AFFT2 CELL
20200102534 ยท 2020-04-02
Inventors
- Shunchang Jiao (Beijing, CN)
- Rong Zhang (Beijing, CN)
- Zishan Zhou (Beijing, CN)
- Jiasen Xie (Beijing, CN)
- Xiaobin Chen (Beijing, CN)
- Gang Peng (Beijing, CN)
- Hongli Chen (Beijing, CN)
Cpc classification
C12N5/0638
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
Abstract
The disclosure relates to an AFFT2 cell and a preparation method thereof. According to an embodiment, the cell is transformed with the TCR-T technology. The transformed T cells are blocked in vitro by an antibody drug of suppressive signaling molecules. According to another embodiment, a predicted antigen epitope is centered on a mutant amino acid site, the predicted antigen epitope extends 10 amino acids to each side of the mutant amino acid site, and the predicted antigen epitope serves as a potential antigen epitope. According to a further embodiment, TCR genes in a peripheral blood cell of a patient are knocked out by a CRISPR technology.
Claims
1. An AFFT2 cell, prepared by a method comprising the steps of: 1) drawing peripheral blood of a patient to perform ctDNA exon sequencing or performing whole exon sequencing with tumor tissues; 2) screening a mutation site to perform antigenic epitope prediction, and synthesizing a mutant polypeptide; 3) using the peripheral blood to prepare an immortalized dendritic cell, loading the mutant polypeptide, and co-incubating with a PBMC to obtain an AFF cell; 4) using the mutant polypeptide as an antigen to stimulate the AFF cell, and screening to obtain a precise polypeptide; 5) loading the immortalized dendritic cell with the precise polypeptide, and co-incubating with the PBMC to prepare an AFF cell; 6) using the precise polypeptide as an antigen to stimulate the AFF cell, screening to obtain a specific T cell capable of recognizing the precise polypeptide, and sequencing to obtain a high-frequency TCR sequence of the specific cells; 7) isolating CD8+T cells from the PBMC, knocking out the original TCR, and performing high-frequency TCR expression to construct a TCR-T cell; and 8) blocking the TCR-T cell with a monoclonal antibody drug of suppressive signaling molecules to prepare the AFFT2 cell.
2. The AFFT2 cell according to claim 1, wherein the peripheral blood of the patient is a commercially available engineered cell line.
3. The AFFT2 cell according to claim 1, wherein: a predicted antigen epitope is centered on a mutant amino acid site; the predicted antigen epitope extends 10 amino acids to each side of the mutant amino acid site; and the predicted antigen epitope serves as a potential antigen epitope.
4. The AFFT2 cell according to claim 1, wherein a method of knocking out TCR genes in a peripheral blood cell of the patient is a CRISPR technology.
5. The AFFT2 cell according to claim 1, wherein the suppressive signaling molecule comprises one or more of PD-1, Tim-3, LAG3, CTLA-4, BTLA, VISTA, CD160, 2B4(CD244), and TIGIT.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DETAILED DESCRIPTION
[0032] The following describes multiple exemplary embodiments of the disclosure with reference to the accompanying drawings in the embodiments of the disclosure. The described embodiments are merely a part rather than all of the embodiments of the present invention. All other embodiments obtained by a person of ordinary skill in the art based on the embodiments of the present invention without creative efforts shall fall within the protection scope of the present invention.
[0033] Regarding the term AFFT2 in the disclosure, A represents immortalized dendritic cell (DC) technology, FF represents mixed polypeptide stimulation technology, T represents TCR-T technology, 2 represents antibody in vitro blocking protection technology. AFFT2 cells are products obtained by a combination of the above techniques.
[0034] In an embodiment, a lung cancer patient is taken as an example to provide an antigen specific AFFT2 cell and a preparation method thereof. The preparation method of a AFFT2 cell includes the following steps.
[0035] 1. Whole Exon Sequencing
[0036] The peripheral blood of the lung cancer patient is drawn for ctDNA sequencing and HLA typing detection. The sequencing information is analyzed with software, the ctDNA sequencing result is compared with a genome of normal cells, and mutation sites are screened out.
[0037] 2. Antigen Epitope Prediction
[0038] The antigen epitope prediction is centered on a mutant amino acid site, extends 10 amino acids to each side, and the polypeptide segment having 21 amino acids is used as a potential antigen epitope. IC50 of the potential antigen epitope is analyzed with prediction software (recommended software: NetMHCpan 3.0, PickPocket, and Artificial Neural Networks (ANN)), and if IC50<1,000 nM, this potential antigen epitope is considered to be an antigen epitope.
[0039] 3. Synthesis of Polypeptide
[0040] A technology service company is entrusted to synthesize the mutant epitope to synthesize a mutant polypeptide.
[0041] 4. Immortalization of DC
[0042] 100 ml of peripheral blood of the patient is drawn. PBMC is isolated by Ficoll density gradient centrifugation. The dendritic cells are isolated using a Miltenyi dendritic cell isolation kit and re-suspended in a culture medium. The isolated dendritic cells are infected by TAX-GFP lentivirus, statically cultured at 37 C. in an incubator and observed. The cloned and grown cells are selected to be cloned in a 96-well plate for culture, respectively. Monoclonal phenotypic analysis. The ideal clone is used as the immortalized DC.
[0043] 5. Loading of Mutant Polypeptide with the Immortalized DC
[0044] Preparation of a polypeptide solution: the mutant polypeptide synthesized in step 3 is adopted for preparing, and the final concentration of each polypeptide is 10-100 g/mL, preferably 50 g/mL, for standby. The obtained immortalized DC is centrifugally collected, re-suspended in the prepared polypeptide solution, and placed in a cell culture plate for polypeptide loading. The cell culture plate is pulsed in 5% CO.sub.2 at 37 C. for 1-4 h, preferably 4 h, for standby.
[0045] 6. Co-Incubation of PBMC and DCs Loaded with Mutant Polypeptides
[0046] A pre-coating plate of stimulating factor OKM-25, i.e., 40 L of OKM-25+4 mL of PBS, 2 mL/dish (4.5 cm2) is placed at room temperature for 4 h, 4 C. for standby. The DC loaded with the mutant polypeptide and the PBMC are mixed at a ratio of 1:50 to 1:500, preferably 1:100, and transferred to a cell culture plate or a culture flask pre-coated with OMK-25. The mixture is mixed well, cultured in 5% CO.sub.2 at 37 C., and recorded as day 0. The condition of the co-cultured cells is observed. The co-cultured cells are transferred to a large culture flask on the 5th day according to the cell density, and 20 mL of fresh culture medium OKM-100+12% FBS is supplemented in a 75 cm2 culture flask. 20 mL of fresh OKM-100+12% FBS is added on the 7th day of co-culture. The culture medium is OKM-200+5% FBS, and the co-cultured cells are transferred from the 75 cm2 flask to the 175 cm2 large flask on the 10th day of co-culture. The transfer method is: cells are dispersed with 25 mL culture medium OKM-200+5% FBS, and then transferred to a large flask and repeated twice, and makes up to 200 mL with the culture medium OKM-200+5% FBS. 8) the cells of the AFF scheme are obtained when cultured for 14-21 days.
[0047] 7. Direct Stimulation of T Cells with the Polypeptide as an Antigen to Screen the Precise Polypeptide
[0048] The obtained cells of the AFF scheme are centrifugally collected, and centrifuged at 1,500 rpm for 5 min to collect T cells. 10 mL of PBS is added to re-suspend the cells, and counted, centrifuged at 1,500 rpm for 5 min, and the T cells are collected and re-suspended in 1640+10% FBS+200 U/mL IL2, and the cell density is adjusted to 110.sup.6 cells/mL. The T cells are distributed into a 96-well flat-bottom plate at 200 L/well with a micropipette, and the number of cells is 2105 cells. Then 10 L of 1 mg/mL mutant polypeptide synthesize in step 3 is added, and a final concentration is 50 g/mL, each polypeptide is provided with three holes. A positive control: T cell +100 ng/mL OKT3, and a negative control: 1640+10% FBS+200 U/mL IL2. Two T cell controls are used as background release detection, T cells are added at earliest time and latest time. The difference in the release of two backgrounds as a systematic error. The cells are stimulated in 5% CO.sub.2 at 37 C. for 24 h, and centrifuged at 1,500 rpm for 10 min, and 140 L of supernatant is transferred to a new 96-well plate. The 96-well plate is centrifuged at 1,500 rpm for 10 min, and a sample is taken for ELISA detection (or the sample is stored at 80 C.).
[0049] 8. Evaluation Criteria of Precise Polypeptide
[0050] If the positive control and the negative control are normal, the data is reliable. T cells as baseline when polypeptide serving as antigen. Each group of experiments consists of two baselines: a high baseline and a low baseline. The high baseline has a high detection value, the low baseline has a low detection value, and the difference between the two baselines is the systematic error, and during data analysis, the detection value >the low baseline, >the high baseline and >the high baseline+the systematic error are labeled separately. The detection value >the high baseline+the systematic error is a valid precise polypeptide.
[0051] 9. Preparation of AFF Cells with the Screened Precise Polypeptide
[0052] The precise polypeptide AFF cells are prepared by methods 4, 5, and 6.
[0053] 10. Culture and Isolation of Mutant Antigen Specific Killing T Cells
[0054] The AFF cells obtained in step 9 are directly stimulated by the screened precise polypeptide for 12-72 h for standby. The stimulated T cells are stained with CD8, CD137, IFN-, and are sorted by a flow cytometer, and CD8+CD137+ or CD8+IFN-+ cells are selected.
[0055] 11. TCR Frequency Detection of CD8+T Cells and Cloning of High-Frequency TCR
[0056] The cells are obtained by sorting, and the genome is immediately extracted. The genome is subjected to TCR sequencing analysis, and the high-frequency TCR sequence is determined according to the TCR distribution frequency. The mRNA of the PBMC is extracted, reversely transcribed into cDNA, and primers are designed according to the high-frequency TCR sequence, and amplified to obtain the TCR gene. A TCR gene expression vector is constructed, and the virus is packaged.
[0057] 12. Construction of a CRISPR Vector that Knocks Out the Original TCR
[0058] A CDS region of mRNA of the TCR gene is found on Pubmed, and a conserved region of the TCR is analyzed, and the conserved region is subjected to knockout target prediction. The construction of the TCR knockout vector and virus packaging are completed by the following steps. Forward primers and reverse primers required for synthesizing sgRNA are designed, and the forward primers and the reverse primers are mixed at 1:1, and then treated at 95 C. for 5-60 min, and then slowly cooled to form a DNA sequence of the sgRNA. The CRISPR lentiviral vector is double-digested and ligated with the double-stranded DNA corresponding to the sgRNA, and transferred into the cloned competent cells, the mono clones are picked for sequencing after 12 h, and the clones of correct sequencing are retained. A CRISPR lentiviral vector carrying the DNA sequence corresponding to the sgRNA is extracted for virus packaging.
[0059] 13. Construction of AFFT Cells
[0060] PBMC is thawed, and CD8+T cells are sorted with magnetic beads. The virus obtained in step 12 is used to infect the CD8+T cells for knocking out the original TCR. The infected CD8+T cells are cultured in the culture medium for 0-5 days, preferably 3 days, and then transfected by the lentivirus constructed in step 11. The infected CD8+T cells are re-suspended in OKM100+12% FBS, and placed on a pre-coating plate of the stimulating factor OKM-25, recorded as day 0. The cell conditions and the cell density are observed. The co-cultured cells are transferred to a large culture flask at the 5th day, and fresh culture medium OKM-100+12% FBS is supplemented. The cells are transferred from a 75 cm2 flask to a 175 cm2 large flask, and the culture medium is OKM-200+5% FBS. The TCR-T can be harvested when cultured for 14-21 days to obtain the AFFT cells.
[0061] 14. Blocking of Immunosuppressive Signaling
[0062] The immunosuppressive signaling molecule is PD-1. The cultured TCR-T cells are collected by centrifuging at 1,000 rpm for 5 min. The cells are washed with PBS once and centrifuged at 1,000 rpm for 5 min, the TCR-T cells are re-suspended with OKM-200+5% FBS, and adjusted to 1107/mL. The monoclonal antibody drug Keytruda of the suppressive signaling molecules is added at a final concentration of 50-500 g/mL, preferably 150 g/mL, and blocked at 0-37 C. for 1-4 h, preferably at 37 C. for 1 h to obtain the AFFT2 cells.
[0063] 15. Construction of Specific Antigen Expression Target Cells and Tumor Model Survival Experiments
[0064] A lentiviral vector that can express the screened precise polypeptide (specific antigen) is constructed. The specific antigen-expressing lentiviral vector is packaged into lentiviral particles, appropriate HLA-matched tumor cells are infected, specific antigens are stably over-expressed, and the expression level and expression intensity are flow-detected. NGS mice are inoculated with the tumor cell line stably overexpressing specific antigen peptides to serve as ectopic tumor-bearing animal models. 5105 tumor cells expressing the specific antigens are suspended in 100 l of physiological saline, subcutaneously injected to the right flank of 30 NSG mice, and the mice are numbered. The cells are infused in groups when the tumor grows to about 100-120 mm3. According to the tumor volume, the animal models are randomly divided into three groups, each group of 5-6 mice, one group is given placebo saline, one group is given 1107 of T cells (control group) without any genetic manipulation, and one group is given 1107 of AFFT2 cells, the second injection is performed 7 days after the first injection of cells, and the cells are injected for the third time after 7 days, observation is made for 60 days continuously, the survival data is counted, and the survival curve is plotted.
Experimental Results
[0065] 1. Mutation Site and Antigen Epitope Prediction
[0066] Table 1 shows a result of mutation sites detected by sequencing and antigen epitope prediction, and the mutant amino acid is underlined.
TABLE-US-00001 TABLE1 Antigenepitopeprediction Polypeptide Antigen Affinityto No. Epitope HLA(nM) 1 HSFQAIEL 121.34 2 WLIHSFQAIEL 40.68 3 LLLFIKHTY 26.83 4 GAHRDAAKI 13.89 5 GGYGYISAC 15.94 6 FIVNTLNAGL 53.61 7 ASYGAHRDA 3.7 8 VLDMLCLGI 65.8 9 FILMELEVL 14.51 10 EPATKLPPL 10.71
[0067] 2. Morphologic Observation of Immortalized DC
[0068] The morphology of the mature induced DC is observed with a microscope first, and distinct dendritic cells can be observed (
[0069] 3. Detection of DC Antigen Loading Efficiency
[0070] The predicted mutant antigens are synthesized according to Table 1, and biotins are labeled. After the antigen is loaded with DC, the distribution of biotins on the cell surface is detected by PE-labeled affinity streptomycin to detect the efficiency of DC presenting the polypeptide antigen. The results are as shown in
[0071] 4. Screening for Precise Polypeptides with AFF Cells
[0072] the cultured T cells are stimulated with 10 polypeptides, and the effective polypeptides are detected by detecting the secretion of IFN-. The results are as shown in
[0073] 5. Identification and Sorting of Specific T Cells for Precise Polypeptides
[0074] The cells of the AFF scheme are stimulated by the selected No. 6 polypeptide, and the ratio of specific T cells for the precise polypeptide is detected in a flow cytometry mode. The results are as shown in
[0075] 6. Identification and Cloning of High-Frequency TCR
[0076] Genome extraction on the sorted cells, sequencing of TCR, and the distribution of TCR are as shown in
TABLE-US-00002 TABLE2 SequenceofTCRchainCDR3 No. DNAsequence5-3ofTCRchainCDR CDR3aminoacidsequence TCR1 TGTGCCAGCAGTTCCCGACTAGCGGGGGGGACAGATACGCAGTATTTT CASSSRLAGGTDTQYF TCR2 TGTGCCACCAGCAGGGAGGGAGGGGAGACCCAGTACTTC CATSREGGETQYT TCR3 TGTGCCACCAGCAGAGATTGGCTATCCAACGGGAACACTGAAGCTTTCTTT CATSRDWLSNGNTEAFP TCR4 TGTGCCAGCAGTTACTCGCTCGGAATCTACGAGCAGTACTTC CASSYSLGIYEQYF TCR5 TGTGCCAGCAGTGATTTCGGACCATCGTGGGGCAATGAGCAGTTCTTC CASSDFGPSWGNEQFF TCR6 TGTGCCAGCAGCTTAGAGGCAGTGAACACTGAAGCTTTCTTT CASSLEAVNTEAFF TCR7 TGTGCCAGCAGCCCCGTTGGCGGCCAAGGAACCCTCCACTTT CASSPVGGQGTLHF TCR8 TGTGCCAGCAGCTTAGGGACACTATATGGCTACACCTTC CASSLGTLYGYTF TCR9 TGCGCCAGCAGTGAGTCTGGGACAGGGTTCTCCTACGAGCAGTACTTC CASSESGTGFSYEQYF TCR10 TGTGCCAGTAGTGCGGCAGGGGGGCCCTACGAGCAGTACTTC CASSAAGGPYEQYF TCR11 TGTGCCATCAGTGAGTCGGACAGTCCCATCGACACTGAAGCTTTCTTT CAISESDSPIDTEAFF TCR12 TGCGCCAGCAGCTTGGCCGAGGGAGATGGCTACACCTTC CASSLAEGDGYTF TCR13 TGTGCCACCAGCAGAGTGGCCGGGAGACCCAGTACTTC CATSRVAGETQYF TCR14 TGTGCCACCAGTGATGGGGCAGGGGTCGAGCAGTTCTTC CATSDGAGVEQFF TCR15 TGTGCCAGCAGTTTGGCGGAGATCAATCAGCCCCAGCATTTT CASSLAEINQPQHF TCR16 TGTGCCAGCAGCTCTTCAAGCGGGACCGGGGCTTTCTTT CASSSSSGTGAFF TCR17 TGTGCCAGCAGCTCCCTTGGGGTCACTGAAGCTTTCTTT CASSSLGVTEAFF TCR18 TGTGCCAGCAGCCCACCGGGCTTGAATGAAAAACTGTTTTTT CASSPPGLNEKLFF TCR19 TGTGCCAGCAGTGAAGAGGGCAGCCCCCGGGGATACGAGCAGTACTTC CASSEEGSPRGYEQYF TCR20 TGCGCCAGCAGTCGGACAGGGGAGAATTCACCCCTCCACTTT CASSRTGENSPLHF
[0077] Known TCR-:
TABLE-US-00003 Aminoacidsequence: MMKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAI ASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKED GRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKL IFGQGTELSVKPN Nucleicacidsequence: ATGATGAAATCCTTGAGAGTTTTACTAGTGATCCTGTGGC TTCAGTTGAGCTGGGTTTGGAGCCAACAGAAGGAGGTGGA GCAGAATTCTGGACCCCTCAGTGTTCCAGAGGGAGCCATT GCCTCTCTCAACTGCACTTACAGTGACCGAGGTTCCCAGT CCTTCTTCTGGTACAGACAATATTCTGGGAAAAGCCCTGA GTTGATAATGTTCATATACTCCAATGGTGACAAAGAAGAT GGAAGGTTTACAGCACAGCTCAATAAAGCCAGCCAGTATG TTTCTCTGCTCATCAGAGACTCCCAGCCCAGTGATTCAGC CACCTACCTCTGTCCCGTGAACTTCGGAGGAGGAAAGCTT ATCTTCGGACAGGGAACGGAGTTATCTGTGAAACCCAAT
[0078] Known TCR-:
TABLE-US-00004 Aminoacid: MRIRLLCCVAFSLLWAGPVIAGITQAPTSQILAAGRRMTL RCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVP DGYSVSRANTDDFPLTLASAVPSQTSVYFCASSLSFGTEA FFGQGTRLTVV(ThetransverselineistheCDR3 sequence,whichisasequencetobe substituted) SubstitutedTCR-: MRIRLLCCVAFSLLWAGPVIAGITQAPTSQILAAGRRMTL RCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVP DGYSVSRANTDDFPLTLASAVPSQTSVYFC ATSRDWLSNGNTEAFFGQGTRLTVV(Thetransverseline isthesubstitutedCDR3sequence)
[0079] 7. Detection of Knockout Efficiency of Original TCR
[0080] The CRISPR technology is used to knock out the original TCR on the CD8+T cells. The result is as shown in
[0081] 8. Detection of Specific TCR Expression
[0082] The foregoing cells are transfected with lentiviruses that package specific TCR. The expression efficiency of TCR is detected in a flow cytometry mode on the 7th day. The results are as shown in
[0083] 9. Blocking Effect of Suppressive Signaling of the AFFT2 Cells
[0084] 500 g/mL of fluorescently labeled monoclonal antibody drug Keytruda is added to the PBS buffer system. As shown in
[0085] 10. The Killing Ability of the AFFT2 Cells to Target Cells
[0086] The killing efficiencies of the AFF cells, AFFT cells and AFFT2 cells to the target cells derived from the mutant antigen epitope are detected, respectively, and the untreated cells are used as a control (Mock). The results are as shown in
[0087] 11. Detection of Cytokines Released by the AFFT2 Cell
[0088] During co-culture of the tumor cells and the effector cells, mutant antigens on the tumor cells can be recognized due to the effector cells. Therefore, a series of cytokines are produced. IFN- is one of the most important cytokines against tumors.
[0089] 12. Construction of Specific Antigen-Expressing Target Cells and Tumor Model Survival Experiments
[0090] A specific antigen-expressing tumor target cell line is successfully constructed, and a tumor-bearing animal model is established. The result (
[0091] Various embodiments of the disclosure may have one or more of the following effects. The AFFT2 cell provided by the disclosure uses a tumor antigen as a mutant antigen, which is different from other tissues. The tumor antigen may have a strong target specificity, may not be easy to cause off-target effects, and may have high safety. The proportion of the specific cells obtained by the disclosure may be high. The distribution of the specific cells capable of recognizing tumor antigens in PBMC may be 0.5% or less. The proportion of the cells transformed by the AFFT2 scheme and the specific T cells (TCR+) recognizing the tumor antigens may be 70% or more. The AFFT2 cell obtained by the disclosure may block the immunosuppressive targets such as PD1, CTLA4, TIM3, and LAG3 with the monoclonal antibody drug. The killing ability against tumors may not be limited, and the killing efficiency be higher. An AFFT2 cell may be transformed with the TCR-T technology, and the transformed T cells may be blocked in vitro by an antibody drug of suppressive signaling molecules, which may enhance the anti-tumor ability of the T cells.
[0092] Many different arrangements of the various components depicted, as well as components not shown, are possible without departing from the spirit and scope of the present disclosure. Embodiments of the present disclosure have been described with the intent to be illustrative rather than restrictive. Alternative embodiments will become apparent to those skilled in the art that do not depart from its scope. A skilled artisan may develop alternative means of implementing the aforementioned improvements without departing from the scope of the present disclosure.
[0093] It will be understood that certain features and subcombinations are of utility and may be employed without reference to other features and subcombinations and are contemplated within the scope of the claims. Unless indicated otherwise, not all steps listed in the various figures need be carried out in the specific order described.