METHODS AND COMPOSITIONS FOR INDUCING PROTECTIVE IMMUNITY AGAINST A MARBURG VIRUS INFECTION

Abstract

Compositions, vaccines and methods using adenovirus vectors for priming and boosting vaccinations for inducing protective immunity against a Marburg virus infection are described.

Claims

1. A vaccine combination comprising a. a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding a first antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and b. a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding a second antigenic protein of a Marburg virus; wherein one of the compositions is a priming composition and the other composition is a boosting composition.

2. The vaccine combination according to claim 1, wherein the first adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

3. The vaccine combination according to claim 1, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

4. The vaccine combination according to claim 1, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

5. The vaccine combination according to claim 1, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

6. The vaccine combination according to claim 1 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

7. The vaccine combination according to claim 1 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

8. A method of inducing an immune response against a Marburg virus in a subject, the method comprising: a. administering to the subject a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding a first antigenic protein of a Marburg virus; and b. administering to the subject a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding a second antigenic protein of a Marburg virus; wherein steps (a) and (b) are conducted in either order.

9. The method according to claim 8, wherein the first adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

10. The method according to claim 8, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

11. The method according to claim 8, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

12. The method according to claim 8, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

13. The method according to claim 8, wherein step (b) is conducted 1-12 weeks after step (a).

14. A kit comprising: a. a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding a first antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and b. a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding a second antigenic protein of a Marburg virus; wherein one of the compositions is a priming composition and the other composition is a boosting composition.

15. The kit according to claim 14, wherein the first adenovirus vector comprises a nucleic acid encoding a first antigenic protein having the amino acid sequence of SEQ ID NO:3.

16. The kit according to claim 14, wherein the second adenovirus vector comprises a nucleic acid encoding a second antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

17. The kit according to claim 14, wherein the second adenovirus vector comprises a nucleic acid encoding a second antigenic protein having the amino acid sequence of SEQ ID NO: 3.

18. The kit according to claim 14, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

19. The kit according to claim 14, for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

20. The kit according to claim 14, for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

21. A use of the vaccine combination according to claim 1 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

22. A use of the vaccine combination according to claim 1 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0047] The foregoing summary, as well as the following detailed description of the invention, will be better understood when read in conjunction with the appended drawings. It should be noted that the invention is not limited to the precise embodiments shown in the drawings.

[0048] In the drawings: [0049] FIG. 1 shows the Marburg Angola glycoprotein specific humoral immune response (assessed by ELISA) observed from the animal study defined in example 1. [0050] FIG. 2 shows the outcome of a challenge experiment with the MARV Angola wild-type P3 challenge virus, as defined in example 1.

[0051] FIG. 3 shows the Marburg Angola glycoprotein specific humoral immune response (assessed by ELISA) observed from the animal study defined in example 2.

DETAILED DESCRIPTION OF THE INVENTION

[0052] Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the present invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.

[0053] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification. All patents, published patent applications and publications cited herein are incorporated by reference as if set forth fully herein. It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise.

[0054] Unless otherwise indicated, the term at least preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.

[0055] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term comprising can be substituted with the term containing or including or sometimes when used herein with the term having. Any of the aforementioned terms (comprising, containing, including, having), whenever used herein in the context of an aspect or embodiment of the present invention can be substituted with the term consisting of, though less preferred.

[0056] When used herein consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.

[0057] As used herein, the conjunctive term and/or between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by and/or, a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term and/or as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term and/or.

[0058] As used herein, subject means any animal, preferably a mammal, most preferably a human, to whom will be or has been treated by a method according to an embodiment of the invention. The term mammal as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.

[0059] As used herein, the term protective immunity or protective immune response means that the vaccinated subject is able to control an infection with the pathogenic agent against which the vaccination was done. Usually, the subject having developed a protective immune response develops only mild to moderate clinical symptoms or no symptoms at all. Usually, a subject having a protective immune response or protective immunity against a certain agent will not die as a result of the infection with said agent.

[0060] An adenovirus capsid protein refers to a protein on the capsid of an adenovirus (e.g., Ad 26 or Ad 35) that is involved in determining the serotype and/or tropism of a particular adenovirus. Adenoviral capsid proteins typically include the fiber, penton and/or hexon proteins. As used herein a Ad26 capsid protein or a Ad35 capsid protein can be, for example, a chimeric capsid protein that includes at least a part of an Ad26 or Ad35 capsid protein. In certain embodiments, the capsid protein is an entire capsid protein of Ad26 or of Ad35. In certain embodiments, the hexon, penton and fiber are of Ad26 or of Ad35.

[0061] The terms adjuvant and immune stimulant are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune system. In this context, an adjuvant is used to enhance an immune response to the adenovirus vectors of the invention.

[0062] The term corresponding to, when applied to positions of amino acid residues in sequences, means corresponding positions in a plurality of sequences when the sequences are optimally aligned. The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, (e.g., glycoproteins of filovirus and polynucleotides that encode them) refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.

[0063] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.

[0064] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).

[0065] Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschuel et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.

[0066] Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).

[0067] In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.

[0068] A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described below.

[0069] The term substantially similar in the context of the filovirus antigenic proteins of the invention indicates that a polypeptide comprises a sequence with at least 90%, preferably at least 95% sequence identity to the reference sequence over a comparison window of 10-20 amino acids. Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window can comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.

[0070] It is discovered in the present invention that heterologous prime-boost combinations, in particular, Ad26 priming followed by Ad26 or Ad35 boosting, are surprisingly effective in generating protective immune responses against one or more subtypes of Marburg viruses.

Filovirus Antigenic Proteins

[0071] The Ebola viruses, and the genetically-related Marburg virus, are filoviruses associated with outbreaks of highly lethal hemorrhagic fever in humans and primates in North America, Europe, and Africa (Peters, C. J. et al. in: Fields Virology, eds. Fields, B. N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996; Peters, C. J. et al. 1994 Semin Virol 5:147-154).

[0072] Although several subtypes have been defined, the genetic organization of these viruses is similar, each containing seven linearly arrayed genes. Among the viral proteins, the envelope glycoprotein exists in two alternative forms, a 50-70 kilodalton (kDa) secreted protein (sGP) and a 130 kDa transmembrane glycoprotein (GP) generated by RNA editing that mediates viral entry (Peters, C. J. et al. in: Fields Virology, eds. Fields, B. N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996; Sanchez, A. et al. 1996 PNAS USA 93:3602-3607). Other structural gene products include the nucleoprotein (NP), matrix proteins VP24 and VP40, presumed nonstructural proteins VP30 and VP35, and the viral polymerase (reviewed in Peters, C. J. et al. in: Fields Virology, eds. Fields, B. N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996).

[0073] The nucleic acid molecules comprised in the adenovirus vectors can encode structural gene products of any filovirus species, such as subtypes of Zaire (type species, also referred to herein as ZEBOV), Sudan (also referred to herein as SEBOV), Reston, Bundibugyo, and Ivory Coast. There is a single species of Marburgvirus (also referred to herein as MARV) comprising two genetic lineages, the Marburg lineage and Ravn lineage. The Marburg virus according to the present invention can be any isolate or strain of the Marburg marburgvirus species, including but not limited to, the Marburg Popp strain, Ratayczak strain, Ozolin strain, Musoke strain (MARV-Musoke), and Angola strain (MARV-Angola), and the Ravn strain. Preferably, the Marburg virus is at least one of MARV-Musoke and MARV-Angola.

[0074] According to embodiments of the invention, the adenoviral vectors can be used to express antigenic proteins which are proteins comprising an antigenic determinant of a wide variety of filovirus antigens. In a typical and preferred embodiment, the vectors of the invention include nucleic acid encoding the transmembrane form of the viral glycoprotein (GP). In other embodiments, the vectors of the invention can encode the secreted form of the viral glycoprotein (ssGP), or the viral nucleoprotein (NP).

[0075] One of skill will recognize that the nucleic acid molecules encoding the filovirus antigenic protein can be modified, e.g., the nucleic acid molecules set forth herein can be mutated, as long as the modified expressed protein elicits an immune response against a pathogen or disease. Thus, as used herein, the term antigenic protein or filovirus protein refers to a protein that comprises at least one antigenic determinant of a filovirus protein described above. The term encompasses filovirus glycoproteins (i.e., gene products of a filovirus) or filovirus nucleoprotein as well as recombinant proteins that comprise one or more filovirus glycoprotein determinants. The term antigenic proteins also encompasses antigenic proteins that are substantially similar to the naturally occurring antigenic proteins. For example, as used herein, a GP of a filovirus, such as a GP of a Marburg virus, can be the naturally occurring GP. A GP of a filovirus can also be a protein that is substantially similar to a naturally occurring GP of a filovirus and contains at least one antigenic determinant of the naturally occurring GP.

[0076] In some embodiments, the protein can be mutated so that it is less toxic to cells (see e.g., WO/2006/037038) or can be expressed with increased or decreased level in the cells. The present invention also includes vaccines comprising a combination of nucleic acid molecules. For example, and without limitation, nucleic acid molecules encoding GP, ssGP and NP of the Zaire, Sudan, Marburg and Ivory Coast/Ta forest Ebola strains can be combined in any combination, in one vaccine composition.

Adenoviruses

[0077] An adenovirus according to the invention belongs to the family of the Adenoviridae and preferably is one that belongs to the genus Mastadenovirus. It can be a human adenovirus, but also an adenovirus that infects other species, including but not limited to a bovine adenovirus (e.g. bovine adenovirus 3, BAdV3), a canine adenovirus (e.g. CAdV2), a porcine adenovirus (e.g. PAdV3 or 5), or a simian adenovirus (which includes a monkey adenovirus and an ape adenovirus, such as a chimpanzee adenovirus or a gorilla adenovirus). Preferably, the adenovirus is a human adenovirus (HAdV, or AdHu; in the present invention a human adenovirus is meant if referred to Ad without indication of species, e.g. the brief notation Ad5 means the same as HAdV5, which is human adenovirus serotype 5), or a simian adenovirus such as chimpanzee or gorilla adenovirus (ChAd, AdCh, or SAdV).

[0078] Most advanced studies have been performed using human adenoviruses, and human adenoviruses are preferred according to certain aspects of the invention. In certain preferred embodiments, the recombinant adenovirus according to the invention is based upon a human adenovirus. In preferred embodiments, the recombinant adenovirus is based upon a human adenovirus serotype 5, 11, 26, 34, 35, 48, 49 or 50. According to a particularly preferred embodiment of the invention, an adenovirus is a human adenovirus of one of the serotypes 26 or 35.

[0079] An advantage of these serotypes is a low seroprevalence and/or low pre-existing neutralizing antibody titers in the human population. Preparation of rAd26 vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63, both of which are incorporated by reference herein in their entirety. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of WO 2007/104792. Preparation of rAd35 vectors is described, for example, in U.S. Pat. No. 7,270,811, in WO 00/70071, and in Vogels et al., (2003) J Virol 77(15): 8263-71, all of which are incorporated by reference herein in their entirety. Exemplary genome sequences of Ad35 are found in GenBank Accession AC 000019 and in FIG. 6 of WO 00/70071.

[0080] Simian adenoviruses generally also have a low seroprevalence and/or low pre-existing neutralizing antibody titers in the human population, and a significant amount of work has been reported using chimpanzee adenovirus vectors (e.g. U.S. Pat. No. 6,083,716; WO 2005/071093; WO 2010/086189; WO 2010085984; Farina et al, 2001, J Virol 75: 11603-13; Cohen et al, 2002, J Gen Virol 83: 151-55; Kobinger et al, 2006, Virology 346: 394-401; Tatsis et al., 2007, Molecular Therapy 15: 608-17; see also review by Bangari and Mittal, 2006, Vaccine 24: 849-62; and review by Lasaro and Ertl, 2009, Mol Ther 17: 1333-39). Hence, in other preferred embodiments, the recombinant adenovirus according to the invention is based upon a simian adenovirus, e.g. a chimpanzee adenovirus. In certain embodiments, the recombinant adenovirus is based upon simian adenovirus type 1, 7, 8, 21, 22, 23, 24, 25, 26, 27.1, 28.1, 29, 30, 31.1, 32, 33, 34, 35.1, 36, 37.2, 39, 40.1, 41.1, 42.1, 43, 44, 45, 46, 48, 49, 50 or SA7P.

Adenoviral Vectors rAd26 and rAd35

[0081] In a preferred embodiment according to the present invention the adenoviral vectors comprise capsid proteins from two rare serotypes: Ad26 and Ad35. In the typical embodiment, the vector is an rAd26 or rAd35 virus.

[0082] Thus, the vectors that can be used in the invention comprise an Ad26 or Ad35 capsid protein (e.g., a fiber, penton or hexon protein). One of skill will recognize that it is not necessary that an entire Ad26 or Ad35 capsid protein be used in the vectors of the invention. Thus, chimeric capsid proteins that include at least a part of an Ad26 or Ad35 capsid protein can be used in the vectors of the invention. The vectors of the invention can also comprise capsid proteins in which the fiber, penton, and hexon proteins are each derived from a different serotype, so long as at least one capsid protein is derived from Ad26 or Ad35. In preferred embodiments, the fiber, penton and hexon proteins are each derived from Ad26 or each from Ad35.

[0083] One of skill will recognize that elements derived from multiple serotypes can be combined in a single recombinant adenovirus vector. Thus, a chimeric adenovirus that combines desirable properties from different serotypes can be produced. Thus, in some embodiments, a chimeric adenovirus of the invention could combine the absence of pre-existing immunity of the Ad26 and Ad35 serotypes with characteristics such as temperature stability, assembly, anchoring, production yield, redirected or improved infection, stability of the DNA in the target cell, and the like.

[0084] In certain embodiments the recombinant adenovirus vector useful in the invention is derived mainly or entirely from Ad35 or from Ad26 (i.e., the vector is rAd35 or rAd26). In some embodiments, the adenovirus is replication deficient, e.g. because it contains a deletion in the E1 region of the genome. For the adenoviruses of the invention, being derived from Ad26 or Ad35, it is typical to exchange the E4-orf6 coding sequence of the adenovirus with the E4-or f6 of an adenovirus of human subgroup C such as Ad5. This allows propagation of such adenoviruses in well-known complementing cell lines that express the E1 genes of Ad5, such as for example 293 cells, PER.C6 cells, and the like (see, e.g. Havenga et al, 2006, J Gen Virol 87: 2135-43; WO 03/104467). In certain embodiments, the adenovirus is a human adenovirus of serotype 35, with a deletion in the E1region into which the nucleic acid encoding the antigen has been cloned, and with an E4 orf6 region of AdS. In certain embodiments, the adenovirus is a human adenovirus of serotype 26, with a deletion in the E1 region into which the nucleic acid encoding the antigen has been cloned, and with an E4 orf6 region of AdS. For the Ad35 adenovirus, it is typical to retain the 3 end of the E1B 55K open reading frame in the adenovirus, for instance the 166 bp directly upstream of the pIX open reading frame or a fragment comprising this such as a 243 bp fragment directly upstream of the pIX start codon, marked at the 5 end by a Bsu36I restriction site, since this increases the stability of the adenovirus because the promoter of the pIX gene is partly residing in this area (see, e.g. Havenga et al, 2006, supra; WO 2004/001032).

[0085] The preparation of recombinant adenoviral vectors is well known in the art. Preparation of rAd26 vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of WO 2007/104792. Preparation of rAd35 vectors is described, for example, in U.S. Pat. No. 7,270,811 and in Vogels et al., (2003) J Virol 77(15): 8263-71. An exemplary genome sequence of Ad35 is found in GenBank Accession AC_000019.

[0086] In an embodiment of the present invention, the vectors useful for the present invention include those described in WO2012/082918, the disclosure of which is incorporated herein by reference in its entirety.

[0087] Typically, a vector useful in the invention is produced using a nucleic acid comprising the entire recombinant adenoviral genome (e.g., a plasmid, cosmid, or baculovirus vector). Thus, the invention also provides isolated nucleic acid molecules that encode the adenoviral vectors of the invention. The nucleic acid molecules of the invention can be in the form of RNA or in the form of DNA obtained by cloning or produced synthetically. The DNA can be double-stranded or single-stranded.

[0088] The adenovirus vectors useful the invention are typically replication defective. In these embodiments, the virus is rendered replication-defective by deletion or inactivation of regions critical to replication of the virus, such as the E1 region. The regions can be substantially deleted or inactivated by, for example, inserting the gene of interest (usually linked to a promoter). In some embodiments, the vectors of the invention can contain deletions in other regions, such as the E2, E3 or E4 regions or insertions of heterologous genes linked to a promoter. For E2- and/or E4-mutated adenoviruses, generally E2- and/or E4-complementing cell lines are used to generate recombinant adenoviruses. Mutations in the E3 region of the adenovirus need not be complemented by the cell line, since E3 is not required for replication.

[0089] A packaging cell line is typically used to produce sufficient amount of adenovirus vectors of the invention. A packaging cell is a cell that comprises those genes that have been deleted or inactivated in a replication-defective vector, thus allowing the virus to replicate in the cell. Suitable cell lines include, for example, PER.C6, 911, 293, and E1 A549.

[0090] As noted above, a wide variety of filovirus glycoproteins can be expressed in the vectors. If required, the heterologous gene encoding the filovirus glycoproteins can be codon-optimized to ensure proper expression in the treated host (e.g., human). Codon-optimization is a technology widely applied in the art. Typically, the heterologous gene is cloned into the E1 and/or the E3 region of the adenoviral genome.

[0091] The heterologous filovirus gene can be under the control of (i.e., operably linked to) an adenovirus-derived promoter (e.g., the Major Late Promoter) or can be under the control of a heterologous promoter. Examples of suitable heterologous promoters include the CMV promoter and the RSV promoter. Preferably, the promoter is located upstream of the heterologous gene of interest within an expression cassette.

[0092] In a preferred embodiment of the present invention, the rAd vector comprises the GP of a Marburg virus (MARV) or GPs substantially similar thereto.

Immunogenic Compositions

[0093] Immunogenic compositions are compositions comprising an immunologically effective amount of purified or partially purified adenovirus vectors for use in the invention. The vector comprises a nucleic acid encoding an antigenic protein of a Marburg virus. The antigenic protein of a Marburg virus encoded by the adenovirus in the first composition can be the same or different antigenic protein of a Marburg that is encoded by the adenovirus in the first composition. The adenovirus in the first composition and the adenovirus in the second composition can be identical or different.

[0094] In one embodiment of the invention, the adenovirus vector in the first composition comprises a nucleic acid encoding a GP from a Marburg virus, such as the GP of MARV-Angola (e.g., that having the amino acid sequence of SEQ ID NO:3), or MARV- Musoke (e.g., that having the amino acid sequence of SEQ ID NO:4), and the adenovirus vector in the second composition comprises a nucleic acid encoding the same GP from the Marburg virus.

[0095] In another embodiment of the invention, the adenovirus vector comprises a nucleic acid encoding a GP from one isolate of Marburg virus, such as the GP of MARV-Angola (e.g., that having the amino acid sequence of SEQ ID NO:3), and the adenovirus vector in the second composition comprises a nucleic acid encoding a GP from a different isolate of Marburg virus, such as the GP of MARV-Musoke (e.g., that having the amino acid sequence of SEQ ID NO:4), or vice versa.

[0096] Said compositions can be formulated as a vaccine (also referred to as an immunogenic composition) according to methods well known in the art. Such compositions can include adjuvants to enhance immune responses. The optimal ratios of each component in the formulation can be determined by techniques well known to those skilled in the art in view of the present disclosure.

[0097] The preparation and use of immunogenic compositions are well known to those of skill in the art. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can be included.

[0098] In addition to adenovirus vectors comprising a nucleic acid encoding an antigenic protein of a Marburg virus, the compositions of the invention can comprise other filovirus antigen(s) or nucleic acid encoding other filovirus antigen(s), or the priming or boosting inoculations can comprise other filovirus antigens or nucleic acid encoding other filovirus antigen(s). The other antigens and nucleic acids expressing the other antigens can be, for example, from one or more additional filovirus subtypes, such as Ebola. The nucleic acid encoding the other filovirus antigen(s) can be included in the same adenovirus vectors that encode the antigenic protein of a Marburg virus. They can also be present on other vectors in the compositions or the priming or boosting inoculations.

[0099] The immunogenic compositions useful in the invention can comprise adjuvants.

[0100] Adjuvants suitable for co-administration in accordance with the present invention should be ones that are potentially safe, well tolerated and effective in people including QS-21, Detox-PC, MPL-SE, MoGM-CSF, TiterMax-G, CRL-1005, GERBU, TERamide, PSC97B, Adjumer, PG-026,GSK-I, GcMAF, B-alethine, MPC-026, Adjuvax, CpG ODN, Betafectin, Alum, and MF59.

[0101] Other adjuvants that can be administered include lectins, growth factors, cytokines and lymphokines such as alpha-interferon, gamma interferon, platelet derived growth factor (PDGF), granulocyte-colony stimulating factor (gCSF), granulocyte macrophage colony stimulating factor (gMCSF), tumor necrosis factor (TNF), epidermal growth factor (EGF), IL-I, IL-2, IL-4, IL-6, IL-8, IL-IO, and IL-12 or encoding nucleic acids therefore.

[0102] The compositions of the invention can comprise a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material can depend on the route of administration, e.g., intramuscular, subcutaneous, oral, intravenous, cutaneous, intramucosal (e.g., gut), intranasal or intraperitoneal routes.

Method for Inducing Protective Immunity Against a Marburg Virus Infection

[0103] The present invention provides a method of priming and boosting an immune response to a Marburg virus in an individual using one or more adenoviral vectors for priming and boosting administrations.

[0104] According to one general aspect of the present invention, a method of inducing an immune response against a Marburg virus in a subject comprises: [0105] a. administering to the subject a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus; and [0106] b. administering to the subject a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus,

[0107] wherein steps (a) and (b) are conducted in either order. In a preferred embodiment the later step is conducted 1-12 weeks after the first step. In a more preferred embodiment the later step is conducted 4 or 8 weeks after the first step.

[0108] In one embodiment of the disclosed methods, a first adenovirus vector is used to prime the immune response, and a second adenovirus vector is used to boost the immune response about 1-12 weeks after the priming vaccination. Boosting compositions are generally administered weeks or months after administration of the priming composition, for example, about 1 or 2 weeks or 3 weeks, or 4 weeks, or 6 weeks, or 8 weeks, or 12 weeks, or 16 weeks, or 20 weeks, or 24 weeks, or 28 weeks, or 32 weeks or one to two years after administration of the priming composition. The first and second adenovirus vectors can be identical or different. The vectors can encode the same antigenic proteins or different antigenic proteins of the same or different Marburg virus.

[0109] In a preferred embodiment of the present invention, the adenovirus vectors disclosed herein include a rAd26 or rAd35 vector. In one exemplary embodiment, an rAd26 vector is used to prime the immune response, and an rAd35 vector is used to boost the immune response, or vice versa. In another exemplary embodiment, an rAd26 vector is used to prime the immune response, and the rAd26 vector is used to boost the immune response. In yet another exemplary embodiment, an rAd35 vector is used to prime the immune response, and an rAd26 vector is used to boost the immune response. In yet another exemplary embodiment, an rAd35 vector is used to prime the immune response, and the rAd35 vector is used to boost the immune response.

[0110] In a more preferred embodiment according to this method, an rAd26 vector is used for the priming followed by a boosting with an rAd26 vector. Preferably, the boosting composition is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming. In a preferred embodiment, the boosting composition is administered 8 weeks after priming. In another preferred embodiment, the boosting composition is administered 4 weeks after priming.

[0111] In a more preferred embodiment according to this method, an rAd26 vector is used for the priming followed by a boosting with a rAd35 vector. Preferably, the boosting composition is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming. In a preferred embodiment, the boosting composition is administered 8 weeks after priming. In another preferred embodiment, the boosting composition is administered 1 week after priming. In another preferred embodiment, the boosting composition is administered 2 weeks after priming. In another preferred embodiment, the boosting composition is administered 4 weeks after priming.

[0112] The present invention is also related to methods of inducing immune responses against a Marburg virus by priming and boosting the immune responses, with the same adenovirus vector or a combination of different adenovirus vectors.

[0113] According to another aspect of the present invention, a method of inducing an immune response against a Marburg virus in a subject comprises: [0114] a. administering to the subject an immunologically effective amount of a rAd26 or rAd35 vector comprising nucleic acids encoding a glycoprotein of a Marburg virus; and [0115] b. administering to the subject an immunologically effective amount of one or more of rAd26 or rAd35 vectors comprising a plurality of nucleic acids encoding glycoproteins of one or more Marburg virus isolates, optionally also encoding NPs of one or more Marburg virus isolates,
wherein steps (a) and (b) are conducted in either order, with one of steps being used to prime the immune response, and the other being used to boost the immune response, or vice versa.

[0116] Preferably, the boosting inoculation is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming.

[0117] The antigens in the respective priming and boosting compositions (however many boosting compositions are employed) need not be identical, but should share antigenic determinants or be substantially similar to each other.

[0118] Administration of the immunogenic compositions comprising the vectors is typically intramuscular or subcutaneous. However other modes of administration such as intravenous, cutaneous, intradermal or nasal can be envisaged as well. Intramuscular administration of the immunogenic compositions can be achieved by using a needle to inject a suspension of the adenovirus vector. An alternative is the use of a needleless injection device to administer the composition (using, e.g., Biojector() or a freeze-dried powder containing the vaccine.

[0119] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the vector will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives can be included, as required. A slow-release formulation can also be employed. Typically, administration will have a prophylactic aim to generate an immune response against a Filovirus antigen before infection or development of symptoms. Diseases and disorders that can be treated or prevented in accordance with the present invention include those in which an immune response can play a protective or therapeutic role. In other embodiments, the adenovirus vectors in the first and second compositions can be administered for post-exposure prophylactics.

[0120] The immunogenic compositions containing the adenovirus vectors are administered to a subject, giving rise to an anti-Marburg virus immune response in the subject. An amount of a composition sufficient to induce a detectable immune response is defined to be an immunologically effective dose. As shown below, the immunogenic compositions of the invention induce a humoral as well as a cell-mediated immune response. In a typical embodiment the immune response is a protective immune response.

[0121] The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g., decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, or in a veterinary context a veterinarian, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. ed., 1980.

[0122] Following production of adenovirus vectors and optional formulation of such particles into compositions, the vectors can be administered to an individual, particularly human or other primate. Administration can be to humans, or another mammal, e.g., mouse, rat, hamster, guinea pig, rabbit, sheep, goat, pig, horse, cow, donkey, monkey, dog or cat. Delivery to a non-human mammal need not be for a therapeutic purpose, but can be for use in an experimental context, for instance in investigation of mechanisms of immune responses to the adenovirus vectors.

[0123] In one exemplary regimen, the adenovirus vector is administered (e.g., intramuscularly) in a volume ranging between about 100 l to about 10 ml containing concentrations of about 10.sup.4 to 10.sup.12 virus particles/ml. Preferably, the adenovirus vector is administered in a volume ranging between 0.25 and 1.0 ml. More preferably the adenovirus vector is administered in a volume of 0.5 ml.

[0124] Typically, the adenovirus is administered in an amount of about 10.sup.9 to about 10.sup.12 viral particles (vp) to a human subject during one administration, more typically in an amount of about 10.sup.10 to about 10.sup.12 vp. In a preferred embodiment, the adenovirus vector is administered in an amount of about 110.sup.12 vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 510.sup.10 vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 0.810.sup.10 vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 210.sup.10 vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 410.sup.10 vp. The human adenovirus vector can be administered in a concentration of about 10.sup.7 vp/ml, 10.sup.8 vp/ml, 10.sup.9 vp/ml, 10.sup.10 vp/ml, 510.sup.10 vp/ml, 10.sup.11 vp/ml, or 10.sup.12 vp/ml.

[0125] The composition can, if desired, be presented in a kit, pack or dispenser, which can contain one or more unit dosage forms containing the active ingredient. The kit, for example, can comprise metal or plastic foil, such as a blister pack. The kit, pack, or dispenser can be accompanied by instructions for administration.

[0126] The invention provides also the following non-limiting embodiments: [0127] 1. A vaccine combination comprising: [0128] a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and [0129] (ii) a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier;
wherein one of the compositions is a priming composition and the other composition is a boosting composition. [0130] 2. The vaccine combination according to embodiment 1, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus. [0131] 3. The vaccine combination according to embodiment 2, wherein the first Marburg virus and the second Marburg virus are identical. [0132] 4. The vaccine combination according to embodiment 2, wherein the first Marburg virus and the second Marburg virus are different. [0133] 5. The vaccine combination according to any of embodiments 1-4, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0134] 6. The vaccine combination according to any of embodiments 1-5, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3. [0135] 7. The vaccine combination according to any of embodiments 1-5, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4. [0136] 8. The vaccine combination according to any one of embodiments 1-7, wherein the adenovirus vectors are rAd26 or rAd35 vectors. [0137] 9. A vaccine combination comprising: [0138] (i) a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, together with a pharmaceutically acceptable carrier; and [0139] (ii) a second composition comprising an immunologically effective amount of an rAd26 or rAd35 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4, together with a pharmaceutically acceptable carrier, together with a pharmaceutically acceptable carrier;
wherein the first compositions is a priming composition and the second composition is a boosting composition. [0140] 10. The vaccine combination according to embodiment 9, wherein the rAd26 or rAd35 vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4. [0141] 11. The vaccine combination according to embodiment 9, wherein the rAd26 or rAd35 vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0142] 12. The vaccine combination according to any of embodiments 9-11, wherein composition (ii) comprises an rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0143] 13. A vaccine combination according to any one of embodiments 1-12 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response. [0144] 14. A vaccine combination according to any one of embodiments 1-12 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response. [0145] 15. A method of inducing an immune response against a Marburg virus in a subject, the method comprising: [0146] a. administering to the subject a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus; and [0147] b. administering to the subject a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus.
wherein steps (a) and (b) are conducted in either order. [0148] 16. The method according to embodiment 15, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus. [0149] 17. The method according to embodiment 16, wherein the first Marburg virus and the second Marburg virus are identical. [0150] 18. The method according to embodiment 16, wherein the first Marburg virus and the second Marburg virus are different. [0151] 19. The method according to any of embodiments 15-18, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0152] 20. The method according to any of embodiments 15-19, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3. [0153] 21. The method according to any of embodiments 15-19, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4. [0154] 22. The method according to any one of embodiments 15-21, wherein the adenovirus vectors are rAd26 or rAd35 vectors. [0155] 23. The method according to any one of embodiments 15-22, wherein the adenovirus vectors are rAd26 vector. [0156] 24. The method according to any one of embodiments 15-23, wherein step (b) is conducted 1-12 weeks after step (a). [0157] 25. A method of inducing an immune response against a Marburg virus in a subject, the method comprising: [0158] a. administering to the subject a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3; and [0159] b. administering to the subject a second composition comprising an immunologically effective amount of an rAd26 or rAd3 5 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4.
wherein step (b) is conducted 1-12 weeks after step (a). [0160] 26. The method according to embodiment 25, wherein the rAd26 or rAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4. [0161] 27. The method according to embodiment 25, wherein the second composition comprises rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4. [0162] 28. The method according to embodiment 25, wherein the rAd26 or rAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0163] 29. The method according to embodiment 25, wherein the second composition comprises rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0164] 30. A kit comprising: [0165] a. a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and [0166] b. a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier;
wherein one of the compositions is a priming composition and the other composition is a boosting composition. [0167] 31. The kit according to embodiment 30, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the second adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus. [0168] 32. The kit according to embodiment 31, wherein the first Marburg virus and the second Marburg virus are identical. [0169] 33. The kit according to embodiment 31, wherein the first Marburg virus and the second Marburg virus are different. [0170] 34. The kit according to any of embodiments 30-33, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3. [0171] 35. The kit according to any of embodiments 30-34, wherein the second adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3. [0172] 36. The kit according to any of embodiments 30-34, wherein the second adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4. [0173] 37. The kit according to any one of embodiments 30-36, wherein the adenovirus vectors are rAd26 or rAd35 vectors. [0174] 38. A kit comprising: [0175] (i) a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, together with a pharmaceutically acceptable carrier; and [0176] (ii) a second composition comprising an immunologically effective amount of an rAd26 or aAd35 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4, together with a pharmaceutically acceptable carrier, together with a pharmaceutically acceptable carrier;
wherein the first compositions is a priming composition and the second composition is a boosting composition. [0177] 39. The kit according to embodiment 38, wherein the rAd26 or aAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4. [0178] 40. The kit according to embodiment 38 or 39, wherein the rAd26 or aAd35 vector in the second composition comprises a nucleic acid encoding antigenic proteins having the amino acid sequences of SEQ ID NO: 3. [0179] 41. The kit according to embodiment 38 or 39, wherein the second composition comprises an rAd26 vector having a nucleic acid encoding antigenic proteins having the amino acid sequences of SEQ ID NO: 3. [0180] 42. The kit according to any one of embodiments 30-41 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response. [0181] 43. The kit according to any one of embodiments 30-41 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response. [0182] 44. A use of a vaccine combination according to any one of embodiments 1-12 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response. [0183] 45. A use of a vaccine combination according to any one of embodiments 1-12 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response. [0184] 46. A use of a kit according to any one of embodiments 30-41 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response. [0185] 47. A use of a kit according to any one of embodiments 30-41 for manufacturing a pharmaceutical composition or medicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

[0186] The compositions of the invention can be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.

EXAMPLES

[0187] The following examples are offered to illustrate, but not to limit the claimed invention.

Example 1

[0188] A study was performed to assess the immunogenicity and protective efficacy of a homologous prime-boost regimen with a 4 week interval between prime and boost, in Cynomolgus macaques (Macaca fascicularis) (NHPs). The regimen consisted of a trivalent Ad26 vaccine (Ad26.Filo, containing Ad26.MARVA, Ad26.ZEBOV and Ad26.SUDV) as a prime and the same trivalent Ad26 vaccine was administered 4 weeks later as a boost. All immunizations were performed intramuscularly.

Vaccine Materials

[0189] The recombinant Ad26 vectors expressed EBOV Mayinga GP (SEQ ID NO:1), SUDV Gulu GP (SEQ ID NO:2) and MARV Angola GP (SEQ ID NO:3). Each rAd26 vector expressed one single antigenic protein (GP). The trivalent composition was made of 410.sup.10 vector particles (vp) of each vector, for a total of 1.210.sup.11 vp. In this study 5 NHP were included that were divided over 2 experimental groups (Table 1).

TABLE-US-00001 TABLE 1 Experimental Grouping of Protection Study in Non- human Primates Challenged With aerosolized MARV Prime Boost Total Number Group (Week 0) (Week 4) dose/imm of NHP A Buffer Ad26.empty 1.2 10.sup.11vp 2 B Ad26.ZEBOV Ad26.ZEBOV 1.2 10.sup.11vp 3 Ad26.SUDV Ad26.SUDV (4 10.sup.10vp Ad26.MARVA Ad26.MARVA each) Abbreviations: vp: viral particles.

Immunogenicity

[0190] Immune response was assessed using a MARV GP-specific Enzyme Linked Immunosorbent Assay (ELISA) on serum samples taken at 3 and 4 weeks post prime and 2 and 3 week post boost. This ELISA, performed at Texas Biomed Research Institute, uses lectin coated plates to capture a recombinant MARV Angola GP from crude supernatant. As expected, no antibody response was observed in NHP immunized with the control vector (FIG. 1, triangles). The prime-immunization with the trivalent Ad26.Filo vectors induced a MARV GP specific antibody response in all animals (FIG. 1, circles) as shown in FIG. 1. The boost effect was noticeable in 2/3 animals for MARVA GP.

Protective Efficacy

[0191] All animals were challenged 4 weeks after the last immunization with a target of 1000 pfu of MARV Angola wild-type P3 challenge virus via the intramuscular route in a Biosafety Level 4 containment unit. Negative controls (group A) succumbed to the infection by day 9 post-challenge, in line with historical controls. Animals immunized with homologous Ad26 prime/boost immunization survived until the end of the experiment (group B, FIG. 2B) and had very limited signs of disease as evidenced by low clinical scores (FIG. 2A)

Example 2

[0192] The immunogenicity of the monovalent Ad26.MARVA homologous prime boost was confirmed in a separate experiment, in which 5 NHP were immunized with Ad26.MARVA at 110.sup.11 vp on day 0 and boosted with the same vaccine dose on day 56. In this study, MARV GP specific immune response was determined at 4 and 8 weeks post prime, and at 3 and 5 weeks post boost using a MARV GP-specific ELISA. This ELISA was performed at Battelle Biomedical Research Center using purified recombinant MARV Angola GP directly coated on the ELISA plate. In line with the immunogenicity data from FIG. 1 (Example 1), a MARV GP-specific Antibody response was induced in all animals (5/5) primed with Ad26.MARVA, but not in negative control animals, which were immunized with saline. The response could be boosted in all animals receiving a second dose of Ad26.MARVA (FIG. 3).

Example 3

[0193] A study will be performed to assess the immunogenicity and protective efficacy of a homologous prime-boost regimens at 0-8 week intervals in Cynomolgus macaques (Macaca fascicularis) (NHPs). The regimen will comprised a monovalent Ad26.MARVA vaccine as a prime and a monovalent Ad26.MARVA vaccine as a boost. All immunizations will be performed intramuscularly.

Vaccine Materials

[0194] The Ad26.MARVA vector expresses the MARV Angola GP (SEQ ID NO:3).

[0195] Ad26.MARVA (110.sup.11 vp) will be used as a prime and boost for the 0-8 week regimen (6 NHPs). One additional group of 2 NHPs will be immunized with saline and TBS as negative immunization control for the study. The grouping of this study is summarized in Table 1.All animals will be challenged 6 weeks after the last immunization with 1000 pfu of MARV Angola wild-type P3 challenge virus via the aerosol route in a Biosafety Level 4 laboratory.

TABLE-US-00002 TABLE 2 Experimental Grouping of Protection Study in Non- human Primates Challenged With aerosolized MARV Immunization Immunization Immunization Challenge 1 2 Schedule After 6 Group Size Group (Dose 1) (Dose 2) (Weeks) Weeks N 1 negative negative 0-8 MARV 2 control control (Angola) (Saline) (saline) 2 Ad26.MARVA Ad26.MARVA 0-8 MARV 6 (Angola) (1 10.sup.11vp) (1 10.sup.11vp) Abbreviations: TBS: Tris-buffered saline; Inf. U.: Infectious Unit; vp: viral particles. Endpoints in this study will be survival/nonsurvival. Nonsurvival is defined by an animal having terminal illness or being moribund and requiring humane termination. Animals' health will be evaluated on a daily clinical observation score sheet.

Immunogenicity

[0196] Blood will be sampled prior to each immunization and 1, 3 and 5 weeks after the last immunization for analyses of the immune response. The immune response in NHP will be characterized with respect to Filovirus GP-binding and neutralizing antibodies (ELISA) as well as cytokine producing T cells (ELISpot and Intracellular Cytokine Staining).

[0197] EDTA or heparin whole blood will be collected and processed for PBMC and plasma. PBMC will be used in an IFN- ELISPOT and an Intracellular Cytokine Staining assay using Marburg Angola GP peptides (15-mers overlapping by 11, spanning the entire MARV Angola GP) together with a DMSO only negative control and a stimulation positive control. Additionally, whole blood without anticoagulant will be processed for serum to be assayed in a MARVA GP specific ELISA and Virus Neutralization Assay.

Example 4

[0198] A clinical study will be performed in humans for evaluating the safety, tolerability and immunogenicity of a regimen using Ad26.MARVA as a homologous prime boost at a dose of 110.sup.11vp.

[0199] The study will be a randomized, placebo-controlled, observer-blind study being conducted in 18 healthy adult subjects who never received an experimental Filovirus candidate vaccine before and have no known exposure to a Filovirus or diagnosis of Filovirus disease. In this study 1 regimen will be tested: Ad26.MARVA as prime and as boost at a 56-day interval.

[0200] The study will consist of a vaccination period in which subjects will be vaccinated at baseline (Day 1) followed by a boost on Day 57, and a post-boost follow-up until all subjects have had their 35-day post-boost visit (Day 92) or discontinued earlier.

[0201] Subjects will be enrolled into 1 group of 18 healthy subjects. Subjects will be randomized in a 5:1 ratio to receive active vaccine or placebo (0.9% saline) through IM injections (0.5 ml).

[0202] The exemplary study vaccination schedules are summarized in Table 2.

TABLE-US-00003 TABLE 3 Study Vaccination Schedules Group N Day 1 Day 57 1 18 15 Ad26.MARVA Ad26.MARVA 1 10.sup.11 vp 1 10.sup.11 vp 3 placebo (0.9% saline) placebo (0.9% saline) N: number of subjects to receive study vaccine; TCID50: 50% Tissue Culture Infective Dose; vp: viral particles

Vaccine Materials

[0203] The Ad26.MARVA vector expresses the MARV Angola GP (SEQ ID NO:3). Safety will be assessed by collection of solicited local and systemic adverse events, unsolicited adverse events and serious adverse events, and by physical examination. In addition, standard chemistry, hematologic (including coagulation parameters) and urinalysis parameters will be assessed at multiple time points.

[0204] Immunogenicity will be assessed using the immunologic assays summarized in Tables 4 and 5. The exploratory assay package may include, but is not limited to, the listed assays.

TABLE-US-00004 TABLE 4 Summary of Immunologic Assays (Serology) Assay Purpose Secondary endpoints ELISA Analysis of antibodies binding to MARV GP Exploratory endpoints Virus neutralization assay Analysis of neutralizing antibodies to Adenovirus neutralization MARV GP Neutralizing antibodies to assay adenovirus MARV: Marburg virus; ELISA: enzyme-linked immunosorbent assay; GP: glycoprotein;

TABLE-US-00005 TABLE 5 Summary of Immunologic Assays (Cellular) Assay Purpose Exploratory endpoints ELISpot T-cell IFN- responses to MARV GP ICS of frozen Analysis of T-cell responses to MARV GP (including PBMC CD4/8, IL-2, IFN-, TNF- and/or activation markers) MARV: Marburg virus; ELISpot: enzyme-linked immunospot; GP: glycoprotein; ICS: intracellular cytokine staining; IFN: interferon; IL: interleukin; PBMC: peripheral blood mononuclear cells; TNF: tumor necrosis factor

[0205] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims.

TABLE-US-00006 SEQUENCELISTING SEQIDNO:1 GlycoproteinEbolavirusZaire,strainMayinga(AminoAcidsequence): MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLR SVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDG IRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKD FFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQL NETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISG QSPARTSSDPGTNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTTKPGP DNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPAT TTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREAIVNAQPKCN PNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQLANETTQALQLFLRAT TELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGD NDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF SEQIDNO:2 GlycoproteinEbolavirusSudan,strainGulu(AminoAcidsequence): MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVINSTLEVTEIDQLVCKDHLASTDQLK SVGLNLEGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDG VRGFPRCRYVHKAQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKET FLQSPPIREAVNYTENTSSYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQL NDTIHLHQQLSNITGRLIWTLDANINADIGEWAFWENKKNLSEQLRGEELSFEALSLNETEDDD AASSRITKGRISDRATRKYSDLVPKNSPGMVPLHIPEGETTLPSQNSTEGRRVGVNTQETITET AATIIGINGNHMQISTIGIRPSSSQIPSSSPITAPSPEAQTPTTHTSGPSVMATEEPTTPPGSS PGPTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGILGSLGLRKRSRRQTNTKATGKCN PNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRAT TELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPNQDN DDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC SEQIDNO:3 GlycoproteinMarburgvirusAngola(AminoAcidsequence): MKTTCLLISLILIQGVKTLPILEIASNIQPQNVDSVCSGTLQKTEDVHLMGFTLSGQKVADSPL EASKRWAFRAGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQ NPHAQGIALHLWGAFFLYDRIASTIMYRGKVFTEGNIAAMIVNKTVHKMIFSRQGQGYREMNLT STNKYWTSSNGTQTNDTGCFGTLQEYNSTKNQTCAPSKKPLPLPTAHPEVKLTSTSTDATKLNT TDPNSDDEDLTTSGSGSGEQEPYTTSDAATKQGLSSIMPPTPSPQPSTPQQGGNNTNHSQGVVT EPGKTNTTAQPSMPPHNTTTISTNNTSKHNLSTPSVPIQNATNYNTQSTAPENEQTSAPSKTTL LPTENPTTAKSTNSTKSPITTVPNTINKYSTSPSPTPNSTAQHLVYFRRKRNILWREGDMFPFL DGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHASPNISLTLSYFPKVNENTAHSGENENDC DAELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTAGLIKNQNNLVCRLRRLANQTAKSLELLLRV TTEERTFSLINRHAIDFLLARWGGTCKVLGPDCCIGIEDLSRNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:4 GlycoproteinMarburgvirusMusoke(AminoAcidsequence): MKTTCFLISLILIQGTKNLPILEIASNNQPQNVDSVCSGTLQKTEDVHLMGFTLSGQKVADSPL EASKRWAFRTGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQ NPHAQGIALHLWGAFFLYDRIASTIMYRGKVFTEGNIAAMIVNKTVHKMIFSRQGQGYREMNLT STNKYWTSSNGTQTNDTGCFGALQEYNSTKNQTCAPSKIPPPLPTARPEIKLTSTPTDATKLNT TDPSSDDEDLATSGSGSGEREPHTTSDAVTKQGLSSIMPPTPSPQPSTPQQGGNNTNHSQDAVT ELDKNNTTAQPSMPPHNTTTISTNNTSKHNFSTLSAPLQNTTNDNTQSTITENEQTSAPSITTL PPIGNPTTAKSTSSKKGPATTAPNTTNEHFTSPPPTPSSTAQHLVYFRRKRSILWREGDMFPFL DGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHASPNISLTLSYFPNINENTAYSGENENDC DAELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRV TTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:5 NucleoproteinEbolavirusTaiForest/Ivorycoast(AminoAcidsequence): MESRAHKAWMTHTASGFETDYHKILTAGLSVQQGIVRQRVIQVHQVTNLEEICQLIIQAFEAGV DFQESADSFLLMLCLHHAYQGDYKQFLESNAVKYLEGHGFRFEVRKKEGVKRLEELLPAASSGK SIRRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHSEQGLIQYPTAWQ SVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQ KTEHGVRLHPLARTAKVKNEVNSFKAALSSLAQHGEYAPFARLLNLSGVNNLEHGLFPQLSAIA LGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQKYAESRELDHLGLDDQEKKILKDFHQKKN ElSFQQTTAMVTLRKERLAKLTEAITSTSLLKTGKQYDDDNDIPFPGPINDNENSEQQDDDPTD SQDTTIPDIIVDPDDGRYNNYGDYPSETANAPEDLVLFDLEDGDEDDHRPSSSSENNNKHSLTG TDSNKTSNWNRNPTNMPKKDSTQNNDNPAQRAQEYARDNIQDTPTPHRALTPISEETGSNGHNE DDIDSIPPLESDEENNTETTITTTKNTTAPPAPVYRSNSEKEPLPQEKSQKQPNQVSGSENTDN KPHSEQSVEEMYRHILQTQGPFDAILYYYMMTEEPIVFSTSDGKEYVYPDSLEGEHPPWLSEKE ALNEDNRFITMDDQQFYWPVMNHRNKFMAILQHHK