and stimulation at 0.5 Hz (50 mA pulse current, 1 ms pulse duration). Before calcium imaging, the slices were maintained for 24 hours in M199 medium (Sigma-Aldrich M4530) supplemented with 1% Penicillin-Streptomycin, 0.5% insulin/transferrin/selene and 50 μM β-mercaptoethanoI on a rocker plate (60 rpm, 15° C. tilt angle) placed in an incubator set at 37° C., 5% CO.sub.2, 20% O.sub.2 and 80% humidity. A continuous readout of contraction force was obtained via the biomimetic chamber.sup.21.
Calcium Imaging
[0178] Myocardial tissue slices were incubated in culture medium containing 3 μM Fluo-4-AM (Thermo Fisher F14201), 0.75% Kolliphor EL (Sigma-Aldrich C5135) and 30 mM 2,3-butadione-2-monoxime (BDM, Sigma-Aldrich B0753) for 60 min at 37° C., then washed and incubated in Tyrode's solution supplemented with Ca2+(135 mM NaCl, 5.4 mM KCl, 1 mM MgCl2, 10 mM glucose, 1.8 mM CaCl.sub.2), and 10 mM HEPES; pH 7.35) containing 30 mM BDM for another 30 min at 37° C. Spontaneous calcium signals from the tissue slices were subsequently imaged using an upright epifluorescence microscope (Zeiss Axio Examiner) equipped with a 40× objective, a GFP filter set, and a Rolera em-c.sup.2 EMCCD camera.
[0179] For calcium imaging in hiPSC-derived cardiomyocytes, two months-old cells were dissociated to single cells using a papain-based protocol described previously.sup.46, Cells were then seeded onto 3.5 cm glass bottom cell culture microdishes (MatTek Corporation P35G-1.5-14-C) coated with 2 μg/cm.sup.2 fibronectin (Sigma-Aldrich F1141) at a density of 5×10.sup.3 cells/cm.sup.2. Ten days after seeding, loading with 2 μM Fluo-4-AM (Thermo Fisher F14201) for 30 min at 37° C., de-esterification of the dye for 30 min at 37° C. and imaging were all performed in Tyrode's solution supplemented with Ca.sup.2+ (135 mM NaCl, 5.4 mM KCl, 1 mM MgCl2, 10 mM glucose, 1.8 mM CaCl.sub.2), and 10 mM HEPES; pH 7.35). The glass bottom microdishes were placed on the stage of an inverted epifluorescence microscope (DM16000B, Leica Microsystems, Wetzlar, Germany), equipped with GFP filter sets, a HCX PL APO 63X/1.4-0.6 oil immersion objective (Leica Microsystems) and a Zyla V sCMOS camera (Andor Technology, Belfast, UK). Field stimulation electrodes (RC-37FS, Warner Instruments, Hamden, Conn., USA) were connected to a stimulus generator (HSE Stimulator P, Hugo Sachs Elektronik, March-Hugstetten, Germany) providing depolarizing pulses (50 V, 5 ms duration) at 1 Hz as indicated.
[0180] Imaging settings (illumination intensity, camera gain, binning) were adjusted to achieve an optimal signal-to-noise ratio while avoiding pixel saturation. Imaging rates were 14 Hz in the tissue slices and 100 Hz in the iPSC-derived cardiomyocytes. ImageJ (National Institutes of Health, Bethesda, Md.) was used to quantify fluorescence over single cells and over background regions. Subsequent analysis was performed in RStudio (RStudio Team (2015). RStudio: Integrated Development for R. RStudio, Inc., Boston, Mass.) using custom-written scripts. After subtraction of background fluorescence, the time course of Fluo-4 fluorescence was expressed either in arbitrary units or normalized to the initial value (F/F.sub.0). After manual selection of the starting points and the peaks of the calcium transients, the transient duration at 90%, decay (TD.sub.90), the rise time and the monoexponential decay time constant A were automatically determined by the script.
Off-Target Analysis
[0181] Potential off-targets with up to four mismatches have been identified using the CRISPOR web tool.sup.36 and ranked according to their CFD and MIT score. The three highest off-targets for both the intron 50 and intron 51 gRNA has been amplified by PCR and sanger sequenced using genomic DNA from a control pig, intramuscular treated animals, different tissues from a systemically injected pig, as well as hDMDΔ52 hiPSCs, hDMDΔ51-52 hiPSCs, and hDMDΔ52 hiPSC-derived myoblasts after infection with AAV2/6-Cas9/gE51.
[0182] Statistical methods
[0183] The results are given as mean±SEM, if not indicated otherwise. Statistical analysis of results between >2 experimental groups was performed with one way analysis of variance ANOVA. Whenever a significant effect was obtained with ANOVA, we performed multiple comparison tests between the groups using the Student Newman Keul's procedure (parametric) or Tukey's test (non-parametric). Two experimental groups were compared by Student's T-Test. For non-parametric testing, the Mann Whitney U test was performed. Kaplan-Meier analysis was used in
Example 1
[0184] The inventors have generated a DMD pig model by replacing DMD exon 52 with a neomycin-resistance cassette.sup.1, resulting in a complete loss of dystrophin expression (
[0185] Since the diaphragm and the heart—two muscles contributing substantially to the mortality of Duchenne patients.sup.16,17—have not been transduced by i.m. limb injection (
[0186] Lack of dystrophin in DMD muscles induces the collapse of the dystrophin-associated glycoprotein complex (DGC). Local i.m. or high-dose i.v. treatment resulted in increased level of membrane-bound amount of β-dystroglycan and γ-sarcoglycan and restoration of the DGC (FIG. 10). Further structural evaluation of skeletal muscles revealed that expression of DMDΔ51-52, which co-localized with the membrane marker wheat germline agglutinin (WGA), significantly reduced occurrence of rounded myofibers with centralized nuclei (
[0187] It is worth mentioning that in the DMDΔ52 animal cohort 61.6% (45/73) of the affected males died within the first week after birth and none survived longer than 105 days. The maximal survival of animals, which received i.v. G2-AAV9-Cas9-gE51-treatment at 4 weeks after birth, increased significantly to 136 days (
[0188] To better evaluate the intrinsic arrhythmogenic vulnerability of DMD cardiomyocytes, we performed ex vivo intracellular Ca.sup.2+ analysis of single cardiomyocytes within 300 μm-thick heart slices maintained in biomimetic chambers (Methods,
[0189] The inventors finally investigated the muscle-specific targeting efficacy of the intein-split Cas9 AAV-mediated approach in human cells (
[0190] When forced to differentiate into skeletal muscle by a transgene-free approach, hDMDΔ52 cells expressed significantly lower levels of skeletal muscle genes (
[0191] In summary, the inventors found that a large animal model of Duchenne muscular dystrophy, displaying disease hallmarks such as muscle weakness, cardiomyopathy and premature death, can be treated by somatic genome editing of the mutated DMDΔ52 gene via AAV9-Cas9-gRNA. Intramuscular therapy provided a robust expression of the internally truncated, but partially functional DMDΔ51-52 in the injected skeletal muscles, with minimal editing of other muscles (such as contralateral muscles, diaphragm and heart) or remote non-muscle organs (liver, lung, and kidney). Pharmacologic testing revealed that systemic application of up to 2×10.sup.14 vp/kg for each of the two AAV9 vectors produced efficient and broad muscle transduction, including diaphragm and heart. This effect was improved by dendrimer viral coating with G2-PAMAMs and allowed using lower virus amounts that do not exceed a recently reported level of toxicity in non-human primates and piglets.sup.25. No intracellular off-target effects were detected at this systemic dose in highly transduced peripheral muscle tissue, as previously demonstrated with the same dose (2×10.sup.14 vp/kg) in a dog model of DMD.sup.15. Although transduction of satellite cells has been demonstrated before in mdx mice.sup.14 expressing a reporter gene under the control of the Pax7 promoter, the inventors got no evidence for such events in pigs with their viral system.
[0192] Using iPSCs, it was possible to model the effects of the human DMDΔ52 mutation and evaluate the efficacy of AAV-Cas9-mediated somatic excision of exon 51 in human muscle cells, which could theoretically reframe about 14% of total DMD mutations.sup.27,28. For the first time, we demonstrate that restoration of dystrophin by genome editing can be achieved at the level of myoblasts as well as cardiomyocytes, with beneficial functional outcomes that are comparable to direct correction in undifferentiated iPSCs.
[0193] The main advantage of systemic application of Cas9-gRNA components using highly myotropic vectors such as AAV9 relies on the widespread and permanent correction of diseased muscle tissues including the heart.
Example 2
[0194] In a further set of experiments, the AAV9-Cas9-gRNA was directly applied to heart vessels. Here, either the coronary artery was injected through an over-the-wire balloon during inflation of the balloon (e.g. blockade of the blood flow), allowing for prolongation of contact time and more efficacious virus transduction. Or a retrograde approach was chosen, where a Swan-Ganz catheter is inserted in the coronary vein accompanying the coronary artery. After balloon inflation selectively in the vein, the blood flow is reversed by gentle increase of blood pressure and the virus solution is injected over 5 min. In each case, the accompanying vessel is occluded by balloon inflation simultaneously, in order to increase contact time and to maximize efficacy (cf.
[0195] As a result, dystrophin expression, assessed by histology, is increased above the levels of systemic infusion 4 weeks after application of the same amount of the same virus agent (G2-AAV9-Cas9-gE51, as a 2-vector intein system) (cf.
[0196] Thus, regional vascular gene editing therapy using AAV9 as vector system may further enhance the transduction efficacy in the heart.
REFERENCES
[0197] 1. Klymiuk, N., et al. Dystrophin-deficient pigs provide new insights into the hierarchy of physiological derangements of dystrophic muscle. Human Molecular Genetics 22, 4368-4382 (2013). [0198] 2. Truong, D. J., et al. Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res 43, 6450-6458 (2015). [0199] 3. Aartsma-Rus, A., Van Deutekom, J. C., Fokkema, I. F., Van Ommen, G. J. & Den Dunnen, J. T. Entries in the Leiden Duchenne muscular dystrophy mutation database: an overview of mutation types and paradoxical cases that confirm the reading-frame rule. Muscle Nerve 34, 135-144 (2006). [0200] 4. White, S., et al. Comprehensive detection of genomic duplications and deletions in the DMD gene, by use of multiplex amplifiable probe hybridization. Am J Hum Genet 71, 365-374 (2002). [0201] 5. Moser, H. Duchenne muscular dystrophy: pathogenetic aspects and genetic prevention. Human genetics 66, 17-40 (1984). [0202] 6. Sharp, P. S., Bye-a-Jee, H. & Wells, D. J. Physiological characterization of muscle strength with variable levels of dystrophin restoration in mdx mice following local antisense therapy. Mol Ther 19, 165-171 (2011). [0203] 7. van Deutekom, J. C., et al. Local Dystrophin Restoration with Antisense Oligonucleotide PRO051. New England Journal of Medicine 357, 2677-2686 (2007). [0204] 8. Goemans, N. M., et al. Systemic Administration of PRO051 in Duchenne's Muscular Dystrophy. New England Journal of Medicine 364, 1513-1522 (2011). [0205] 9. Verhaart, I. E., et al. The Dynamics of Compound, Transcript, and Protein Effects After Treatment With 2OMePS Antisense Oligonucleotides in mdx Mice. Molecular therapy. Nucleic acids 3, e148 (2014). [0206] 10. Bengtsson, N. E., et al. Muscle-specific CRISPR/Cas9 dystrophin gene editing ameliorates pathophysiology in a mouse model for Duchenne muscular dystrophy. Nat Commun 8, 14454 (2017). [0207] 11. E L Refaey, M., et al. In Vivo Genome Editing Restores Dystrophin Expression and Cardiac Function in Dystrophic Mice. Circulation Research (2017). [0208] 12. Long, C., et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-403 (2016). [0209] 13. Nelson, C. E., et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science 351, 403-407 (2016). [0210] 14. Tabebordbar, M., et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science 351, 407-411 (2016). [0211] 15. Amoasii, L., et al. Gene editing restores dystrophin expression in a canine model of Duchenne muscular dystrophy. Science (2018). [0212] 16. Punnoose, A. R., et al. Cardiac Disease Burden and Risk of Mortality in Hospitalized Muscular Dystrophy Patients. Pediatric Cardiology 37, 1290-1296 (2016). [0213] 17. Feingold, B., et al. Management of Cardiac Involvement Associated With Neuromuscular Diseases: A Scientific Statement From the American Heart Association. Circulation 136, e200-e231 (2017). [0214] 18. Vetter, A., et al. Adenoviral vectors coated with PAMAM dendrimer conjugates allow CAR independent virus uptake and targeting to the EGF receptor. Mol Pharm 10, 606-618 (2013). [0215] 19. Zincarelli, C., Soltys, S., Rengo, G. & Rabinowitz, J. E. Analysis of AAV Serotypes 1-9 Mediated Gene Expression and Tropism in Mice After Systemic Injection. Mol Ther 16, 1073-1080 (2008). [0216] 20. Thajudeen, A., et al. Correlation of scar in cardiac MRI and high-resolution contact mapping of left ventricle in a chronic infarct model. Pacing and clinical electrophysiology: PACE 38, 663-674 (2015). [0217] 21. Fischer C, M. H., Fein E, Reiser E, Lu K, Seidel T, Schinner C, Schwarzmayr T, Schramm R, Tomasi R, Husse B, Cao-Ehlker X, Pohl U, Dendorfer A. Long-term functional and structural preservation of precision-cut human myocardium under continuous electromechanical stimulation in vitro. Nat Commun in press (2019). [0218] 22. Moretti, A., et al. Patient-specific induced pluripotent stem-cell models for long-QT syndrome. N Engl J Med 363, 1397-1409 (2010). [0219] 23. Bar, S., et al. A novel product of the Duchenne muscular dystrophy gene which greatly differs from the known isoforms in its structure and tissue distribution. Biochem. J. 272, 557-560 (1990). [0220] 24. Kawaguchi, T., et al. Detection of Dystrophin Dp71 in Human Skeletal Muscle Using an Automated Capillary Western Assay System. Int. J. Mol. Sci. 19(2018). [0221] 25. Hinderer, C., et al. Severe toxicity in nonhuman primates and piglets following high-dose intravenous administration of an AAV vector expressing human SMN. Hum Gene Ther (2018). [0222] 26. Pleger, S. T., et al. Cardiac AAV9-S100A1 gene therapy rescues post-ischemic heart failure in a preclinical large animal model. Sci Transl. Med 3, 92ra64 (2011). [0223] 27. Walter, M. C. & Reilich, P. Recent developments in Duchenne muscular dystrophy: facts and numbers. 8, 681-685 (2017). [0224] 28. Aartsma-Rus, A., et al. Theoretic applicability of antisense-mediated exon skipping for Duchenne muscular dystrophy mutations. Human mutation 30, 293-299 (2009). [0225] 29. Wagner, D. L., et al. High prevalence of Streptococcus pyogenes Cas9-reactive T cells within the adult human population. Nature Medicine (2018). [0226] 30. Chew, W. L., et al. A multifunctional AAV-CRISPR-Cas9 and its host response. Nature Methods 13, 868 (2016). [0227] 31. Zhu, P., et al. CRISPR/Cas9-Mediated Genome Editing Corrects Dystrophin Mutation in Skeletal Muscle Stem Cells in a Mouse Model of Muscle Dystrophy. Molecular therapy. Nucleic acids 7, 31-41 (2017). [0228] 32. Klymiuk, N., et al. Dystrophin-deficient pigs provide new insights into the hierarchy of physiological derangements of dystrophic muscle. Human Molecular Genetics 22, 4368-4382 (2013). [0229] 33. Richter, A., et al. Potential of primary kidney cells for somatic cell nuclear transfer mediated transgenesis in pig. BMC biotechnology 12, 84 (2012). [0230] 34. Klymiuk, N., et al. Sequential targeting of CFTR by BAC vectors generates a novel pig model of cystic fibrosis. Journal of molecular medicine (Berlin, Germany) 90, 597-608 (2012). [0231] 35. Kurome, M., Kessler, B., Wuensch, A., Nagashima, H. & Wolf, E. Nuclear transfer and transgenesis in the pig. Methods Mol Biol 1222, 37-59 (2015). [0232] 36. Concordet, J. P. & Haeussler, M. CRISPOR: intuitive guide selection for CRISPR/Cas9 genome editing experiments and screens. Nucleic acids research 46, W242-W245 (2018). [0233] 37. Truong, D. J., et al. Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic acids research 43, 6450-6458 (2015). [0234] 38. Kupatt, C., et al. Cotransfection of Vascular Endothelial Growth Factor-A and Platelet-Derived Growth Factor-B Via Recombinant Adeno-Associated Virus Resolves Chronic Ischemic Malperfusion: Role of Vessel Maturation. Journal of the American College of Cardiology 56, 414-422 (2010). [0235] 39. Kupatt, C., et al. Endothelial nitric oxide synthase overexpression provides a functionally relevant angiogenic switch in hibernating pig myocardium. Journal of the American College of Cardiology 49, 1575-1584 (2007). [0236] 40. Hinkel, R., et al. Diabetes Mellitus-Induced Microvascular Destabilization in the Myocardium. J Am Coll Cardiol 69, 131-143 (2017). [0237] 41. Pathik, B., et al. New Insights Into an Old Arrhythmia: High-Resolution Mapping Demonstrates Conduction and Substrate Variability in Right Atrial Macro-Re-Entrant Tachycardia. JACC: Clinical Electrophysiology 3, 971-986 (2017). [0238] 42. Childers, M. K., Grange, R. W. & Kornegay, J. N. In vivo canine muscle function assay. Journal of visualized experiments: JoVE (2011). [0239] 43. Gramlich, M., et al. Antisense-mediated exon skipping: a therapeutic strategy for titin-based dilated cardiomyopathy. EMBO molecular medicine (2015). [0240] 44. Lian, X., et al. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/beta-catenin signaling under fully defined conditions. Nature protocols 8, 162-175 (2013). [0241] 45. Dorn, T., et al. Interplay of cell-cell contacts and RhoA/MRTF-A signaling regulates cardiomyocyte identity. EMBO J 37(2018). [0242] 46. Fischer, B., et al. A complete workflow for the differentiation and the dissociation of hiPSC-derived cardiospheres. Stem cell research 32, 65-72 (2018). [0243] 47. Van der Auwera, G. A., et al. From FastQ data to high confidence variant calls: the Genome Analysis Toolkit best practices pipeline. Curr Protoc Bioinformatics 43, 11.10.11-33 (2013).