Methods and Compositions for Diagnosis and Prognosis of Renal Injury and Renal Failure

20200103415 ยท 2020-04-02

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to methods and compositions for monitoring, diagnosis, prognosis, and determination of treatment regimens in subjects suffering from or suspected of having a renal injury. In particular, the invention relates to using assays that detect one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24 as diagnostic and prognostic biomarker assays in renal injuries.

Claims

1. A method for evaluating renal status in a subject, comprising: performing one or more of an assay method configured to detect Metalloproteinase inhibitor 1, an assay method configured to detect Metalloproteinase inhibitor 2, an assay method configured to detect Metalloproteinase inhibitor 4, an assay method configured to detect CC motif chemokine 15, an assay method configured to detect CC motif chemokine 18, an assay method configured to detect CC motif chemokine 23, and/or an assay method configured to detect CC motif chemokine 24, on a body fluid sample obtained from the subject to provide one or more assay result(s); and correlating the assay result(s) to the renal status of the subject.

2. A method according to claim 1, wherein said correlation step comprises correlating the assay result(s) to one or more of risk stratification, diagnosis, staging, prognosis, classifying and monitoring of the renal status of the subject.

3. A method according to claim 1, wherein said correlating step comprises assigning a likelihood of one or more future changes in renal status to the subject based on the assay result(s).

4. A method according to claim 3, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, future acute renal failure (ARF), and future persistence of existing ARF.

5. A method according to one of claims 1-4, wherein said assay result(s) comprise one or more of a measured concentration of Metalloproteinase inhibitor 1, a measured concentration of Metalloproteinase inhibitor 2, a measured concentration of Metalloproteinase inhibitor 4, a measured concentration of CC motif chemokine 15, a measured concentration of CC motif chemokine 18, a measured concentration of CC motif chemokine 23, and/or a measured concentration of CC motif chemokine 24.

6. A method according to one of claims 1-5, wherein said correlating step comprises combining a plurality of assay results using a function that converts the plurality of assay results into a single composite result.

7. A method according to claim 3, wherein said one or more future changes in renal status comprise a clinical outcome related to a renal injury suffered by the subject.

8. A method according to claim 3, wherein the likelihood of one or more future changes in renal status is that an event of interest is more or less likely to occur within 30 days of the time at which the body fluid sample is obtained from the subject.

9. A method according to claim 8, wherein the likelihood of one or more future changes in renal status is that an event of interest is more or less likely to occur within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours.

10. A method according to one of claims 1-5, wherein the subject is selected for evaluation of renal status based on the pre-existence in the subject of one or more known risk factors for prerenal, intrinsic renal, or postrenal ARF.

11. A method according to one of claims 1-5, wherein the subject is selected for evaluation of renal status based on an existing diagnosis of one or more of congestive heart failure, preeclampsia, eclampsia, diabetes mellitus, hypertension, coronary artery disease, proteinuria, renal insufficiency, glomerular filtration below the normal range, cirrhosis, serum creatinine above the normal range, sepsis, injury to renal function, reduced renal function, or ARF, or based on undergoing or having undergone major vascular surgery, coronary artery bypass, or other cardiac surgery, or based on exposure to NSAIDs, cyclosporines, tacrolimus, aminoglycosides, foscarnet, ethylene glycol, hemoglobin, myoglobin, ifosfamide, heavy metals, methotrexate, radiopaque contrast agents, or streptozotocin.

12. A method according to one of claims 1-5, wherein said correlating step comprises assigning a diagnosis of the occurrence or nonoccurrence of one or more of an injury to renal function, reduced renal function, or ARF to the subject based on the assay result.

13. A method according to one of claims 1-5, wherein said correlating step comprises assessing whether or not renal function is improving or worsening in a subject who has suffered from an injury to renal function, reduced renal function, or ARF based on the assay result.

14. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of an injury to renal function in said subject.

15. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of reduced renal function in said subject.

16. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of acute renal failure in said subject.

17. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of a need for renal replacement therapy in said subject.

18. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of a need for renal transplantation in said subject.

19. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of an injury to renal function in said subject.

20. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of reduced renal function in said subject.

21. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of acute renal failure in said subject.

22. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of a need for renal replacement therapy in said subject.

23. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of a need for renal transplantation in said subject.

24. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 72 hours of the time at which the body fluid sample is obtained.

25. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 48 hours of the time at which the body fluid sample is obtained.

26. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 24 hours of the time at which the body fluid sample is obtained.

27. A method according to one of claims 1-5, wherein the subject is in RIFLE stage 0 or R.

28. A method according to claim 27, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 72 hours.

29. A method according to claim 28, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

30. A method according to claim 28, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

31. A method according to claim 27, wherein the subject is in RIFLE stage 0 or R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

32. A method according to claim 31, wherein the subject is in RIFLE stage 0 or R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

33. A method according to claim 27, wherein the subject is in RIFLE stage R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

34. A method according to claim 33, wherein the subject is in RIFLE stage R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

35. A method according to one of claims 1-5, wherein the subject is in RIFLE stage 0, R, or I, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

36. A method according to claim 35, wherein the subject is in RIFLE stage I, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

37. A method according to claim 28, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 48 hours.

38. A method according to claim 29, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

39. A method according to claim 30, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

40. A method according to claim 31, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

41. A method according to claim 32, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

42. A method according to claim 33, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

43. A method according to claim 34, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

44. A method according to claim 35, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

45. A method according to claim 36, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

46. A method according to claim 28, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 24 hours.

47. A method according to claim 29, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

48. A method according to claim 30, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

49. A method according to claim 31, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

50. A method according to claim 32, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

51. A method according to claim 33, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

52. A method according to claim 34, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

53. A method according to claim 35, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

54. A method according to claim 36, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

55. A method according to one of claims 1-5, wherein the subject is not in acute renal failure.

56. A method according to one of claims 1-5, wherein the subject has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

57. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained.

58. A method according to one of claims 1-5, wherein the subject has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

59. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

60. A method according to one of claims 1-5, wherein the subject has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

61. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained.

62. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 12 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

63. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

64. A method according to claim 63, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

65. A method according to claim 63, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

66. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

67. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

68. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

69. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

70. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

71. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

72. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

73. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

74. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

75. A method according to one of claims 1-5, wherein the subject has not experienced a 2-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

76. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 12 hours preceding the time at which the body fluid sample is obtained.

77. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 2-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 2 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

78. A method according to one of claims 1-5, wherein the subject has not experienced a 3-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

79. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.3 ml/kg/hr over the 24 hours preceding the time at which the body fluid sample is obtained, or anuria over the 12 hours preceding the time at which the body fluid sample is obtained.

80. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 3-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.3 ml/kg/hr over the 24 hours preceding the time at which the body fluid sample is obtained, or anuria over the 12 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

81. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 12 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

82. A method according to claim 81, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

83. A method according to claim 81, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

84. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 2-fold or greater increase in serum creatinine.

85. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

86. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 2-fold or greater increase in serum creatinine.

87. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

88. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 2-fold or greater increase in serum creatinine.

89. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

90. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

91. A method according to claim 90, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

92. A method according to claim 90, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

93. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 3-fold or greater increase in serum creatinine.

94. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

95. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 3-fold or greater increase in serum creatinine.

96. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

97. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 3-fold or greater increase in serum creatinine.

98. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

99. A method according to one of claims 1-98, wherein the body fluid sample is a urine sample.

100. A method according to one of claims 1-98, wherein the body fluid sample is a blood, serum, or plasma sample.

101. A method according to one of claims 1-100, wherein the assay method comprises introducing the body fluid sample obtained from the subject into an assay instrument which (i) contacts the body fluid sample with one or more reagents which specifically bind for detection one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24, (ii) generates one or more assay results indicative of one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24 in the urine sample, and (iii) uses the assay result(s) to assign the subject to a predetermined subpopulation of individuals having a known predisposition of a current or future acute renal injury or current or future acute renal failure.

102. A method according to claim 101, further comprising treating the subject based on the predetermined subpopulation of individuals to which the patient is assigned, wherein the treatment comprises one or more of initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, delaying or avoiding procedures that are known to be damaging to the kidney, and modifying diuretic administration.

103. A method according to claim 101 or 102, wherein the subject does not have a current acute renal injury or acute renal failure, and the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of a future acute renal injury or future acute renal failure.

104. A method according to claim 103, wherein the future acute renal injury or future acute renal failure is within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours

105. A method according to claim 101 or 102, wherein the subject has a current acute renal injury or acute renal failure, and the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of future recovery from acute renal injury or acute renal failure.

106. A method according to claim 105, wherein the future recovery from acute renal injury or acute renal failure is within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours

107. A method according to claim 101 or 102, wherein the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of future persistence of an acute renal injury or acute renal failure.

108. A method according to claim 107, wherein the future persistence is over a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours.

109. A method according to claim 107 or 108, wherein the subject has an acute renal injury or acute renal failure at the time the body fluid sample is obtained.

110. Measurement of one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24 for the evaluation of renal injury, particularly acute renal injury, and most particularly persistent acute renal injury.

111. A kit, comprising: reagents for performing one or more assays configured to detect one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24, and a device which contains one or more encoded calibration curves for correlating results from performing said assay(s) to a concentration of one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24, wherein the concentration range of said calibration curve(s) comprise a normal concentration of one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24, and a threshold concentration of one or more of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24 that indicates persistent acute renal injury in a human.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0050] The present invention relates to methods and compositions for diagnosis, differential diagnosis, risk stratification, monitoring, classifying and determination of treatment regimens in subjects suffering or at risk of suffering from injury to renal function, reduced renal function and/or acute renal failure through measurement of one or more kidney injury markers. In various embodiments, a measured concentration of one or more markers selected from the group consisting of Metalloproteinase inhibitor 1, Metalloproteinase inhibitor 2, Metalloproteinase inhibitor 4, CC motif chemokine 15, CC motif chemokine 18, CC motif chemokine 23, and/or, CC motif chemokine 24 or one or more markers related thereto, and optionally one or more additional kidney injury markers known in the art, are correlated to the renal status of the subject.

[0051] For purposes of this document, the following definitions apply:

As used herein, an injury to renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) measurable reduction in a measure of renal function. Such an injury may be identified, for example, by a decrease in glomerular filtration rate or estimated GFR, a reduction in urine output, an increase in serum creatinine, an increase in serum cystatin C, a requirement for renal replacement therapy, etc. Improvement in Renal Function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) measurable increase in a measure of renal function. Preferred methods for measuring and/or estimating GFR are described hereinafter.
As used herein, reduced renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.1 mg/dL (>8.8 mol/L), a percentage increase in serum creatinine of greater than or equal to 20% (1.2-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour).
As used herein, acute renal failure or ARF is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.3 mg/dl (>26.4 mol/1), a percentage increase in serum creatinine of greater than or equal to 50% (1.5-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour for at least 6 hours). This term is synonymous with acute kidney injury or AKI.

[0052] In this regard, the skilled artisan will understand that the signals obtained from an immunoassay are a direct result of complexes formed between one or more antibodies and the target biomolecule (i.e., the analyte) and polypeptides containing the necessary epitope(s) to which the antibodies bind. While such assays may detect the full length biomarker and the assay result be expressed as a concentration of a biomarker of interest, the signal from the assay is actually a result of all such immunoreactive polypeptides present in the sample. Expression of biomarkers may also be determined by means other than immunoassays, including protein measurements (such as dot blots, western blots, chromatographic methods, mass spectrometry, etc.) and nucleic acid measurements (mRNA quatitation). This list is not meant to be limiting.

[0053] As used herein, the term Metalloproteinase inhibitor 1 refers to one or more polypeptides present in a biological sample that are derived from the Metalloproteinase inhibitor 1 precursor (Swiss-Prot P01033 (SEQ ID NO: 1)).

TABLE-US-00002 10203040 MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDL 50607080 VIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAAD 90100110120 IRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT 130140150160 TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPC 170180190200 KLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ SLRSQIA

[0054] The following domains have been identified in Metalloproteinase inhibitor 1:

TABLE-US-00003 Residues Length Domain ID 1-23 23 signal sequence 24-207 184 Metalloproteinase inhibitor 1

[0055] As used herein, the term Metalloproteinase inhibitor 2 refers to one or more polypeptides present in a biological sample that are derived from the Metalloproteinase inhibitor 2 precursor (human precursor: Swiss-Prot P16035 (SEQ ID NO: 2)).

TABLE-US-00004 10203040 MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCN 50607080 ADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFK 90100110120 GPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG 130140150160 KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCP 170180190200 MIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS 210220 CAWYRGAAPPKQEFLDIEDP

[0056] The following domains have been identified in Metalloproteinase inhibitor 2:

TABLE-US-00005 Residues Length Domain ID 1-26 26 Signal peptide 27-220 194 Metalloproteinase inhibitor 2

[0057] As used herein, the term Metalloproteinase inhibitor 4 refers to one or polypeptides present in a biological sample that are derived from the Metalloproteinase inhibitor 4 precursor (human precursor: Swiss-Prot Q99727 (SEQ ID NO: 3)).

TABLE-US-00006 10203040 MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQH 50607080 ICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKM 90100110120 FKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV 130140150160 LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQI 170180190200 TTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKH 210220 VDGTCSWYRGHLPLRKEFVDIVQP

[0058] The following domains have been identified in Metalloproteinase inhibitor 4:

TABLE-US-00007 Residues Length Domain ID 1-29 29 Signal sequence 30-224 195 Metalloproteinase inhibitor 4

[0059] As used herein, the term CC motif chemokine 15 refers to one or more polypeptides present in a biological sample that are derived from the CC motif chemokine 15 precursor (human precursor: Swiss-Prot Q16663 (SEQ ID NO: 4)).

TABLE-US-00008 10203040 MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLEN 50607080 PVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP 90100110 GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

[0060] The following domains have been identified in CC motif chemokine 15:

TABLE-US-00009 Residues Length Domain ID 1-21 21 Signal peptide 22-113 92 C-C motif chemokine 15 43-113 71 C-C motif chemokine 15 (22-92) 46-113 68 C-C motif chemokine 15 (25-92) 50-113 64 C-C motif chemokine 15 (29-92)

[0061] As used herein, the term CC motif chemokine 18 refers to one or more polypeptides present in a biological sample that are derived from the CC motif chemokine 18 precursor (human precursor: Swiss-Prot P55774 (SEQ ID NO: 5)).

TABLE-US-00010 10203040 MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIP 50607080 QKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQK YISDLKLNA

[0062] The following domains have been identified in CC motif chemokine 18: Residues Length Domain ID

TABLE-US-00011 Residues Length Domain ID 1-20 20 Signal peptide 21-89 69 C-C motif chemokine 18 21-88 68 CCL 18 (1-68) 23-89 67 CCL 18 (3-69) 24-89 66 CCL 18 (4-69)

[0063] As used herein, the term CC motif chemokine 23 refers to one or more polypeptides present in a biological sample that are derived from the CC motif chemokine 23 precursor (Swiss-Prot P55773 (SEQ ID NO: 6))

TABLE-US-00012 10203040 MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLEN 50607080 PVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSK 90100110120 PGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN

[0064] The following domains have been identified in CC motif chemokine 23:

TABLE-US-00013 Residues Length Domain ID 1-21 21 signal peptide 22-120 99 C-C motif chemokine 23 40-120 81 C-C motif chemokine 23 (19-99) 43-120 78 C-C motif chemokine 23 (22-99) 48-120 73 C-C motif chemokine 23 (27-99) 51-120 70 C-C motif chemokine 23 (30-99)

[0065] As used herein, the term CC motif chemokine 24 refers to one or more polypeptides present in a biological sample that are derived from the CC motif chemokine 24 precursor (Swiss-Prot O00175 (SEQ ID NO: 7))

TABLE-US-00014 10203040 MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSK 50607080 RIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQE 90100110 WVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

[0066] The following domains have been identified in CC motif chemokine 24:

TABLE-US-00015 Residues Length Domain ID 1-26 26 signal peptide 27-119 93 C-C motif chemokine 24

[0067] As used herein, the term relating a signal to the presence or amount of an analyte reflects this understanding. Assay signals are typically related to the presence or amount of an analyte through the use of a standard curve calculated using known concentrations of the analyte of interest. As the term is used herein, an assay is configured to detect an analyte if an assay can generate a detectable signal indicative of the presence or amount of a physiologically relevant concentration of the analyte. Because an antibody epitope is on the order of 8 amino acids, an immunoassay configured to detect a marker of interest will also detect polypeptides related to the marker sequence, so long as those polypeptides contain the epitope(s) necessary to bind to the antibody or antibodies used in the assay.

[0068] The term related marker as used herein with regard to a biomarker such as one of the kidney injury markers described herein refers to one or more fragments, variants, etc., of a particular marker or its biosynthetic parent that may be detected as a surrogate for the marker itself or as independent biomarkers. The term also refers to one or more polypeptides present in a biological sample that are derived from the biomarker precursor complexed to additional species, such as binding proteins, receptors, heparin, lipids, sugars, etc.

[0069] The term positive going marker as that term is used herein refer to a marker that is determined to be elevated in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition. The term negative going marker as that term is used herein refer to a marker that is determined to be reduced in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition.

[0070] The term subject as used herein refers to a human or non-human organism. Thus, the methods and compositions described herein are applicable to both human and veterinary disease. Further, while a subject is preferably a living organism, the invention described herein may be used in post-mortem analysis as well. Preferred subjects are humans, and most preferably patients, which as used herein refers to living humans that are receiving medical care for a disease or condition. This includes persons with no defined illness who are being investigated for signs of pathology.

[0071] Preferably, an analyte is measured in a sample. Such a sample may be obtained from a subject, or may be obtained from biological materials intended to be provided to the subject. For example, a sample may be obtained from a kidney being evaluated for possible transplantation into a subject, and an analyte measurement used to evaluate the kidney for preexisting damage. Preferred samples are body fluid samples.

[0072] The term body fluid sample as used herein refers to a sample of bodily fluid obtained for the purpose of diagnosis, prognosis, classification or evaluation of a subject of interest, such as a patient or transplant donor. In certain embodiments, such a sample may be obtained for the purpose of determining the outcome of an ongoing condition or the effect of a treatment regimen on a condition. Preferred body fluid samples include blood, serum, plasma, cerebrospinal fluid, urine, saliva, sputum, and pleural effusions. In addition, one of skill in the art would realize that certain body fluid samples would be more readily analyzed following a fractionation or purification procedure, for example, separation of whole blood into serum or plasma components.

[0073] The term diagnosis as used herein refers to methods by which the skilled artisan can estimate and/or determine the probability (a likelihood) of whether or not a patient is suffering from a given disease or condition. In the case of the present invention, diagnosis includes using the results of an assay, most preferably an immunoassay, for a kidney injury marker of the present invention, optionally together with other clinical characteristics, to arrive at a diagnosis (that is, the occurrence or nonoccurrence) of an acute renal injury or ARF for the subject from which a sample was obtained and assayed. That such a diagnosis is determined is not meant to imply that the diagnosis is 100% accurate. Many biomarkers are indicative of multiple conditions. The skilled clinician does not use biomarker results in an informational vacuum, but rather test results are used together with other clinical indicia to arrive at a diagnosis. Thus, a measured biomarker level on one side of a predetermined diagnostic threshold indicates a greater likelihood of the occurrence of disease in the subject relative to a measured level on the other side of the predetermined diagnostic threshold.

[0074] Similarly, a prognostic risk signals a probability (a likelihood) that a given course or outcome will occur. A level or a change in level of a prognostic indicator, which in turn is associated with an increased probability of morbidity (e.g., worsening renal function, future ARF, or death) is referred to as being indicative of an increased likelihood of an adverse outcome in a patient.

[0075] Marker Assays

[0076] In general, immunoassays involve contacting a sample containing or suspected of containing a biomarker of interest with at least one antibody that specifically binds to the biomarker. A signal is then generated indicative of the presence or amount of complexes formed by the binding of polypeptides in the sample to the antibody. The signal is then related to the presence or amount of the biomarker in the sample. Numerous methods and devices are well known to the skilled artisan for the detection and analysis of biomarkers. See, e.g., U.S. Pat. Nos. 6,143,576; 6,113,855; 6,019,944; 5,985,579; 5,947,124; 5,939,272; 5,922,615; 5,885,527; 5,851,776; 5,824,799; 5,679,526; 5,525,524; and 5,480,792, and The Immunoassay Handbook, David Wild, ed. Stockton Press, New York, 1994, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims.

[0077] The assay devices and methods known in the art can utilize labeled molecules in various sandwich, competitive, or non-competitive assay formats, to generate a signal that is related to the presence or amount of the biomarker of interest. Suitable assay formats also include chromatographic, mass spectrographic, and protein blotting methods. Additionally, certain methods and devices, such as biosensors and optical immunoassays, may be employed to determine the presence or amount of analytes without the need for a labeled molecule. See, e.g., U.S. Pat. Nos. 5,631,171; and 5,955,377, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims. One skilled in the art also recognizes that robotic instrumentation including but not limited to Beckman ACCESS, Abbott AXSYM, Roche ELECSYS, Dade Behring STRATUS systems are among the immunoassay analyzers that are capable of performing immunoassays. But any suitable immunoassay may be utilized, for example, enzyme-linked immunoassays (ELISA), radioimmunoassays (RIAs), competitive binding assays, and the like.

[0078] Antibodies or other polypeptides may be immobilized onto a variety of solid supports for use in assays. Solid phases that may be used to immobilize specific binding members include include those developed and/or used as solid phases in solid phase binding assays. Examples of suitable solid phases include membrane filters, cellulose-based papers, beads (including polymeric, latex and paramagnetic particles), glass, silicon wafers, microparticles, nanoparticles, TentaGels, AgroGels, PEGA gels, SPOCC gels, and multiple-well plates. An assay strip could be prepared by coating the antibody or a plurality of antibodies in an array on solid support. This strip could then be dipped into the test sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot. Antibodies or other polypeptides may be bound to specific zones of assay devices either by conjugating directly to an assay device surface, or by indirect binding. In an example of the later case, antibodies or other polypeptides may be immobilized on particles or other solid supports, and that solid support immobilized to the device surface.

[0079] Biological assays require methods for detection, and one of the most common methods for quantitation of results is to conjugate a detectable label to a protein or nucleic acid that has affinity for one of the components in the biological system being studied. Detectable labels may include molecules that are themselves detectable (e.g., fluorescent moieties, electrochemical labels, metal chelates, etc.) as well as molecules that may be indirectly detected by production of a detectable reaction product (e.g., enzymes such as horseradish peroxidase, alkaline phosphatase, etc.) or by a specific binding molecule which itself may be detectable (e.g., biotin, digoxigenin, maltose, oligohistidine, 2,4-dintrobenzene, phenylarsenate, ssDNA, dsDNA, etc.).

[0080] Preparation of solid phases and detectable label conjugates often comprise the use of chemical cross-linkers. Cross-linking reagents contain at least two reactive groups, and are divided generally into homofunctional cross-linkers (containing identical reactive groups) and heterofunctional cross-linkers (containing non-identical reactive groups). Homobifunctional cross-linkers that couple through amines, sulfhydryls or react non-specifically are available from many commercial sources. Maleimides, alkyl and aryl halides, alpha-haloacyls and pyridyl disulfides are thiol reactive groups. Maleimides, alkyl and aryl halides, and alpha-haloacyls react with sulfhydryls to form thiol ether bonds, while pyridyl disulfides react with sulfhydryls to produce mixed disulfides. The pyridyl disulfide product is cleavable. Imidoesters are also very useful for protein-protein cross-links. A variety of heterobifunctional cross-linkers, each combining different attributes for successful conjugation, are commercially available.

[0081] In certain aspects, the present invention provides kits for the analysis of the described kidney injury markers. The kit comprises reagents for the analysis of at least one test sample which comprise at least one antibody that a kidney injury marker. The kit can also include devices and instructions for performing one or more of the diagnostic and/or prognostic correlations described herein. Preferred kits will comprise an antibody pair for performing a sandwich assay, or a labeled species for performing a competitive assay, for the analyte. Preferably, an antibody pair comprises a first antibody conjugated to a solid phase and a second antibody conjugated to a detectable label, wherein each of the first and second antibodies that bind a kidney injury marker. Most preferably each of the antibodies are monoclonal antibodies. The instructions for use of the kit and performing the correlations can be in the form of labeling, which refers to any written or recorded material that is attached to, or otherwise accompanies a kit at any time during its manufacture, transport, sale or use. For example, the term labeling encompasses advertising leaflets and brochures, packaging materials, instructions, audio or video cassettes, computer discs, as well as writing imprinted directly on kits.

[0082] Antibodies

[0083] The term antibody as used herein refers to a peptide or polypeptide derived from, modeled after or substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, capable of specifically binding an antigen or epitope. See, e.g. Fundamental Immunology, 3rd Edition, W. E. Paul, ed., Raven Press, N.Y. (1993); Wilson (1994; J. Immunol. Methods 175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97. The term antibody includes antigen-binding portions, i.e., antigen binding sites, (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term antibody.

[0084] Antibodies used in the immunoassays described herein preferably specifically bind to a kidney injury marker of the present invention. The term specifically binds is not intended to indicate that an antibody binds exclusively to its intended target since, as noted above, an antibody binds to any polypeptide displaying the epitope(s) to which the antibody binds. Rather, an antibody specifically binds if its affinity for its intended target is about 5-fold greater when compared to its affinity for a non-target molecule which does not display the appropriate epitope(s). Preferably the affinity of the antibody will be at least about 5 fold, preferably 10 fold, more preferably 25-fold, even more preferably 50-fold, and most preferably 100-fold or more, greater for a target molecule than its affinity for a non-target molecule. In preferred embodiments, Preferred antibodies bind with affinities of at least about 10.sup.7 M.sup.1, and preferably between about 10.sup.8 M.sup.1 to about 10.sup.9 M.sup.1, about 10.sup.9 M.sup.1 to about 10.sup.10 M.sup.1, or about 1010 M.sup.1 to about 1012 M.sup.1.

[0085] Affinity is calculated as K.sub.d=k.sub.off/k.sub.on (k.sub.off is the dissociation rate constant, K.sub.on is the association rate constant and K.sub.d is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction bound (r) of labeled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r/c=K(nr): where r=moles of bound ligand/mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.

[0086] The term epitope refers to an antigenic determinant capable of specific binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.

[0087] Numerous publications discuss the use of phage display technology to produce and screen libraries of polypeptides for binding to a selected analyte. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87, 6378-82, 1990; Devlin et al., Science 249, 404-6, 1990, Scott and Smith, Science 249, 386-88, 1990; and Ladner et al., U.S. Pat. No. 5,571,698. A basic concept of phage display methods is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the phage particle, which displays a polypeptide as part of a capsid enclosing the phage genome which encodes the polypeptide. The establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target bind to the target and these phage are enriched by affinity screening to the target. The identity of polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means. See, e.g., U.S. Pat. No. 6,057,098, which is hereby incorporated in its entirety, including all tables, figures, and claims.

[0088] The antibodies that are generated by these methods may then be selected by first screening for affinity and specificity with the purified polypeptide of interest and, if required, comparing the results to the affinity and specificity of the antibodies with polypeptides that are desired to be excluded from binding. The screening procedure can involve immobilization of the purified polypeptides in separate wells of microtiter plates. The solution containing a potential antibody or groups of antibodies is then placed into the respective microtiter wells and incubated for about 30 min to 2 h. The microtiter wells are then washed and a labeled secondary antibody (for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies) is added to the wells and incubated for about 30 min and then washed. Substrate is added to the wells and a color reaction will appear where antibody to the immobilized polypeptide(s) are present.

[0089] The antibodies so identified may then be further analyzed for affinity and specificity in the assay design selected. In the development of immunoassays for a target protein, the purified target protein acts as a standard with which to judge the sensitivity and specificity of the immunoassay using the antibodies that have been selected. Because the binding affinity of various antibodies may differ; certain antibody pairs (e.g., in sandwich assays) may interfere with one another sterically, etc., assay performance of an antibody may be a more important measure than absolute affinity and specificity of an antibody.

[0090] Assay Correlations

[0091] The term correlating as used herein in reference to the use of biomarkers refers to comparing the presence or amount of the biomarker(s) in a patient to its presence or amount in persons known to suffer from, or known to be at risk of, a given condition; or in persons known to be free of a given condition. Often, this takes the form of comparing an assay result in the form of a biomarker concentration to a predetermined threshold selected to be indicative of the occurrence or nonoccurrence of a disease or the likelihood of some future outcome.

[0092] Selecting a diagnostic threshold involves, among other things, consideration of the probability of disease, distribution of true and false diagnoses at different test thresholds, and estimates of the consequences of treatment (or a failure to treat) based on the diagnosis. For example, when considering administering a specific therapy which is highly efficacious and has a low level of risk, few tests are needed because clinicians can accept substantial diagnostic uncertainty. On the other hand, in situations where treatment options are less effective and more risky, clinicians often need a higher degree of diagnostic certainty. Thus, cost/benefit analysis is involved in selecting a diagnostic threshold.

[0093] Suitable thresholds may be determined in a variety of ways. For example, one recommended diagnostic threshold for the diagnosis of acute myocardial infarction using cardiac troponin is the 97.5.sup.th percentile of the concentration seen in a normal population. Another method may be to look at serial samples from the same patient, where a prior baseline result is used to monitor for temporal changes in a biomarker level.

[0094] Population studies may also be used to select a decision threshold. Reciever Operating Characteristic (ROC) arose from the field of signal dectection therory developed during World War II for the analysis of radar images, and ROC analysis is often used to select a threshold able to best distinguish a diseased subpopulation from a nondiseased subpopulation. A false positive in this case occurs when the person tests positive, but actually does not have the disease. A false negative, on the other hand, occurs when the person tests negative, suggesting they are healthy, when they actually do have the disease. To draw a ROC curve, the true positive rate (TPR) and false positive rate (FPR) are determined as the decision threshold is varied continuously. Since TPR is equivalent with sensitivity and FPR is equal to 1specificity, the ROC graph is sometimes called the sensitivity vs (1specificity) plot. A perfect test will have an area under the ROC curve of 1.0; a random test will have an area of 0.5. A threshold is selected to provide an acceptable level of specificity and sensitivity.

[0095] In this context, diseased is meant to refer to a population having one characteristic (the presence of a disease or condition or the occurrence of some outcome) and nondiseased is meant to refer to a population lacking the characteristic. While a single decision threshold is the simplest application of such a method, multiple decision thresholds may be used. For example, below a first threshold, the absence of disease may be assigned with relatively high confidence, and above a second threshold the presence of disease may also be assigned with relatively high confidence. Between the two thresholds may be considered indeterminate. This is meant to be exemplary in nature only.

[0096] In addition to threshold comparisons, other methods for correlating assay results to a patient classification (occurrence or nonoccurrence of disease, likelihood of an outcome, etc.) include decision trees, rule sets, Bayesian methods, and neural network methods. These methods can produce probability values representing the degree to which a subject belongs to one classification out of a plurality of classifications.

[0097] Measures of test accuracy may be obtained as described in Fischer et al., Intensive Care Med. 29: 1043-51, 2003, and used to determine the effectiveness of a given biomarker. These measures include sensitivity and specificity, predictive values, likelihood ratios, diagnostic odds ratios, and ROC curve areas. The area under the curve (AUC) of a ROC plot is equal to the probability that a classifier will rank a randomly chosen positive instance higher than a randomly chosen negative one. The area under the ROC curve may be thought of as equivalent to the Mann-Whitney U test, which tests for the median difference between scores obtained in the two groups considered if the groups are of continuous data, or to the Wilcoxon test of ranks.

[0098] As discussed above, suitable tests may exhibit one or more of the following results on these various measures: a specificity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding sensitivity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; a sensitivity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding specificity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; at least 75% sensitivity, combined with at least 75% specificity; a ROC curve area of greater than 0.5, preferably at least 0.6, more preferably 0.7, still more preferably at least 0.8, even more preferably at least 0.9, and most preferably at least 0.95; an odds ratio different from 1, preferably at least about 2 or more or about 0.5 or less, more preferably at least about 3 or more or about 0.33 or less, still more preferably at least about 4 or more or about 0.25 or less, even more preferably at least about 5 or more or about 0.2 or less, and most preferably at least about 10 or more or about 0.1 or less; a positive likelihood ratio (calculated as sensitivity/(1-specificity)) of greater than 1, at least 2, more preferably at least 3, still more preferably at least 5, and most preferably at least 10; and or a negative likelihood ratio (calculated as (1-sensitivity)/specificity) of less than 1, less than or equal to 0.5, more preferably less than or equal to 0.3, and most preferably less than or equal to 0.1

[0099] Additional clinical indicia may be combined with the kidney injury marker assay result(s) of the present invention. These include other biomarkers related to renal status. Examples include the following, which recite the common biomarker name, followed by the Swiss-Prot entry number for that biomarker or its parent: Actin (P68133); Adenosine deaminase binding protein (DPP4, P27487); Alpha-1-acid glycoprotein 1 (P02763); Alpha-1-microglobulin (P02760); Albumin (P02768); Angiotensinogenase (Renin, P00797); Annexin A2 (P07355); Beta-glucuronidase (P08236); B-2-microglobulin (P61769); Beta-galactosidase (P16278); BMP-7 (P18075); Brain natriuretic peptide (proBNP, BNP-32, NTproBNP; P16860); Calcium-binding protein Beta (S100-beta, P04271); Carbonic anhydrase 9 (Q16790); Casein Kinase 2 (P68400); Clusterin (P10909); Complement C3 (P01024); Cysteine-rich protein (CYR61, 000622); Cytochrome C (P99999); Epidermal growth factor (EGF, P01133); Endothelin-1 (PO5305); Exosomal Fetuin-A (P02765); Fatty acid-binding protein, heart (FABP3, P05413); Fatty acid-binding protein, liver (P07148); Ferritin (light chain, P02792; heavy chain P02794); Fructose-1,6-biphosphatase (P09467); GRO-alpha (CXCL1, (P09341); Growth Hormone (P01241); Hepatocyte growth factor (P14210); Insulin-like growth factor I (P05019); Immunoglobulin G; Immunoglobulin Light Chains (Kappa and Lambda); Interferon gamma (P01579); Lysozyme (P61626); Interleukin-1 alpha (P01583); Interleukin-2 (P60568); Interleukin-4 (P05112); Interleukin-9 (P15248); Interleukin-12p40 (P29460); Interleukin-13 (P35225); Interleukin-16 (Q14005); L1 cell adhesion molecule (P32004); Lactate dehydrogenase (P00338); Leucine Aminopeptidase (P28838); Meprin A-alpha subunit (Q16819); Meprin A-beta subunit (Q16820); Midkine (P21741); MIP2-alpha (CXCL2, P19875); MMP-2 (P08253); MMP-9 (P14780); Netrin-1 (O95631); Neutral endopeptidase (P08473); Osteopontin (P10451); Renal papillary antigen 1 (RPA1); Renal papillary antigen 2 (RPA2); Retinol binding protein (P09455); Ribonuclease; S100 calcium-binding protein A6 (P06703); Serum Amyloid P Component (P02743); Sodium/Hydrogen exchanger isoform (NHE3, P48764); Spermidine/spermine Ni-acetyltransferase (P21673); TGF-Beta1 (P01137); Transferrin (P02787); Trefoil factor 3 (TFF3, Q07654); Toll-Like protein 4 (O00206); Total protein; Tubulointerstitial nephritis antigen (Q9UJW2); Uromodulin (Tamm-Horsfall protein, P07911).

[0100] For purposes of risk stratification, Adiponectin (Q15848); Alkaline phosphatase (P05186); Aminopeptidase N (P15144); CalbindinD28k (P05937); Cystatin C (P01034); 8 subunit of FIFO ATPase (P03928); Gamma-glutamyltransferase (P19440); GSTa (alpha-glutathione-S-transferase, P08263); GSTpi (Glutathione-S-transferase P; GST class-pi; P09211); IGFBP-1 (P08833); IGFBP-2 (P18065); IGFBP-6 (P24592); Integral membrane protein 1 (Itm1, P46977); Interleukin-6 (P05231); Interleukin-8 (P10145); Interleukin-18 (Q14116); IP-10 (10 kDa interferon-gamma-induced protein, P02778); IRPR (IFRD1, 000458); Isovaleryl-CoA dehydrogenase (IVD, P26440); I-TAC/CXCL11 (O14625); Keratin 19 (P08727); Kim-1 (Hepatitis A virus cellular receptor 1, Q96D42); L-arginine:glycine amidinotransferase (P50440); Leptin (P41159); Lipocalin2 (NGAL, P80188); MCP-1 (P13500); MIG (Gamma-interferon-induced monokine Q07325); MIP-1a (P10147); MIP-3a (P78556); MIP-1beta (P13236); MIP-1d (Q16663); NAG (N-acetyl-beta-D-glucosaminidase, P54802); Organic ion transporter (OCT2, 015244); Osteoprotegerin (O00300); P8 protein (O60356); Plasminogen activator inhibitor 1 (PAI-1, P05121); ProANP(1-98) (P01160); Protein phosphatase 1-beta (PPI-beta, P62140); Rab GDI-beta (P50395); Renal kallikrein (P06870); RT1.B-1 (alpha) chain of the integral membrane protein (Q5Y7A8); soluble tumor necrosis factor receptor superfamily member 1A (sTNFR-I, P19438); soluble tumor necrosis factor receptor superfamily member 1B (sTNFR-II, P20333); Tissue inhibitor of metalloproteinases 3 (TIMP-3, P35625); uPAR (Q03405) may be combined with the kidney injury marker assay result(s) of the present invention.

[0101] Other clinical indicia which may be combined with the kidney injury marker assay result(s) of the present invention includes demographic information (e.g., weight, sex, age, race), medical history (e.g., family history, type of surgery, pre-existing disease such as aneurism, congestive heart failure, preeclampsia, eclampsia, diabetes mellitus, hypertension, coronary artery disease, proteinuria, renal insufficiency, or sepsis, type of toxin exposure such as NSAIDs, cyclosporines, tacrolimus, aminoglycosides, foscarnet, ethylene glycol, hemoglobin, myoglobin, ifosfamide, heavy metals, methotrexate, radiopaque contrast agents, or streptozotocin), clinical variables (e.g., blood pressure, temperature, respiration rate), risk scores (APACHE score, PREDICT score, TIMI Risk Score for UA/NSTEMI, Framingham Risk Score), a urine total protein measurement, a glomerular filtration rate, an estimated glomerular filtration rate, a urine production rate, a serum or plasma creatinine concentration, a renal papillary antigen 1 (RPA1) measurement; a renal papillary antigen 2 (RPA2) measurement; a urine creatinine concentration, a fractional excretion of sodium, a urine sodium concentration, a urine creatinine to serum or plasma creatinine ratio, a urine specific gravity, a urine osmolality, a urine urea nitrogen to plasma urea nitrogen ratio, a plasma BUN to creatnine ratio, and/or a renal failure index calculated as urine sodium/(urine creatinine/plasma creatinine). Other measures of renal function which may be combined with the kidney injury marker assay result(s) are described hereinafter and in Harrison's Principles of Internal Medicine, 17.sup.th Ed., McGraw Hill, New York, pages 1741-1830, and Current Medical Diagnosis & Treatment 2008, 47.sup.th Ed, McGraw Hill, New York, pages 785-815, each of which are hereby incorporated by reference in their entirety.

[0102] Combining assay results/clinical indicia in this manner can comprise the use of multivariate logistical regression, loglinear modeling, neural network analysis, n-of-m analysis, decision tree analysis, etc. This list is not meant to be limiting.

[0103] Diagnosis of Acute Renal Failure

[0104] As noted above, the terms acute renal (or kidney) injury and acute renal (or kidney) failure as used herein are defined in part in terms of changes in serum creatinine from a baseline value. Most definitions of ARF have common elements, including the use of serum creatinine and, often, urine output. Patients may present with renal dysfunction without an available baseline measure of renal function for use in this comparison. In such an event, one may estimate a baseline serum creatinine value by assuming the patient initially had a normal GFR. Glomerular filtration rate (GFR) is the volume of fluid filtered from the renal (kidney) glomerular capillaries into the Bowman's capsule per unit time. Glomerular filtration rate (GFR) can be calculated by measuring any chemical that has a steady level in the blood, and is freely filtered but neither reabsorbed nor secreted by the kidneys. GFR is typically expressed in units of ml/min:

[00001] GFR = Urine .Math. .Math. Concentration Urine .Math. .Math. Flow Plasma .Math. .Math. Concentration

[0105] By normalizing the GFR to the body surface area, a GFR of approximately 75-100 ml/min per 1.73 m.sup.2 can be assumed. The rate therefore measured is the quantity of the substance in the urine that originated from a calculable volume of blood.

[0106] There are several different techniques used to calculate or estimate the glomerular filtration rate (GFR or eGFR). In clinical practice, however, creatinine clearance is used to measure GFR. Creatinine is produced naturally by the body (creatinine is a metabolite of creatine, which is found in muscle). It is freely filtered by the glomerulus, but also actively secreted by the renal tubules in very small amounts such that creatinine clearance overestimates actual GFR by 10-20%. This margin of error is acceptable considering the ease with which creatinine clearance is measured.

[0107] Creatinine clearance (CCr) can be calculated if values for creatinine's urine concentration (U.sub.Cr), urine flow rate (V), and creatinine's plasma concentration (P.sub.Cr) are known. Since the product of urine concentration and urine flow rate yields creatinine's excretion rate, creatinine clearance is also said to be its excretion rate (U.sub.CrV) divided by its plasma concentration. This is commonly represented mathematically as:

[00002] C Cr = U Cr V P Cr

[0108] Commonly a 24 hour urine collection is undertaken, from empty-bladder one morning to the contents of the bladder the following morning, with a comparative blood test then taken:

[00003] C Cr = U Cr 24 .Math. - .Math. hour .Math. .Math. volume P Cr 24 60 .Math. .Math. mins

[0109] To allow comparison of results between people of different sizes, the CCr is often corrected for the body surface area (BSA) and expressed compared to the average sized man as ml/min/1.73 m2. While most adults have a BSA that approaches 1.7 (1.6-1.9), extremely obese or slim patients should have their CCr corrected for their actual BSA:

[00004] C Cr .Math. - .Math. corrected = C Cr 1.73 BSA

[0110] The accuracy of a creatinine clearance measurement (even when collection is complete) is limited because as glomerular filtration rate (GFR) falls creatinine secretion is increased, and thus the rise in serum creatinine is less. Thus, creatinine excretion is much greater than the filtered load, resulting in a potentially large overestimation of the GFR (as much as a twofold difference). However, for clinical purposes it is important to determine whether renal function is stable or getting worse or better. This is often determined by monitoring serum creatinine alone. Like creatinine clearance, the serum creatinine will not be an accurate reflection of GFR in the non-steady-state condition of ARF. Nonetheless, the degree to which serum creatinine changes from baseline will reflect the change in GFR. Serum creatinine is readily and easily measured and it is specific for renal function.

[0111] For purposes of determining urine output on a Urine output on a mL/kg/hr basis, hourly urine collection and measurement is adequate. In the case where, for example, only a cumulative 24-h output was available and no patient weights are provided, minor modifications of the RIFLE urine output criteria have been described. For example, Bagshaw et al., Nephrol. Dial. Transplant. 23: 1203-1210, 2008, assumes an average patient weight of 70 kg, and patients are assigned a RIFLE classification based on the following: <35 mL/h (Risk), <21 mL/h (Injury) or <4 mL/h (Failure).

[0112] Selecting a Treatment Regimen

[0113] Once a diagnosis is obtained, the clinician can readily select a treatment regimen that is compatible with the diagnosis, such as initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, kidney transplantation, delaying or avoiding procedures that are known to be damaging to the kidney, modifying diuretic administration, initiating goal directed therapy, etc. The skilled artisan is aware of appropriate treatments for numerous diseases discussed in relation to the methods of diagnosis described herein. See, e.g., Merck Manual of Diagnosis and Therapy, 17th Ed. Merck Research Laboratories, Whitehouse Station, N J, 1999. In addition, since the methods and compositions described herein provide prognostic information, the markers of the present invention may be used to monitor a course of treatment. For example, improved or worsened prognostic state may indicate that a particular treatment is or is not efficacious.

[0114] One skilled in the art readily appreciates that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.

Example 1: Contrast-Induced Nephropathy Sample Collection

[0115] The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after receiving intravascular contrast media. Approximately 250 adults undergoing radiographic/angiographic procedures involving intravascular administration of iodinated contrast media are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0116] males and females 18 years of age or older;
undergoing a radiographic/angiographic procedure (such as a CT scan or coronary intervention) involving the intravascular administration of contrast media;
expected to be hospitalized for at least 48 hours after contrast administration.
able and willing to provide written informed consent for study participation and to comply with all study procedures.

Exclusion Criteria

[0117] renal transplant recipients;
acutely worsening renal function prior to the contrast procedure;
already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment;
expected to undergo a major surgical procedure (such as involving cardiopulmonary bypass) or an additional imaging procedure with contrast media with significant risk for further renal insult within the 48 hrs following contrast administration;
participation in an interventional clinical study with an experimental therapy within the previous 30 days;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

[0118] Immediately prior to the first contrast administration (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL) and a urine sample (10 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5), 8 (1), 24 (2) 48 (2), and 72 (2) hrs following the last administration of contrast media during the index contrast procedure. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

[0119] Serum creatinine is assessed at the site immediately prior to the first contrast administration (after any pre-procedure hydration) and at 4 (0.5), 8 (1), 24 (2) and 48 (2)), and 72 (2) hours following the last administration of contrast (ideally at the same time as the study samples are obtained). In addition, each patient's status is evaluated through day 30 with regard to additional serum and urine creatinine measurements, a need for dialysis, hospitalization status, and adverse clinical outcomes (including mortality).

[0120] Prior to contrast administration, each patient is assigned a risk based on the following assessment: systolic blood pressure <80 mm Hg=5 points; intra-arterial balloon pump=5 points; congestive heart failure (Class III-IV or history of pulmonary edema)=5 points; age >75 yrs=4 points; hematocrit level <39% for men, <35% for women=3 points; diabetes=3 points; contrast media volume=1 point for each 100 mL; serum creatinine level >1.5 g/dL=4 points OR estimated GFR 40-60 mL/min/1.73 m.sup.2=2 points, 20-40 mL/min/1.73 m.sup.2=4 points, <20 mL/min/1.73 m.sup.2=6 points. The risks assigned are as follows: risk for CIN and dialysis: 5 or less total points=risk of CIN7.5%, risk of dialysis0.04%; 6-10 total points=risk of CIN14%, risk of dialysis0.12%; 11-16 total points=risk of CIN26.1%, risk of dialysis1.09%; >16 total points=risk of CIN57.3%, risk of dialysis12.8%.

Example 2: Cardiac Surgery Sample Collection

[0121] The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after undergoing cardiovascular surgery, a procedure known to be potentially damaging to kidney function. Approximately 900 adults undergoing such surgery are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0122] males and females 18 years of age or older;
undergoing cardiovascular surgery;
Toronto/Ottawa Predictive Risk Index for Renal Replacement risk score of at least 2 (Wijeysundera et al., JAMA 297: 1801-9, 2007); and
able and willing to provide written informed consent for study participation and to comply with all study procedures.

Exclusion Criteria

[0123] known pregnancy;
previous renal transplantation;
acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria);
already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment;
currently enrolled in another clinical study or expected to be enrolled in another clinical study within 7 days of cardiac surgery that involves drug infusion or a therapeutic intervention for AKI;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

[0124] Within 3 hours prior to the first incision (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL), whole blood (3 mL), and a urine sample (35 mL) are collected from each patient. Blood and urine samples are then collected at 3 (0.5), 6 (0.5), 12 (1), 24 (2) and 48 (2) hrs following the procedure and then daily on days 3 through 7 if the subject remains in the hospital. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

Example 3: Acutely Ill Subject Sample Collection

[0125] The objective of this study is to collect samples from acutely ill patients. Approximately 2200 adults expected to be in the ICU for at least 48 hours will be enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0126] males and females 18 years of age or older;
Study population 1: approximately 300 patients that have at least one of:
shock (SBP<90 mmHg and/or need for vasopressor support to maintain MAP>60 mmHg and/or documented drop in SBP of at least 40 mmHg); and
sepsis;
Study population 2: approximately 300 patients that have at least one of:
IV antibiotics ordered in computerized physician order entry (CPOE) within 24 hours of enrollment;
contrast media exposure within 24 hours of enrollment;
increased Intra-Abdominal Pressure with acute decompensated heart failure; and
severe trauma as the primary reason for ICU admission and likely to be hospitalized in the ICU for 48 hours after enrollment;
Study population 3: approximately 300 patients expected to be hospitalized through acute care setting (ICU or ED) with a known risk factor for acute renal injury (e.g. sepsis, hypotension/shock (Shock=systolic BP<90 mmHg and/or the need for vasopressor support to maintain a MAP>60 mmHg and/or a documented drop in SBP>40 mmHg), major trauma, hemorrhage, or major surgery); and/or expected to be hospitalized to the ICU for at least 24 hours after enrollment;
Study population 4: approximately 1000 patients that are 21 years of age or older, within 24 hours of being admitted into the ICU, expected to have an indwelling urinary catheter for at least 48 hours after enrollment, and have at least one of the following acute conditions within 24 hours prior to enrollment:
(i) respiratory SOFA score of >2 (PaO2/FiO2<300), (ii) cardiovascular SOFA score of >1 (MAP<70 mm Hg and/or any vasopressor required).
Study population 5: approximately 300 patients that are 21 years of age or older, receiving care in the ICU, have an indwelling urinary catheter as standard care at the time of enrollment, have acute kidney injury (KDIGO stage 2 or stage 3) at the time of the first sample collection, and have their first sample collected within 36 hours of meeting KDIGO stage 2 criteria

Exclusion Criteria

[0127] known pregnancy;
prisoners or institutionalized individuals;
previous renal transplantation;
comfort-measures-only status for study population 5;
known acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria) for study populations 1, 2, 3, and 4;
received dialysis (either acute or chronic) within 5 days prior to enrollment or in imminent need of dialysis at the time of enrollment;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus; meets any of the following in study populations 4 and 5: [0128] (i) active bleeding with an anticipated need for >4 units PRBC in a day; [0129] (ii) hemoglobin <7 g/dL; [0130] (iii) any other condition that in the physician's opinion would contraindicate drawing serial blood samples for clinical study purposes;
meets only the SBP <90 mmHg inclusion criterion set forth above, and does not have shock in the attending physician's or principal investigator's opinion.

[0131] After obtaining informed consent, an EDTA anti-coagulated blood sample (10 mL) and a urine sample (25-50 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5) and 8 (1) hours after contrast administration (if applicable); at 12 (1), 24 (2), 36 (2), 48 (2), 60 (2), 72 (2), and 84 (2) hours after enrollment, and thereafter daily up to day 7 to day 14 while the subject is hospitalized. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

Example 4. Immunoassay Format

[0132] Analytes are measured using standard sandwich enzyme immunoassay techniques. A first antibody which binds the analyte is immobilized in wells of a 96 well polystyrene microplate. Analyte standards and test samples are pipetted into the appropriate wells and any analyte present is bound by the immobilized antibody. After washing away any unbound substances, a horseradish peroxidase-conjugated second antibody which binds the analyte is added to the wells, thereby forming sandwich complexes with the analyte (if present) and the first antibody. Following a wash to remove any unbound antibody-enzyme reagent, a substrate solution comprising tetramethylbenzidine and hydrogen peroxide is added to the wells. Color develops in proportion to the amount of analyte present in the sample. The color development is stopped and the intensity of the color is measured at 540 nm or 570 nm. An analyte concentration is assigned to the test sample by comparison to a standard curve determined from the analyte standards.

[0133] Table of Swiss-Prot numbers, preferred names and units for the analytes in the examples below.

TABLE-US-00016 Swiss-Prot Number Preferred Name Units P01033 Metalloproteinase inhibitor 1 pg/ml P16035 Metalloproteinase inhibitor 2 pg/ml Q99727 Metalloproteinase inhibitor 4 pg/ml Q16663 C-C motif chemokine 15 pg/ml P55774 C-C motif chemokine 18 ng/ml P55773 C-C motif chemokine 23 ng/ml O00175 C-C motif chemokine 24 pg/ml

Example 5. Apparently Healthy Donor and Chronic Disease Patient Samples

[0134] Human urine samples from donors with no known chronic or acute disease (Apparently Healthy Donors) were purchased from two vendors (Golden West Biologicals, Inc., 27625 Commerce Center Dr., Temecula, Calif. 92590 and Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454). The urine samples were shipped and stored frozen at less than 20 C. The vendors supplied demographic information for the individual donors including gender, race (Black/White), smoking status and age.

[0135] Human urine samples from donors with various chronic diseases (Chronic Disease Patients) including congestive heart failure, coronary artery disease, chronic kidney disease, chronic obstructive pulmonary disease, diabetes mellitus and hypertension were purchased from Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454. The urine samples were shipped and stored frozen at less than 20 degrees centigrade. The vendor provided a case report form for each individual donor with age, gender, race (Black/White), smoking status and alcohol use, height, weight, chronic disease(s) diagnosis, current medications and previous surgeries.

Example 6. Use of Metalloproteinase Inhibitor 1 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0136] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 1 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0137] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0138] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00017 TABLE 6.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 5950 17800 5970 17700 5950 17300 Average 9410 33100 8890 32200 8800 31800 Stdev 9010 35200 7930 34800 8170 34600 p (t-test) 8.0E7 8.9E6 3.1E5 Min 634 297 634 297 634 297 Max 39400 146000 32600 146000 32600 146000 n (Patient) 57 260 46 271 41 276 sCr only Median 7940 18500 7940 18100 7940 18100 Average 12800 33700 13000 33500 11700 33500 Stdev 16300 35700 16400 35600 11300 35800 p (t-test) 1.3E6 2.7E6 8.7E7 Min 634 297 634 297 634 297 Max 116000 146000 116000 146000 65500 146000 n (Patient) 76 240 74 242 70 246 UO only Median 10800 21300 9980 20500 9520 20800 Average 23500 37700 23000 36200 22100 35700 Stdev 30800 35700 30600 35400 29800 35400 p (t-test) 2.2E4 4.4E4 2.7E4 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 127000 146000 n (Patient) 194 121 173 142 156 159 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.75 0.70 0.66 0.75 0.69 SE 0.031 0.032 0.032 0.033 0.032 p Value 2.2E16 2.7E10 7.5E7 6.6E14 2.2E9 nCohort 57 76 194 46 74 Recovered nCohort Non- 260 240 121 271 242 recovered Cutoff Quartile 2 6030 6020 6080 6030 6020 Sensitivity 82% 81% 88% 80% 81% Specificity 54% 43% 34% 52% 43% Cutoff Quartile 3 14200 14100 14200 14200 14100 Sensitivity 58% 58% 66% 56% 58% Specificity 84% 76% 60% 87% 76% Cutoff Quartile 4 35900 35400 36300 35900 35400 Sensitivity 30% 31% 35% 30% 31% Specificity 98% 95% 81% 100% 95% OR Quartile 2 5.27 3.24 3.85 4.28 3.16 p Value 8.6E8 3.5E5 2.9E5 1.1E5 5.5E5 Lower limit of 2.87 1.86 2.05 2.24 1.81 95% CI Upper limit of 9.67 5.64 7.24 8.21 5.53 95% CI OR Quartile 3 7.27 4.51 2.90 8.64 4.27 p Value 2.4E7 5.1E7 1.0E5 2.1E6 1.4E6 Lower limit of 3.42 2.51 1.81 3.55 2.37 95% CI Upper limit of 15.4 8.12 4.66 21.1 7.70 95% CI OR Quartile 4 24.4 8.18 2.26 39.1 7.86 p Value 0.0017 7.8E5 0.0021 0.010 1.1E4 Lower limit of 3.32 2.88 1.34 2.38 2.77 95% CI Upper limit of 180 23.2 3.79 642 22.3 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.65 0.75 0.70 0.66 SE 0.031 0.035 0.032 0.030 p Value 8.9E7 2.7E13 8.0E10 1.2E7 nCohort 173 41 70 156 Recovered nCohort Non- 142 276 246 159 recovered Cutoff Quartile 2 6080 6030 6020 6080 Sensitivity 86% 79% 80% 85% Specificity 34% 54% 43% 35% Cutoff Quartile 3 14200 14200 14100 14200 Sensitivity 63% 56% 58% 63% Specificity 61% 88% 77% 63% Cutoff Quartile 4 36300 35900 35400 36300 Sensitivity 33% 29% 31% 33% Specificity 82% 100% 96% 83% OR Quartile 2 3.16 4.45 3.02 3.06 p Value 7.2E5 1.7E5 1.4E4 5.6E5 Lower limit of 1.79 2.25 1.71 1.78 95% CI Upper limit of 5.57 8.78 5.32 5.28 95% CI OR Quartile 3 2.67 9.09 4.61 2.86 p Value 2.6E5 7.4E6 1.0E6 6.4E6 Lower limit of 1.69 3.46 2.50 1.81 95% CI Upper limit of 4.22 23.9 8.50 4.52 95% CI OR Quartile 4 2.18 34.0 9.98 2.50 p Value 0.0033 0.014 1.5E4 7.9E4 Lower limit of 1.30 2.07 3.04 1.46 95% CI Upper limit of 3.66 559 32.7 4.27 95% CI

TABLE-US-00018 TABLE 6.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 6460 20500 6980 19000 6510 18500 Average 13400 34900 14200 33700 14400 33000 Stdev 18900 35800 19900 35500 20800 35100 p (t-test) 1.2E-7 5.1E-6 2.7E-5 Min 634 297 634 297 634 297 Max 110000 146000 110000 146000 110000 146000 n (Patient) 90 227 79 238 71 246 sCr only Median 8310 20500 8310 20000 8210 19800 Average 15500 35500 15700 35200 14700 35200 Stdev 21000 36300 21100 36300 19000 36400 p (t-test) 2.9E-7 6.5E-7 2.4E-7 Min 634 297 634 297 634 297 Max 116000 146000 116000 146000 110000 146000 n (Patient) 106 211 104 213 99 218 UO only Median 11200 20500 11000 19200 11000 19300 Average 25400 36200 25900 33900 25000 34000 Stdev 31900 35500 32300 34700 31500 35300 p (t-test) 0.0071 0.039 0.017 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 127000 146000 n (Patient) 212 103 194 121 178 137 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.74 0.70 0.64 0.71 0.69 SE 0.029 0.030 0.034 0.031 0.030 p Value 2.2E16 1.5E11 5.3E5 4.3E12 1.2E10 nCohort 90 106 212 79 104 Recovered nCohort Non- 227 211 103 238 213 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 Sensitivity 85% 84% 90% 82% 84% Specificity 49% 42% 33% 47% 42% Cutoff Quartile 3 14200 14200 14200 14200 14200 Sensitivity 61% 62% 67% 59% 61% Specificity 78% 73% 58% 76% 72% Cutoff Quartile 4 35900 35900 36300 35900 35900 Sensitivity 32% 33% 31% 31% 33% Specificity 92% 91% 78% 91% 90% OR Quartile 2 5.25 3.84 4.49 4.11 3.73 p Value 3.1E9 7.1E7 3.7E5 5.6E7 1.2E6 Lower limit of 3.03 2.26 2.20 2.36 2.19 95% CI Upper limit of 9.08 6.54 9.15 7.15 6.35 95% CI OR Quartile 3 5.53 4.26 2.80 4.51 4.05 p Value 2.8E9 2.4E8 4.1E5 3.1E7 7.4E8 Lower limit of 3.14 2.56 1.71 2.53 2.43 95% CI Upper limit of 9.72 7.09 4.59 8.03 6.74 95% CI OR Quartile 4 5.62 4.77 1.58 4.55 4.60 p Value 3.7E5 1.7E5 0.089 3.1E4 2.6E5 Lower limit of 2.48 2.34 0.933 2.00 2.26 95% CI Upper limit of 12.8 9.71 2.68 10.4 9.38 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.61 0.71 0.70 0.62 SE 0.033 0.032 0.030 0.032 p Value 5.9E4 1.8E11 2.2E11 2.6E4 nCohort 194 71 99 178 Recovered nCohort Non- 121 246 218 137 recovered Cutoff Quartile 2 6080 6030 6030 6080 Sensitivity 87% 82% 83% 85% Specificity 32% 48% 42% 33% Cutoff Quartile 3 14200 14200 14200 14200 Sensitivity 61% 58% 61% 61% Specificity 57% 77% 74% 58% Cutoff Quartile 4 36300 35900 35900 36300 Sensitivity 29% 30% 33% 31% Specificity 77% 90% 91% 79% OR Quartile 2 3.16 4.10 3.60 2.67 p Value 2.0E4 1.0E6 2.4E6 6.0E4 Lower limit of 1.72 2.33 2.12 1.52 95% CI Upper limit of 5.78 7.23 6.14 4.68 95% CI OR Quartile 3 2.06 4.77 4.39 2.11 p Value 0.0022 5.5E7 3.1E8 0.0013 Lower limit of 1.30 2.59 2.60 1.34 95% CI Upper limit of 3.28 8.80 7.42 3.32 95% CI OR Quartile 4 1.39 3.86 4.83 1.68 p Value 0.21 0.0014 3.1E5 0.046 Lower limit of 0.827 1.69 2.30 1.01 95% CI Upper limit of 2.33 8.82 10.1 2.81 95% CI

TABLE-US-00019 TABLE 6.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 7170 20500 7180 20200 7150 19300 Average 15100 36500 15400 35700 15800 34600 Stdev 20200 36700 20700 36400 21500 36000 p (t-test) 1.9E8 1.9E7 2.6E6 Min 475 297 475 297 475 297 Max 110000 146000 110000 146000 110000 146000 n (Patient) 114 203 107 210 97 220 sCr only Median 8610 20500 8810 20000 8610 19800 Average 16800 36900 17100 36400 16300 36300 Stdev 21800 37100 22000 37100 20400 37200 p (t-test) 8.2E8 3.2E7 1.3E7 Min 475 297 475 297 475 297 Max 116000 146000 116000 146000 110000 146000 n (Patient) 127 190 124 193 119 198 UO only Median 11600 20500 11500 19400 11000 20500 Average 26000 35300 25900 34500 24700 35300 Stdev 32000 35500 32000 35400 31000 35900 p (t-test) 0.021 0.030 0.0057 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 127000 146000 n (Patient) 214 101 204 111 190 125 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.72 0.69 0.62 0.71 0.68 SE 0.028 0.029 0.035 0.029 0.030 p Value 1.6E15 2.6E11 6.7E4 2.9E13 9.0E10 nCohort 114 127 214 107 124 Recovered nCohort Non- 203 190 101 210 193 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 Sensitivity 87% 86% 87% 85% 85% Specificity 46% 41% 31% 45% 40% Cutoff Quartile 3 14200 14200 14200 14200 14200 Sensitivity 64% 63% 64% 62% 62% Specificity 74% 69% 57% 73% 69% Cutoff Quartile 4 35900 35900 36300 35900 35900 Sensitivity 34% 35% 30% 33% 34% Specificity 90% 89% 77% 90% 89% OR Quartile 2 5.47 4.19 3.02 4.70 3.82 p Value 1.2E9 2.0E7 8.7E4 1.8E8 8.4E7 Lower limit of 3.16 2.44 1.57 2.74 2.24 95% CI Upper limit of 9.45 7.18 5.79 8.05 6.51 95% CI OR Quartile 3 4.88 3.87 2.35 4.37 3.58 p Value 7.9E10 3.0E8 6.1E4 1.4E8 1.7E7 Lower limit of 2.94 2.40 1.44 2.63 2.22 95% CI Upper limit of 8.09 6.24 3.83 7.27 5.78 95% CI OR Quartile 4 4.82 4.30 1.42 4.27 4.08 p Value 7.0E6 5.9E6 0.19 3.5E5 1.2E5 Lower limit of 2.43 2.29 0.835 2.15 2.17 95% CI Upper limit of 9.58 8.07 2.42 8.49 7.67 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.61 0.70 0.69 0.63 SE 0.034 0.030 0.030 0.033 p Value 0.0013 6.9E12 2.9E10 1.2E4 nCohort 204 97 119 190 Recovered nCohort Non- 111 220 198 125 recovered Cutoff Quartile 2 6080 6030 6030 6080 Sensitivity 86% 84% 84% 85% Specificity 31% 45% 40% 32% Cutoff Quartile 3 14200 14200 14200 14200 Sensitivity 62% 60% 62% 62% Specificity 56% 73% 70% 58% Cutoff Quartile 4 36300 35900 35900 36300 Sensitivity 29% 31% 34% 32% Specificity 77% 89% 89% 79% OR Quartile 2 2.65 4.39 3.64 2.57 p Value 0.0016 7.5E8 1.8E6 0.0013 Lower limit of 1.45 2.56 2.14 1.45 95% CI Upper limit of 4.87 7.52 6.19 4.58 95% CI OR Quartile 3 2.12 4.17 3.78 2.28 p Value 0.0018 9.2E8 7.8E8 4.7E4 Lower limit of 1.32 2.47 2.33 1.44 95% CI Upper limit of 3.41 7.05 6.14 3.62 95% CI OR Quartile 4 1.35 3.57 4.17 1.82 p Value 0.26 2.9E4 1.5E5 0.022 Lower limit of 0.801 1.79 2.18 1.09 95% CI Upper limit of 2.29 7.12 7.96 3.05 95% CI

TABLE-US-00020 TABLE 6.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 8180 22000 8150 21100 7940 20000 Average 15800 38300 16200 37000 16600 35700 Stdev 21300 37200 21900 36900 22700 36300 p (t-test) 1.1E9 2.9E8 6.2E7 Min 419 297 419 297 419 297 Max 111000 146000 111000 146000 111000 146000 n (Patient) 134 183 125 192 114 203 sCr only Median 8710 21900 8740 21300 8730 21600 Average 17200 38000 17400 37700 16600 37900 Stdev 22900 37300 23000 37200 21600 37500 p (t-test) 1.6E8 4.2E8 9.3E9 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 111000 146000 n (Patient) 140 177 138 179 135 182 UO only Median 11600 21300 11200 20300 11000 20500 Average 25600 36300 25600 35400 24600 35900 Stdev 31900 35600 31800 35600 30800 36300 p (t-test) 0.0076 0.013 0.0032 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 127000 146000 n (Patient) 216 99 207 108 194 121 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.73 0.71 0.63 0.72 0.70 SE 0.028 0.029 0.035 0.028 0.029 p Value 0 3.9E13 1.9E4 2.8E14 4.1E12 nCohort 134 140 216 125 138 Recovered nCohort Non- 183 177 99 192 179 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 Sensitivity 88% 87% 88% 86% 87% Specificity 43% 40% 31% 42% 40% Cutoff Quartile 3 14200 14200 14200 14200 14200 Sensitivity 67% 66% 66% 64% 65% Specificity 72% 69% 57% 71% 69% Cutoff Quartile 4 35900 35900 36300 35900 35900 Sensitivity 37% 36% 33% 35% 36% Specificity 90% 89% 79% 90% 88% OR Quartile 2 5.42 4.46 3.26 4.70 4.28 p Value 3.8E9 1.2E7 5.3E4 2.6E8 2.1E7 Lower limit of 3.09 2.57 1.67 2.73 2.47 95% CI Upper limit of 9.50 7.76 6.36 8.10 7.41 95% CI OR Quartile 3 5.24 4.29 2.53 4.41 4.07 p Value 2.8E11 1.8E9 2.4E4 2.3E9 6.2E9 Lower limit of 3.22 2.67 1.54 2.71 2.53 95% CI Upper limit of 8.54 6.89 4.15 7.17 6.53 95% CI OR Quartile 4 5.38 4.39 1.85 4.62 4.24 p Value 3.4E7 1.6E6 0.023 3.5E6 2.7E6 Lower limit of 2.82 2.40 1.09 2.42 2.32 95% CI Upper limit of 10.3 8.03 3.14 8.81 7.76 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.62 0.71 0.71 0.63 SE 0.034 0.029 0.029 0.033 p Value 2.7E4 6.0E13 5.8E13 6.7E5 nCohort 207 114 135 194 Recovered nCohort Non- 108 203 182 121 recovered Cutoff Quartile 2 6080 6030 6030 6080 Sensitivity 88% 85% 86% 86% Specificity 32% 43% 40% 32% Cutoff Quartile 3 14200 14200 14200 14200 Sensitivity 63% 63% 65% 63% Specificity 57% 72% 70% 58% Cutoff Quartile 4 36300 35900 35900 36300 Sensitivity 31% 33% 36% 33% Specificity 78% 89% 89% 80% OR Quartile 2 3.42 4.35 4.19 2.87 p Value 2.0E4 7.9E8 2.6E7 5.1E4 Lower limit of 1.79 2.54 2.43 1.58 95% CI Upper limit of 6.55 7.43 7.22 5.21 95% CI OR Quartile 3 2.21 4.28 4.23 2.31 p Value 0.0011 1.0E8 3.1E9 4.4E4 Lower limit of 1.37 2.60 2.62 1.45 95% CI Upper limit of 3.56 7.04 6.81 3.68 95% CI OR Quartile 4 1.65 3.83 4.44 1.96 p Value 0.060 4.8E5 2.1E6 0.011 Lower limit of 0.980 2.00 2.40 1.17 95% CI Upper limit of 2.79 7.31 8.23 3.29 95% CI

TABLE-US-00021 TABLE 6.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 20800 10000 20700 10000 20700 Average 22100 38700 22200 38200 22200 38200 Stdev 28300 37600 28500 37300 28500 37300 p (t-test) 9.9E6 2.0E5 2.0E5 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 188 129 185 132 185 132 sCr only Median 9400 22000 9350 22000 9330 22000 Average 18800 39100 18900 38600 18300 39000 Stdev 24400 37900 24600 37700 23400 38100 p (t-test) 3.0E8 8.7E8 1.5E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 111000 146000 n (Patient) 160 157 157 160 156 161 UO only Median 11300 21500 11600 20800 11300 21100 Average 24300 38300 24500 37500 24500 37300 Stdev 29900 38000 30100 37800 30200 37400 p (t-test) 4.4E4 0.0010 0.0012 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 211 104 208 107 205 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.70 0.64 0.66 0.69 0.63 0.66 0.70 0.63 SE 0.032 0.029 0.034 0.031 0.029 0.034 0.031 0.029 0.034 p Value 3.5E7 1.9E11 5.5E5 3.6E7 8.3E11 1.1E4 3.6E7 1.5E11 9.6E5 nCohort 188 160 211 185 157 208 185 156 205 Recovered nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 6080 6030 6030 6080 Sensitivity 87% 88% 87% 87% 88% 87% 87% 88% 86% Specificity 33% 38% 31% 34% 38% 31% 34% 38% 31% Cutoff Quartile 3 14200 14200 14200 14200 14200 14200 14200 14200 14200 Sensitivity 66% 66% 65% 65% 66% 64% 65% 66% 64% Specificity 61% 66% 57% 61% 66% 57% 61% 66% 57% Cutoff Quartile 4 35900 35900 36300 35900 35900 36300 35900 35900 36300 Sensitivity 37% 37% 35% 36% 36% 34% 36% 37% 34% Specificity 83% 86% 80% 83% 86% 79% 83% 87% 80% OR Quartile 2 3.24 4.36 2.86 3.41 4.21 3.02 3.41 4.29 2.87 p Value 1.0E4 5.6E7 0.0012 5.1E5 7.3E7 6.3E4 5.1E5 5.4E7 8.4E4 Lower limit of 1.79 2.45 1.52 1.88 2.39 1.60 1.88 2.43 1.55 95% CI Upper limit of 5.87 7.76 5.40 6.17 7.44 5.69 6.17 7.58 5.34 95% CI OR Quartile 3 2.98 3.75 2.54 2.87 3.64 2.29 2.87 3.75 2.33 p Value 4.7E6 2.5E8 1.8E4 8.5E6 4.6E8 7.3E4 8.5E6 2.5E8 5.2E4 Lower limit of 1.87 2.35 1.56 1.80 2.29 1.41 1.80 2.35 1.44 95% CI Upper limit of 4.75 5.96 4.13 4.56 5.79 3.69 4.56 5.96 3.75 95% CI OR Quartile 4 2.89 3.67 2.07 2.73 3.49 1.95 2.73 3.72 1.97 p Value 6.7E5 4.2E6 0.0066 1.5E4 9.8E6 0.013 1.5E4 4.4E6 0.011 Lower limit of 1.71 2.11 1.22 1.62 2.01 1.15 1.62 2.12 1.17 95% CI Upper limit of 4.87 6.40 3.50 4.60 6.07 3.28 4.60 6.51 3.31 95% CI

TABLE-US-00022 TABLE 6.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 253000 499000 245000 494000 245000 472000 Average 314000 530000 280000 527000 285000 523000 Stdev 213000 274000 171000 275000 178000 275000 p (t-test) 1.5E7 3.4E8 3.8E7 Min 66700 13600 66700 13600 66700 13600 Max 975000 1120000 872000 1120000 872000 1120000 n (Patient) 52 275 42 285 38 289 sCr only Median 257000 519000 257000 519000 257000 511000 Average 341000 535000 333000 535000 341000 530000 Stdev 237000 270000 231000 270000 236000 271000 p (t-test) 1.1E7 4.6E8 5.7E7 Min 66700 13600 66700 13600 66700 13600 Max 950000 1120000 950000 1120000 950000 1120000 n (Patient) 69 257 67 259 63 263 UO only Median 359000 582000 343000 586000 342000 567000 Average 431000 598000 413000 596000 411000 580000 Stdev 248000 287000 239000 285000 241000 283000 p (t-test) 5.3E8 1.1E9 1.9E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 197 128 176 149 159 166 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.74 0.72 0.67 0.78 0.73 SE 0.032 0.031 0.031 0.032 0.031 p Value 7.8E14 4.5E13 8.1E8 0 3.7E14 nCohort 52 69 197 42 67 Recovered nCohort Non- 275 257 128 285 259 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 80% 82% 84% 80% 82% Specificity 52% 51% 31% 57% 52% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 56% 57% 62% 55% 57% Specificity 81% 75% 58% 83% 76% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 28% 29% 41% 28% 29% Specificity 92% 88% 85% 98% 90% OR Quartile 2 4.32 4.60 2.42 5.22 4.93 p Value 3.6E6 1.4E7 0.0021 1.7E6 5.1E8 Lower limit of 2.33 2.61 1.38 2.65 2.78 95% CI Upper limit of 8.02 8.12 4.26 10.3 8.76 95% CI OR Quartile 3 5.35 4.02 2.29 6.13 4.18 p Value 6.7E6 5.6E6 3.7E4 2.6E5 4.8E6 Lower limit of 2.58 2.21 1.45 2.64 2.27 95% CI Upper limit of 11.1 7.34 3.61 14.3 7.72 95% CI OR Quartile 4 4.75 3.08 4.09 16.3 3.49 p Value 0.0037 0.0049 1.7E7 0.0063 0.0030 Lower limit of 1.66 1.41 2.41 2.20 1.53 95% CI Upper limit of 13.6 6.76 6.94 120 7.99 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.69 0.77 0.72 0.68 SE 0.030 0.034 0.032 0.030 p Value 5.0E10 6.9E15 1.3E11 3.1E9 nCohort 176 38 63 159 Recovered nCohort Non- 149 289 263 166 recovered Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 85% 79% 81% 85% Specificity 33% 58% 51% 35% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 63% 54% 56% 60% Specificity 61% 82% 75% 60% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 40% 28% 29% 37% Specificity 88% 97% 89% 87% OR Quartile 2 2.69 5.25 4.40 3.07 p Value 3.6E4 3.9E6 6.1E7 4.1E5 Lower limit of 1.56 2.60 2.46 1.79 95% CI Upper limit of 4.64 10.6 7.87 5.24 95% CI OR Quartile 3 2.65 5.27 3.72 2.19 p Value 2.2E5 1.3E4 3.0E5 5.2E4 Lower limit of 1.69 2.25 2.01 1.41 95% CI Upper limit of 4.16 12.4 6.90 3.42 95% CI OR Quartile 4 4.72 14.4 3.19 4.14 p Value 4.0E8 0.0090 0.0061 8.0E7 Lower limit of 2.71 1.94 1.39 2.36 95% CI Upper limit of 8.21 107 7.32 7.29 95% CI

TABLE-US-00023 TABLE 6.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 279000 525000 277000 499000 279000 490000 Average 363000 543000 366000 534000 370000 529000 Stdev 233000 275000 239000 275000 245000 275000 p (t-test) 1.0E7 2.4E6 1.7E5 Min 66700 13600 66700 13600 66700 13600 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 87 240 76 251 69 258 sCr only Median 282000 528000 282000 528000 291000 521000 Average 380000 547000 376000 547000 382000 541000 Stdev 248000 273000 245000 273000 249000 274000 p (t-test) 3.0E7 1.7E7 1.8E6 Min 66700 13600 66700 13600 66700 13600 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 101 226 99 228 94 233 UO only Median 371000 598000 369000 576000 371000 534000 Average 437000 617000 434000 595000 433000 578000 Stdev 250000 287000 248000 289000 245000 292000 p (t-test) 1.4E8 1.9E7 1.8E6 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 217 108 198 127 181 144 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.70 0.69 0.68 0.69 0.69 SE 0.030 0.030 0.033 0.032 0.030 p Value 4.7E11 4.8E10 1.9E8 4.3E9 1.6E10 nCohort 87 101 217 76 99 Recovered nCohort Non- 240 226 108 251 228 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 81% 82% 87% 80% 82% Specificity 43% 42% 31% 43% 42% Cutoff Quartile 3 437000 437000 437000 437000 437000 Sensitivity 57% 58% 65% 56% 58% Specificity 70% 67% 57% 68% 68% Cutoff Quartile 4 707000 707000 708000 707000 707000 Sensitivity 30% 31% 44% 29% 31% Specificity 90% 87% 84% 89% 88% OR Quartile 2 3.21 3.31 3.00 3.16 3.46 p Value 1.9E5 7.2E6 6.5E4 4.1E5 3.5E6 Lower limit of 1.88 1.96 1.60 1.82 2.05 95% CI Upper limit of 5.47 5.58 5.64 5.49 5.85 95% CI OR Quartile 3 3.17 2.84 2.46 2.73 2.88 p Value 1.7E5 3.3E5 2.3E4 2.9E4 3.0E5 Lower limit of 1.88 1.74 1.52 1.59 1.75 95% CI Upper limit of 5.37 4.65 3.96 4.71 4.73 95% CI OR Quartile 4 3.79 2.98 4.01 3.55 3.21 p Value 4.4E4 9.7E4 2.2E7 0.0015 5.9E4 Lower limit of 1.80 1.56 2.37 1.63 1.65 95% CI Upper limit of 7.96 5.68 6.77 7.76 6.25 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.66 0.68 0.68 0.65 SE 0.031 0.033 0.031 0.031 p Value 2.4E7 6.9E8 7.1E9 2.1E6 nCohort 198 69 94 181 Recovered nCohort Non- 127 258 233 144 recovered Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 85% 80% 82% 84% Specificity 31% 43% 41% 32% Cutoff Quartile 3 437000 437000 437000 437000 Sensitivity 62% 55% 57% 58% Specificity 58% 68% 67% 56% Cutoff Quartile 4 708000 707000 707000 708000 Sensitivity 39% 29% 30% 37% Specificity 84% 88% 87% 84% OR Quartile 2 2.59 3.05 3.13 2.48 p Value 0.0011 1.1E4 2.2E5 0.0011 Lower limit of 1.46 1.73 1.85 1.44 95% CI Upper limit of 4.59 5.36 5.31 4.28 95% CI OR Quartile 3 2.23 2.62 2.70 1.81 p Value 5.5E4 8.1E4 1.0E4 0.0088 Lower limit of 1.42 1.49 1.64 1.16 95% CI Upper limit of 3.52 4.59 4.47 2.81 95% CI OR Quartile 4 3.37 3.07 2.93 3.05 p Value 4.6E6 0.0051 0.0016 2.8E5 Lower limit of 2.00 1.40 1.51 1.81 95% CI Upper limit of 5.66 6.72 5.72 5.14 95% CI

TABLE-US-00024 TABLE 6.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 280000 560000 279000 530000 279000 524000 Average 362000 564000 364000 557000 366000 547000 Stdev 224000 276000 229000 275000 235000 275000 p (t-test) 1.2E10 1.5E9 4.4E8 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 111 216 104 223 94 233 sCr only Median 286000 564000 282000 564000 286000 552000 Average 376000 568000 372000 568000 376000 561000 Stdev 238000 273000 236000 273000 239000 274000 p (t-test) 4.0E10 2.0E10 3.0E9 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 124 203 121 206 116 211 UO only Median 367000 602000 363000 595000 367000 577000 Average 434000 627000 435000 608000 429000 596000 Stdev 247000 288000 249000 288000 243000 292000 p (t-test) 1.4E9 2.8E8 4.6E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 219 106 208 117 193 132 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.72 0.71 0.70 0.71 0.71 SE 0.028 0.028 0.032 0.029 0.028 p Value 1.2E14 1.7E13 1.4E9 2.1E13 3.3E14 nCohort 111 124 219 104 121 Recovered nCohort Non- 216 203 106 223 206 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 84% 84% 88% 83% 84% Specificity 42% 40% 31% 43% 41% Cutoff Quartile 3 437000 437000 437000 437000 437000 Sensitivity 60% 61% 66% 59% 61% Specificity 68% 67% 58% 69% 68% Cutoff Quartile 4 707000 707000 708000 707000 707000 Sensitivity 33% 33% 42% 32% 33% Specificity 91% 89% 83% 90% 89% OR Quartile 2 3.80 3.61 3.22 3.83 3.83 p Value 5.5E7 1.4E6 4.0E4 5.1E7 4.8E7 Lower limit of 2.25 2.14 1.69 2.27 2.27 95% CI Upper limit of 6.40 6.08 6.15 6.48 6.46 95% CI OR Quartile 3 3.22 3.11 2.63 3.26 3.24 p Value 2.2E6 2.0E6 8.5E5 2.8E6 1.1E6 Lower limit of 1.98 1.95 1.63 1.99 2.02 95% CI Upper limit of 5.22 4.97 4.27 5.35 5.21 95% CI OR Quartile 4 5.05 3.96 3.63 4.48 4.18 p Value 7.5E6 1.8E5 1.3E6 3.4E5 1.3E5 Lower limit of 2.49 2.11 2.15 2.20 2.20 95% CI Upper limit of 10.3 7.42 6.12 9.11 7.97 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.68 0.70 0.70 0.67 SE 0.032 0.030 0.029 0.031 p Value 2.6E8 2.1E11 1.9E12 5.2E8 nCohort 208 94 116 193 Recovered nCohort Non- 117 233 211 132 recovered Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 86% 82% 84% 86% Specificity 31% 44% 41% 32% Cutoff Quartile 3 437000 437000 437000 437000 Sensitivity 65% 58% 60% 62% Specificity 58% 69% 67% 58% Cutoff Quartile 4 708000 707000 707000 708000 Sensitivity 40% 31% 33% 39% Specificity 83% 89% 89% 84% OR Quartile 2 2.87 3.62 3.67 2.81 p Value 6.2E4 1.9E6 9.7E7 3.9E4 Lower limit of 1.57 2.13 2.18 1.59 95% CI Upper limit of 5.25 6.15 6.19 4.99 95% CI OR Quartile 3 2.58 3.09 3.04 2.27 p Value 7.6E5 1.4E5 4.5E6 4.0E4 Lower limit of 1.61 1.86 1.89 1.44 95% CI Upper limit of 4.12 5.14 4.89 3.57 95% CI OR Quartile 4 3.32 3.76 3.85 3.53 p Value 5.7E6 2.7E4 4.2E5 2.3E6 Lower limit of 1.98 1.84 2.02 2.09 95% CI Upper limit of 5.57 7.66 7.34 5.96 95% CI

TABLE-US-00025 TABLE 6.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 296000 564000 293000 536000 279000 529000 Average 383000 573000 381000 566000 372000 561000 Stdev 232000 278000 233000 277000 236000 274000 p (t-test) 3.3E10 1.7E9 1.6E9 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 134 193 125 202 113 214 sCr only Median 293000 567000 289000 567000 282000 565000 Average 381000 580000 377000 581000 376000 577000 Stdev 234000 275000 231000 275000 233000 274000 p (t-test) 3.6E11 1.0E11 2.7E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 139 188 137 190 133 194 UO only Median 373000 595000 371000 582000 369000 576000 Average 438000 621000 437000 609000 432000 599000 Stdev 249000 290000 248000 291000 246000 291000 p (t-test) 1.1E8 4.2E8 5.9E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 220 105 211 114 198 127 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.70 0.71 0.69 0.70 0.72 SE 0.028 0.028 0.033 0.029 0.028 p Value 7.5E13 2.6E14 1.2E8 2.5E12 2.7E15 nCohort 134 139 220 125 137 Recovered nCohort Non- 193 188 105 202 190 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 85% 86% 90% 85% 86% Specificity 40% 40% 32% 42% 40% Cutoff Quartile 3 437000 437000 437000 437000 437000 Sensitivity 60% 62% 65% 59% 62% Specificity 64% 65% 57% 65% 66% Cutoff Quartile 4 707000 707000 708000 707000 707000 Sensitivity 35% 36% 41% 34% 36% Specificity 90% 89% 82% 90% 90% OR Quartile 2 3.98 3.90 3.99 4.08 4.05 p Value 3.1E7 4.9E7 7.7E5 1.6E7 2.5E7 Lower limit of 2.34 2.30 2.01 2.41 2.38 95% CI Upper limit of 6.75 6.64 7.92 6.91 6.89 95% CI OR Quartile 3 2.70 3.05 2.42 2.69 3.24 p Value 2.0E5 1.7E6 3.2E4 2.6E5 5.4E7 Lower limit of 1.71 1.93 1.49 1.70 2.05 95% CI Upper limit of 4.26 4.82 3.91 4.28 5.14 95% CI OR Quartile 4 4.66 4.58 3.22 4.47 4.90 p Value 1.5E6 1.2E6 1.1E5 5.1E6 6.9E7 Lower limit of 2.49 2.48 1.91 2.35 2.61 95% CI Upper limit of 8.73 8.45 5.42 8.51 9.17 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.68 0.71 0.72 0.67 SE 0.032 0.029 0.028 0.031 p Value 5.0E8 2.2E13 6.7E15 4.9E8 nCohort 211 113 133 198 Recovered nCohort Non- 114 214 194 127 recovered Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 88% 85% 86% 87% Specificity 32% 44% 41% 33% Cutoff Quartile 3 437000 437000 437000 437000 Sensitivity 64% 59% 62% 62% Specificity 57% 67% 67% 58% Cutoff Quartile 4 708000 707000 707000 708000 Sensitivity 40% 33% 35% 39% Specificity 83% 89% 89% 84% OR Quartile 2 3.32 4.51 4.05 3.39 p Value 1.9E4 2.2E8 2.2E7 7.1E5 Lower limit of 1.77 2.66 2.39 1.86 95% CI Upper limit of 6.24 7.65 6.88 6.19 95% CI OR Quartile 3 2.39 3.00 3.28 2.23 p Value 2.7E4 6.8E6 5.0E7 5.5E4 Lower limit of 1.50 1.86 2.06 1.42 95% CI Upper limit of 3.83 4.84 5.21 3.52 95% CI OR Quartile 4 3.29 4.09 4.59 3.37 p Value 6.8E6 3.1E5 1.9E6 4.6E6 Lower limit of 1.96 2.11 2.45 2.00 95% CI Upper limit of 5.52 7.94 8.59 5.66 95% CI

TABLE-US-00026 TABLE 6.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 359000 572000 342000 576000 342000 577000 Average 421000 595000 416000 597000 415000 598000 Stdev 240000 290000 237000 289000 237000 289000 p (t-test) 8.6E9 1.6E9 1.1E9 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 187 140 184 143 183 144 sCr only Median 313000 564000 308000 564000 308000 564000 Average 402000 583000 399000 583000 399000 581000 Stdev 240000 280000 239000 279000 239000 279000 p (t-test) 1.3E9 5.5E10 8.4E10 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 159 168 156 171 154 173 UO only Median 375000 582000 369000 586000 359000 596000 Average 436000 616000 433000 617000 428000 622000 Stdev 245000 296000 243000 294000 241000 292000 p (t-test) 1.4E8 4.2E9 3.7E10 Min 13600 135000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 215 110 212 113 209 116 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.69 0.68 0.68 0.70 0.69 0.69 0.69 0.70 SE 0.030 0.029 0.032 0.030 0.029 0.032 0.030 0.029 0.031 p Value 6.3E9 3.9E11 3.0E8 8.4E10 8.0E12 6.3E9 4.4E10 1.5E11 4.5E10 nCohort Recovered 187 159 215 184 156 212 183 154 209 nCohort Non- 140 168 110 143 171 113 144 173 116 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 86% 86% 88% 87% 87% 88% 87% 86% 89% Specificity 34% 37% 32% 34% 38% 32% 34% 38% 33% Cutoff Quartile 3 437000 437000 437000 437000 437000 437000 437000 437000 437000 Sensitivity 62% 61% 65% 62% 62% 65% 62% 62% 66% Specificity 59% 62% 57% 59% 63% 58% 60% 63% 58% Cutoff Quartile 4 707000 707000 708000 707000 707000 708000 707000 707000 708000 Sensitivity 39% 37% 40% 40% 37% 41% 40% 36% 42% Specificity 86% 87% 82% 86% 88% 83% 86% 88% 84% OR Quartile 2 3.24 3.72 3.45 3.40 3.91 3.63 3.45 3.75 3.82 p Value 5.5E5 2.3E6 1.7E4 2.7E5 9.5E7 9.1E5 2.1E5 1.6E6 4.7E5 Lower limit of 1.83 2.16 1.81 1.92 2.27 1.90 1.95 2.18 2.00 95% CI Upper limit of 5.73 6.41 6.59 6.01 6.75 6.93 6.11 6.44 7.29 95% CI OR Quartile 3 2.35 2.55 2.43 2.40 2.76 2.47 2.45 2.76 2.66 p Value 2.0E4 4.0E5 2.4E4 1.3E4 9.3E6 1.7E4 8.6E5 9.2E6 4.6E5 Lower limit of 1.50 1.63 1.51 1.53 1.76 1.54 1.57 1.76 1.66 95% CI Upper limit of 3.67 3.98 3.91 3.75 4.31 3.97 3.84 4.32 4.27 95% CI OR Quartile 4 3.83 4.07 3.11 4.22 4.21 3.36 4.14 4.07 3.90 p Value 6.8E7 1.1E6 1.8E5 1.6E7 8.4E7 4.8E6 2.3E7 1.5E6 3.5E7 Lower limit of 2.26 2.31 1.85 2.46 2.37 2.00 2.42 2.30 2.31 95% CI Upper limit of 6.52 7.14 5.21 7.22 7.45 5.64 7.09 7.21 6.58 95% CI

Example 7. Use of Metalloproteinase Inhibitor 1 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0139] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 1 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0140] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0141] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00027 TABLE 7.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 7070 20000 6950 20000 6710 20500 Average 15900 35500 14900 35600 14800 35300 Stdev 23300 35800 21500 35900 21900 35700 p (t-test) 4.7E7 1.2E7 2.2E7 Min 475 297 475 297 475 297 Max 116000 146000 110000 146000 110000 146000 n (Patient) 108 209 104 213 100 217 sCr only Median 8650 20500 8510 20500 8310 20500 Average 16400 36800 16400 36600 16500 36400 Stdev 22300 36800 22400 36700 22600 36500 p (t-test) 5.2E8 8.5E8 1.3E7 Min 475 297 475 297 475 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 126 190 124 192 122 194 UO only Median 11300 21700 11000 21300 11000 20500 Average 24700 39200 24000 38700 24000 37300 Stdev 31100 36500 30700 36400 31000 35800 p (t-test) 3.9E4 1.9E4 6.3E4 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 222 93 208 107 198 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.70 0.66 0.73 0.70 0.66 0.73 0.70 0.65 SE 0.029 0.029 0.035 0.028 0.029 0.033 0.028 0.029 0.033 p Value 3.8E14 9.9E12 6.3E6 2.2E15 8.2E12 1.7E6 2.2E16 6.5E12 4.3E6 nCohort Recovered 108 126 222 104 124 208 100 122 198 nCohort Non- 209 190 93 213 192 107 217 194 117 recovered Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 85% 84% 89% 85% 84% 89% 85% 85% 87% Specificity 44% 39% 31% 45% 40% 32% 46% 40% 32% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 63% 64% 68% 62% 64% 66% 63% 63% 64% Specificity 74% 71% 57% 75% 71% 58% 77% 71% 58% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 33% 35% 35% 33% 34% 36% 32% 34% 35% Specificity 89% 90% 79% 90% 90% 81% 90% 89% 81% OR Quartile 2 4.59 3.39 3.74 4.66 3.53 3.76 4.75 3.67 3.25 p Value 2.8E8 6.1E6 3.0E4 2.1E8 3.2E6 9.9E5 1.6E8 1.6E6 1.9E4 Lower limit of 2.68 2.00 1.83 2.72 2.08 1.93 2.77 2.16 1.75 95% CI Upper limit of 7.87 5.76 7.65 7.99 6.00 7.33 8.15 6.24 6.03 95% CI OR Quartile 3 4.80 4.22 2.81 4.99 4.26 2.74 5.62 4.31 2.47 p Value 2.2E9 5.6E9 7.2E5 1.8E9 5.3E9 4.8E5 3.9E10 4.9E9 1.7E4 Lower limit of 2.87 2.60 1.69 2.96 2.62 1.69 3.27 2.64 1.54 95% CI Upper limit of 8.02 6.85 4.67 8.42 6.93 4.46 9.65 7.02 3.96 95% CI OR Quartile 4 3.86 4.63 2.10 4.60 4.47 2.41 4.29 4.32 2.27 p Value 7.1E5 3.5E6 0.0064 2.6E5 5.7E6 9.9E4 6.3E5 9.3E6 0.0019 Lower limit of 1.98 2.42 1.23 2.26 2.34 1.43 2.10 2.26 1.35 95% CI Upper limit of 7.51 8.84 3.59 9.38 8.54 4.07 8.74 8.26 3.82 95% CI

TABLE-US-00028 TABLE 7.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9010 20500 8810 20500 8420 20500 Average 17700 37200 17600 37000 16900 37000 Stdev 23400 37100 23500 37000 22300 37100 p (t-test) 1.6E7 1.9E7 6.6E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 110000 146000 n (Patient) 136 181 134 183 129 188 sCr only Median 9350 20500 9380 20500 9380 20500 Average 18000 38400 18100 38200 18100 38000 Stdev 22800 38000 22900 38000 23000 37800 p (t-test) 2.8E8 4.1E8 6.8E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 149 168 148 169 146 171 UO only Median 11900 21700 11800 21300 11200 20900 Average 25200 38600 25300 37400 24900 36700 Stdev 31100 37200 31400 36500 31200 36200 p (t-test) 0.0012 0.0030 0.0029 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 226 89 220 95 207 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.64 0.69 0.68 0.64 0.70 0.68 0.64 SE 0.029 0.030 0.036 0.029 0.030 0.035 0.029 0.030 0.034 p Value 9.9E11 1.0E9 7.8E5 5.0E11 1.4E9 9.6E5 2.3E12 1.4E9 5.6E5 nCohort Recovered 136 149 226 134 148 220 129 146 207 nCohort Non- 181 168 89 183 169 95 188 171 108 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 6080 6030 6030 6080 Sensitivity 86% 86% 90% 86% 86% 89% 86% 86% 88% Specificity 40% 37% 31% 40% 37% 31% 41% 38% 32% Cutoff Quartile 3 14200 14200 14200 14200 14200 14200 14200 14200 14200 Sensitivity 63% 64% 66% 63% 63% 65% 63% 63% 64% Specificity 67% 65% 56% 67% 65% 56% 69% 65% 57% Cutoff Quartile 4 35900 35900 36300 35900 35900 36300 35900 35900 36300 Sensitivity 34% 36% 33% 34% 36% 33% 34% 36% 32% Specificity 87% 87% 78% 87% 87% 78% 88% 87% 79% OR Quartile 2 4.11 3.51 3.99 4.27 3.57 3.88 4.35 3.70 3.42 p Value 3.6E7 6.4E6 2.7E4 1.8E7 4.8E6 2.0E4 1.1E7 2.6E6 2.0E4 Lower limit of 2.38 2.03 1.89 2.47 2.07 1.90 2.53 2.14 1.79 95% CI Upper limit of 7.08 6.06 8.40 7.36 6.17 7.94 7.48 6.39 6.55 95% CI OR Quartile 3 3.44 3.27 2.52 3.46 3.19 2.43 3.84 3.19 2.35 p Value 2.2E7 4.6E7 4.0E4 2.1E7 8.0E7 5.0E4 3.2E8 7.9E7 4.9E4 Lower limit of 2.16 2.06 1.51 2.16 2.01 1.47 2.38 2.01 1.45 95% CI Upper limit of 5.49 5.19 4.21 5.53 5.05 4.00 6.18 5.06 3.79 95% CI OR Quartile 4 3.42 3.90 1.70 3.61 3.83 1.74 3.65 3.71 1.78 p Value 3.7E5 3.5E6 0.055 2.2E5 4.6E6 0.043 2.7E5 7.9E6 0.031 Lower limit of 1.91 2.19 0.988 2.00 2.16 1.02 1.99 2.09 1.05 95% CI Upper limit of 6.12 6.93 2.93 6.54 6.81 2.96 6.67 6.59 3.00 95% CI

TABLE-US-00029 TABLE 7.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9010 21900 9010 21700 8870 21700 Average 18400 38700 18500 38300 18000 38300 Stdev 24700 37300 24900 37200 23900 37400 p (t-test) 3.1E8 7.1E8 3.0E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 111000 146000 n (Patient) 154 163 152 165 148 169 sCr only Median 9310 22000 9160 21900 9310 21600 Average 18700 39200 18800 39000 18900 38800 Stdev 24500 37800 24600 37800 24700 37700 p (t-test) 2.3E8 3.4E8 5.2E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 161 156 160 157 159 158 UO only Median 11900 21300 11900 20900 11800 20500 Average 25600 37100 25700 36700 25300 36500 Stdev 31500 36700 31500 36600 31200 36500 p (t-test) 0.0056 0.0077 0.0053 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 224 91 223 92 212 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.69 0.63 0.70 0.69 0.62 0.70 0.69 0.62 SE 0.029 0.030 0.036 0.029 0.030 0.036 0.029 0.030 0.034 p Value 4.1E12 8.7E11 3.1E4 1.3E11 1.3E10 6.4E4 3.0E12 2.1E10 3.7E4 nCohort Recovered 154 161 224 152 160 223 148 159 212 nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 6080 6030 6030 6080 Sensitivity 87% 86% 88% 87% 86% 87% 86% 86% 86% Specificity 37% 35% 30% 38% 36% 30% 38% 36% 31% Cutoff Quartile 3 14200 14200 14200 14200 14200 14200 14200 14200 14200 Sensitivity 66% 66% 65% 65% 66% 64% 65% 65% 63% Specificity 67% 65% 56% 66% 65% 56% 67% 65% 56% Cutoff Quartile 4 35900 35900 36300 35900 35900 36300 35900 35900 36300 Sensitivity 37% 38% 32% 36% 38% 32% 36% 37% 32% Specificity 87% 87% 78% 87% 87% 78% 87% 87% 78% OR Quartile 2 3.77 3.34 3.17 3.90 3.40 2.86 3.86 3.45 2.81 p Value 2.9E6 2.0E5 0.0011 1.6E6 1.6E5 0.0021 1.5E6 1.2E5 0.0014 Lower limit of 2.16 1.92 1.59 2.24 1.95 1.46 2.23 1.98 1.49 95% CI Upper limit of 6.57 5.81 6.33 6.80 5.91 5.60 6.70 6.02 5.30 95% CI OR Quartile 3 3.97 3.64 2.33 3.75 3.54 2.24 3.77 3.44 2.19 p Value 7.3E9 4.6E8 0.0010 2.5E8 8.4E8 0.0016 2.4E8 1.5E7 0.0015 Lower limit of 2.49 2.29 1.41 2.36 2.23 1.36 2.36 2.17 1.35 95% CI Upper limit of 6.33 5.79 3.86 5.97 5.63 3.70 6.00 5.46 3.55 95% CI OR Quartile 4 3.90 4.05 1.63 3.77 3.98 1.59 3.83 3.92 1.70 p Value 2.6E6 1.0E6 0.078 4.5E6 1.4E6 0.092 4.6E6 1.8E6 0.048 Lower limit of 2.21 2.31 0.947 2.14 2.27 0.927 2.16 2.23 1.00 95% CI Upper limit of 6.88 7.11 2.80 6.65 6.98 2.74 6.81 6.86 2.88 95% CI

TABLE-US-00030 TABLE 7.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9350 21900 9360 21500 9310 21500 Average 19200 39700 19400 39100 18900 39100 Stdev 24900 38100 25100 37900 24200 38100 p (t-test) 2.3E8 7.9E8 3.5E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 111000 146000 n (Patient) 168 149 165 152 161 156 sCr only Median 9510 22000 9570 22000 9620 21900 Average 19400 40000 19500 39700 19600 39500 Stdev 24900 38400 24900 38400 25000 38300 p (t-test) 2.4E8 3.7E8 5.7E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 172 145 171 146 170 147 UO only Median 11800 21500 11900 21300 11800 20500 Average 25400 37400 25500 37200 25200 37000 Stdev 31500 36500 31500 36400 31100 36700 p (t-test) 0.0036 0.0046 0.0033 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 223 92 222 93 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.69 0.63 0.69 0.69 0.63 0.69 0.68 0.63 SE 0.030 0.030 0.036 0.030 0.030 0.035 0.029 0.030 0.034 p Value 3.9E11 3.8E10 1.9E4 1.5E10 5.6E10 2.3E4 4.7E11 9.1E10 1.6E4 nCohort Recovered 168 172 223 165 171 222 161 170 214 nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 6080 6030 6030 6080 Sensitivity 87% 86% 88% 88% 86% 88% 87% 86% 88% Specificity 36% 34% 30% 36% 35% 31% 37% 35% 31% Cutoff Quartile 3 14200 14200 14200 14200 14200 14200 14200 14200 14200 Sensitivity 68% 68% 65% 66% 67% 65% 66% 67% 63% Specificity 65% 65% 56% 65% 64% 56% 65% 64% 56% Cutoff Quartile 4 35900 35900 36300 35900 35900 36300 35900 35900 36300 Sensitivity 38% 38% 35% 37% 38% 34% 37% 37% 34% Specificity 86% 85% 79% 85% 85% 79% 86% 85% 79% OR Quartile 2 3.80 3.26 3.23 4.00 3.32 3.29 3.93 3.38 3.38 p Value 5.4E6 4.4E5 8.9E4 2.4E6 3.4E5 7.3E4 2.3E6 2.7E5 3.5E4 Lower limit of 2.14 1.85 1.62 2.25 1.88 1.65 2.23 1.91 1.73 95% CI Upper limit of 6.76 5.76 6.45 7.12 5.85 6.57 6.94 5.95 6.60 95% CI OR Quartile 3 3.99 3.79 2.39 3.65 3.68 2.30 3.64 3.57 2.21 p Value 6.9E9 2.3E8 7.0E4 4.5E8 4.2E8 0.0011 4.6E8 7.7E8 0.0014 Lower limit of 2.50 2.38 1.44 2.30 2.31 1.39 2.29 2.25 1.36 95% CI Upper limit of 6.37 6.06 3.96 5.81 5.87 3.80 5.79 5.69 3.59 95% CI OR Quartile 4 3.61 3.59 2.00 3.43 3.53 1.95 3.45 3.47 1.91 p Value 3.8E6 3.5E6 0.011 9.1E6 4.8E6 0.014 9.5E6 6.4E6 0.017 Lower limit of 2.10 2.09 1.17 1.99 2.06 1.14 2.00 2.02 1.12 95% CI Upper limit of 6.23 6.17 3.41 5.90 6.06 3.34 5.98 5.95 3.23 95% CI

TABLE-US-00031 TABLE 7.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11100 21500 11100 21100 11000 20800 Average 23100 39100 23200 38600 23300 38300 Stdev 28900 38100 29000 38000 29000 37900 p (t-test) 3.3E5 6.5E5 8.6E5 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 203 114 201 116 200 117 sCr only Median 10900 22000 10900 22000 10900 22000 Average 20400 40600 20400 40600 20400 40600 Stdev 25100 39400 25100 39400 25100 39400 p (t-test) 5.4E8 5.4E8 5.4E8 Min 419 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 185 132 185 132 185 132 UO only Median 11800 21500 11900 21300 11900 20800 Average 24500 38800 24600 38500 24700 37900 Stdev 29700 38800 29800 38700 29900 38500 p (t-test) 4.1E4 5.5E4 9.8E4 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 217 98 216 99 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.67 0.63 0.65 0.67 0.63 0.64 0.67 0.63 SE 0.033 0.031 0.035 0.033 0.031 0.035 0.033 0.031 0.035 p Value 4.4E6 2.0E8 1.3E4 8.7E6 2.0E8 1.5E4 9.7E6 2.0E8 2.5E4 nCohort Recovered 203 185 217 201 185 216 200 185 214 nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 6030 6030 6080 6030 6030 6080 6030 6030 6080 Sensitivity 86% 87% 87% 86% 87% 87% 86% 87% 87% Specificity 31% 34% 30% 31% 34% 31% 32% 34% 31% Cutoff Quartile 3 14200 14200 14200 14200 14200 14200 14200 14200 14200 Sensitivity 66% 65% 64% 65% 65% 64% 64% 65% 62% Specificity 59% 61% 56% 58% 61% 56% 58% 61% 56% Cutoff Quartile 4 35900 35900 36300 35900 35900 36300 35900 35900 36300 Sensitivity 37% 39% 35% 36% 39% 34% 36% 39% 34% Specificity 81% 84% 79% 81% 84% 79% 81% 84% 79% OR Quartile 2 2.76 3.41 2.86 2.85 3.41 2.91 2.90 3.41 3.02 p Value 0.0010 5.1E5 0.0016 7.0E4 5.1E5 0.0013 5.7E4 5.1E5 8.7E4 Lower limit of 1.50 1.88 1.49 1.56 1.88 1.52 1.58 1.88 1.57 95% CI Upper limit of 5.05 6.17 5.48 5.23 6.17 5.58 5.32 6.17 5.79 95% CI OR Quartile 3 2.72 2.87 2.31 2.55 2.87 2.23 2.47 2.87 2.08 p Value 3.9E5 8.5E6 8.6E4 1.1E4 8.5E6 0.0013 1.7E4 8.5E6 0.0031 Lower limit of 1.69 1.80 1.41 1.59 1.80 1.37 1.54 1.80 1.28 95% CI Upper limit of 4.39 4.56 3.78 4.09 4.56 3.64 3.95 4.56 3.37 95% CI OR Quartile 4 2.53 3.39 2.03 2.43 3.39 1.99 2.39 3.39 1.91 p Value 4.5E4 6.2E6 0.0088 7.6E4 6.2E6 0.011 9.7E4 6.2E6 0.017 Lower limit of 1.51 2.00 1.20 1.45 2.00 1.17 1.42 2.00 1.12 95% CI Upper limit of 4.26 5.75 3.45 4.09 5.75 3.37 4.00 5.75 3.23 95% CI

TABLE-US-00032 TABLE 7.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 274000 564000 275000 564000 270000 564000 Average 354000 562000 354000 560000 342000 561000 Stdev 231000 271000 231000 271000 222000 271000 p (t-test) 5.2E11 1.3E10 1.0E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 105 222 102 225 98 229 sCr only Median 279000 566000 279000 566000 275000 566000 Average 365000 569000 362000 569000 358000 570000 Stdev 235000 269000 235000 268000 232000 268000 p (t-test) 2.1E11 1.4E11 4.4E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 121 205 119 207 117 209 UO only Median 373000 605000 371000 598000 369000 595000 Average 445000 617000 439000 608000 433000 603000 Stdev 256000 284000 252000 287000 249000 286000 p (t-test) 1.4E7 7.4E8 3.9E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 226 99 213 112 202 123 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.72 0.67 0.73 0.73 0.67 0.74 0.73 0.67 SE 0.028 0.028 0.034 0.028 0.028 0.032 0.028 0.027 0.031 p Value 2.2E16 4.4E16 3.0E7 1.3E15 0 1.3E7 0 0 4.0E8 nCohort Recovered 105 121 226 102 119 213 98 117 202 nCohort Non- 222 205 99 225 207 112 229 209 123 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 84% 85% 85% 84% 86% 85% 84% 86% 85% Specificity 45% 43% 29% 44% 44% 30% 46% 44% 31% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 60% 62% 66% 60% 62% 64% 60% 62% 63% Specificity 71% 70% 57% 72% 71% 57% 72% 71% 57% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 33% 34% 44% 32% 33% 42% 33% 33% 41% Specificity 91% 89% 83% 91% 89% 84% 93% 90% 84% OR Quartile 2 4.33 4.40 2.31 4.01 4.58 2.40 4.41 4.77 2.64 p Value 5.2E8 4.0E8 0.0081 2.3E7 1.8E8 0.0038 4.3E8 8.2E9 0.0011 Lower limit of 2.55 2.59 1.24 2.37 2.70 1.33 2.59 2.81 1.48 95% CI Upper limit of 7.34 7.46 4.29 6.79 7.78 4.35 7.49 8.12 4.73 95% CI OR Quartile 3 3.81 3.84 2.50 3.78 3.89 2.41 3.92 3.94 2.26 p Value 1.8E7 4.1E8 2.6E4 2.7E7 3.8E8 2.6E4 2.2E7 3.5E8 5.1E4 Lower limit of 2.31 2.38 1.53 2.28 2.40 1.50 2.34 2.42 1.43 95% CI Upper limit of 6.29 6.22 4.08 6.26 6.31 3.87 6.56 6.41 3.57 95% CI OR Quartile 4 5.23 4.21 3.96 4.96 4.08 3.68 6.33 4.41 3.64 p Value 1.1E5 1.2E5 3.3E7 2.1E5 1.9E5 1.0E6 9.5E6 1.2E5 1.2E6 Lower limit of 2.50 2.21 2.33 2.37 2.14 2.18 2.80 2.27 2.16 95% CI Upper limit of 10.9 8.03 6.71 10.4 7.77 6.20 14.3 8.55 6.13 95% CI

TABLE-US-00033 TABLE 7.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 293000 568000 293000 571000 284000 568000 Average 379000 576000 376000 577000 370000 576000 Stdev 235000 274000 234000 273000 229000 274000 p (t-test) 5.1E11 2.7E11 8.5E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 134 193 133 194 128 199 sCr only Median 300000 576000 299000 577000 294000 577000 Average 386000 583000 384000 584000 380000 585000 Stdev 237000 274000 237000 274000 235000 273000 p (t-test) 3.5E11 1.9E11 6.9E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 146 181 145 182 143 184 UO only Median 375000 598000 375000 598000 369000 596000 Average 448000 619000 443000 618000 432000 616000 Stdev 256000 287000 253000 288000 247000 288000 p (t-test) 2.5E7 7.7E8 4.4E9 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 231 94 225 100 210 115 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.71 0.67 0.72 0.72 0.68 0.72 0.72 0.69 SE 0.028 0.028 0.034 0.028 0.028 0.033 0.028 0.028 0.032 p Value 1.9E14 4.0E14 3.9E7 5.3E15 1.2E14 9.9E8 6.7E16 2.0E15 4.2E9 nCohort Recovered 134 146 231 133 145 225 128 143 210 nCohort Non- 193 181 94 194 182 100 199 184 115 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 85% 86% 87% 86% 86% 88% 85% 86% 88% Specificity 40% 39% 30% 41% 39% 31% 41% 40% 32% Cutoff Quartile 3 437000 437000 437000 437000 437000 437000 437000 437000 437000 Sensitivity 62% 63% 65% 62% 63% 64% 62% 63% 63% Specificity 67% 66% 56% 68% 66% 56% 68% 66% 57% Cutoff Quartile 4 707000 707000 708000 707000 707000 708000 707000 707000 708000 Sensitivity 35% 36% 43% 35% 36% 42% 35% 36% 42% Specificity 89% 88% 82% 89% 88% 82% 90% 89% 84% OR Quartile 2 3.98 4.00 2.91 4.05 4.07 3.24 4.14 4.22 3.38 p Value 3.1E7 4.4E7 0.0017 2.2E7 3.2E7 5.4E4 1.3E7 1.6E7 1.5E4 Lower limit of 2.34 2.33 1.49 2.39 2.38 1.67 2.44 2.46 1.80 95% CI Upper limit of 6.75 6.84 5.68 6.88 6.96 6.32 7.02 7.22 6.35 95% CI OR Quartile 3 3.36 3.27 2.34 3.47 3.36 2.26 3.43 3.38 2.32 p Value 2.9E7 3.6E7 8.1E4 1.6E7 2.0E7 9.9E4 2.5E7 2.0E7 4.3E4 Lower limit of 2.12 2.07 1.42 2.18 2.13 1.39 2.15 2.13 1.45 95% CI Upper limit of 5.34 5.15 3.84 5.52 5.31 3.68 5.49 5.34 3.70 95% CI OR Quartile 4 4.22 4.25 3.33 4.15 4.18 3.35 4.70 4.44 3.71 p Value 4.2E6 1.5E6 7.9E6 5.4E6 2.0E6 6.1E6 2.5E6 1.2E6 8.5E7 Lower limit of 2.28 2.36 1.97 2.25 2.32 1.98 2.47 2.43 2.20 95% CI Upper limit of 7.79 7.67 5.65 7.66 7.54 5.66 8.94 8.10 6.25 95% CI

TABLE-US-00034 TABLE 7.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 303000 573000 300000 576000 296000 576000 Average 394000 586000 390000 587000 384000 587000 Stdev 239000 276000 238000 275000 232000 276000 p (t-test) 1.0E10 2.8E11 7.0E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 154 173 152 175 148 179 sCr only Median 304000 582000 303000 586000 301000 590000 Average 394000 594000 392000 594000 389000 596000 Stdev 239000 275000 238000 274000 236000 274000 p (t-test) 1.4E11 7.8E12 2.2E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 161 166 160 167 159 168 UO only Median 373000 600000 373000 600000 367000 597000 Average 443000 627000 442000 627000 434000 621000 Stdev 254000 285000 252000 287000 248000 287000 p (t-test) 2.5E8 1.7E8 3.3E9 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 230 95 228 97 215 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.71 0.69 0.71 0.72 0.69 0.72 0.72 0.69 SE 0.028 0.028 0.034 0.028 0.028 0.034 0.028 0.028 0.032 p Value 3.2E13 3.4E14 2.8E8 3.4E14 1.1E14 2.3E8 4.9E15 2.0E15 2.6E9 nCohort Recovered 154 161 230 152 160 228 148 159 215 nCohort Non- 173 166 95 175 167 97 179 168 110 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 87% 88% 88% 87% 88% 88% 87% 88% 88% Specificity 39% 39% 30% 39% 39% 30% 40% 39% 32% Cutoff Quartile 3 437000 437000 437000 437000 437000 437000 437000 437000 437000 Sensitivity 62% 63% 66% 62% 63% 66% 62% 64% 65% Specificity 63% 63% 57% 64% 64% 57% 64% 64% 57% Cutoff Quartile 4 707000 707000 708000 707000 707000 708000 707000 707000 708000 Sensitivity 36% 37% 42% 36% 37% 42% 36% 37% 42% Specificity 87% 87% 82% 88% 87% 82% 89% 87% 83% OR Quartile 2 4.38 4.57 3.34 4.54 4.65 3.07 4.50 4.73 3.45 p Value 1.6E7 1.3E7 5.9E4 8.3E8 9.8E8 9.7E4 7.4E8 7.2E8 1.7E4 Lower limit of 2.52 2.60 1.68 2.61 2.64 1.58 2.60 2.69 1.81 95% CI Upper limit of 7.61 8.04 6.65 7.88 8.18 5.99 7.78 8.32 6.59 95% CI OR Quartile 3 2.76 2.98 2.56 2.91 3.06 2.53 2.93 3.14 2.43 p Value 9.2E6 2.0E6 2.2E4 3.3E6 1.2E6 2.4E4 3.2E6 6.9E7 2.4E4 Lower limit of 1.76 1.90 1.55 1.86 1.95 1.54 1.86 2.00 1.51 95% CI Upper limit of 4.32 4.67 4.22 4.57 4.80 4.15 4.60 4.93 3.91 95% CI OR Quartile 4 3.74 3.87 3.26 3.94 3.81 3.34 4.39 4.07 3.57 p Value 4.4E6 1.9E6 1.1E5 2.6E6 2.5E6 7.0E6 8.8E7 1.1E6 1.7E6 Lower limit of 2.13 2.22 1.92 2.22 2.18 1.97 2.44 2.31 2.12 95% CI Upper limit of 6.57 6.76 5.51 6.97 6.65 5.65 7.93 7.14 6.02 95% CI

TABLE-US-00035 TABLE 7.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 318000 576000 313000 577000 304000 577000 Average 401000 592000 398000 592000 393000 593000 Stdev 243000 275000 243000 273000 238000 275000 p (t-test) 1.3E10 4.8E11 1.3E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 166 161 163 164 159 168 sCr only Median 313000 590000 311000 594000 309000 594000 Average 397000 600000 395000 601000 393000 603000 Stdev 242000 272000 242000 271000 240000 271000 p (t-test) 6.4E12 3.5E12 9.9E13 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 169 158 168 159 167 160 UO only Median 377000 598000 375000 596000 371000 596000 Average 441000 626000 441000 624000 436000 621000 Stdev 251000 289000 251000 288000 249000 287000 p (t-test) 1.2E8 1.7E8 5.7E9 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 226 99 225 100 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.72 0.69 0.71 0.72 0.69 0.71 0.73 0.69 SE 0.029 0.028 0.033 0.028 0.028 0.033 0.028 0.028 0.032 p Value 8.9E13 1.4E14 1.3E8 1.2E13 4.9E15 1.6E8 2.3E14 8.9E16 3.9E9 nCohort Recovered 166 169 226 163 168 225 159 167 217 nCohort Non- 161 158 99 164 159 100 168 160 108 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 88% 89% 90% 88% 89% 90% 88% 89% 90% Specificity 38% 38% 31% 39% 38% 32% 39% 38% 32% Cutoff Quartile 3 437000 437000 437000 437000 437000 437000 437000 437000 437000 Sensitivity 63% 65% 66% 63% 65% 65% 63% 66% 64% Specificity 63% 64% 57% 63% 64% 56% 64% 65% 57% Cutoff Quartile 4 707000 707000 708000 707000 707000 708000 707000 707000 708000 Sensitivity 37% 37% 41% 37% 37% 41% 37% 38% 42% Specificity 86% 86% 82% 87% 86% 82% 87% 87% 83% OR Quartile 2 4.57 4.74 4.08 4.81 4.82 4.15 4.73 4.90 4.20 p Value 1.9E7 1.5E7 1.1E4 7.7E8 1.1E7 8.8E5 7.2E8 8.3E8 4.1E5 Lower limit of 2.58 2.65 2.00 2.71 2.70 2.04 2.69 2.74 2.12 95% CI Upper limit of 8.10 8.47 8.30 8.53 8.62 8.45 8.32 8.77 8.33 95% CI OR Quartile 3 2.90 3.32 2.50 2.98 3.40 2.41 2.98 3.49 2.32 p Value 3.4E6 2.2E7 2.6E4 2.0E6 1.3E7 4.2E4 2.0E6 7.1E8 5.4E4 Lower limit of 1.85 2.11 1.53 1.90 2.16 1.48 1.90 2.22 1.44 95% CI Upper limit of 4.54 5.22 4.08 4.67 5.36 3.92 4.67 5.51 3.73 95% CI OR Quartile 4 3.60 3.78 3.19 3.70 3.72 3.12 4.07 3.95 3.47 p Value 4.1E6 1.7E6 1.4E5 3.2E6 2.3E6 2.0E5 1.1E6 1.0E6 2.8E6 Lower limit of 2.09 2.19 1.89 2.13 2.16 1.85 2.31 2.28 2.06 95% CI Upper limit of 6.20 6.53 5.39 6.41 6.41 5.26 7.14 6.86 5.85 95% CI

TABLE-US-00036 TABLE 7.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 358000 578000 350000 578000 342000 582000 Average 428000 607000 426000 607000 424000 609000 Stdev 246000 288000 246000 286000 244000 286000 p (t-test) 5.2E9 4.0E9 1.4E9 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 204 123 202 125 201 126 sCr only Median 328000 578000 328000 578000 328000 578000 Average 412000 603000 412000 603000 412000 603000 Stdev 242000 281000 242000 281000 242000 281000 p (t-test) 1.8E10 1.8E10 1.8E10 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 184 143 184 143 184 143 UO only Median 377000 586000 375000 582000 371000 590000 Average 439000 619000 439000 617000 436000 620000 Stdev 247000 295000 247000 295000 246000 293000 p (t-test) 2.0E8 2.8E8 6.1E9 Min 13600 135000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 220 105 219 106 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.70 0.68 0.69 0.70 0.68 0.69 0.70 0.69 SE 0.031 0.030 0.033 0.031 0.030 0.033 0.031 0.030 0.032 p Value 3.2E9 1.9E11 3.8E8 1.8E9 1.9E11 4.5E8 5.7E10 1.9E11 8.2E9 nCohort Recovered 204 184 220 202 184 219 201 184 217 nCohort Non- 123 143 105 125 143 106 126 143 108 recovered Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 89% 88% 89% 89% 88% 89% 89% 88% 89% Specificity 33% 35% 31% 34% 35% 32% 34% 35% 32% Cutoff Quartile 3 437000 437000 437000 437000 437000 437000 437000 437000 437000 Sensitivity 64% 64% 65% 64% 64% 64% 64% 64% 65% Specificity 58% 61% 57% 58% 61% 57% 59% 61% 57% Cutoff Quartile 4 707000 707000 708000 707000 707000 708000 707000 707000 708000 Sensitivity 39% 38% 40% 39% 38% 40% 40% 38% 41% Specificity 83% 85% 82% 84% 85% 82% 84% 85% 82% OR Quartile 2 3.89 4.05 3.54 4.02 4.05 3.60 4.09 4.05 3.73 p Value 2.2E5 3.4E6 1.9E4 1.4E5 3.4E6 1.6E4 1.1E5 3.4E6 1.0E4 Lower limit of 2.08 2.24 1.82 2.15 2.24 1.85 2.18 2.24 1.92 95% CI Upper limit of 7.29 7.30 6.89 7.54 7.30 7.01 7.66 7.30 7.25 95% CI OR Quartile 3 2.51 2.81 2.42 2.50 2.81 2.34 2.56 2.81 2.46 p Value 9.2E5 7.8E6 3.2E4 9.7E5 7.8E6 5.1E4 6.2E5 7.8E6 2.3E4 Lower limit of 1.58 1.78 1.49 1.58 1.78 1.45 1.62 1.78 1.52 95% CI Upper limit of 3.99 4.41 3.91 3.96 4.41 3.77 4.05 4.41 3.96 95% CI OR Quartile 4 3.20 3.63 3.00 3.30 3.63 2.94 3.47 3.63 3.24 p Value 1.0E5 1.8E6 3.4E5 6.1E6 1.8E6 4.7E5 2.6E6 1.8E6 9.3E6 Lower limit of 1.91 2.14 1.78 1.97 2.14 1.75 2.07 2.14 1.93 95% CI Upper limit of 5.36 6.17 5.04 5.54 6.17 4.93 5.84 6.17 5.44 95% CI

Example 8. Use of Metalloproteinase Inhibitor 1 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0142] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 1 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0143] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0144] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00037 TABLE 8.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10700 28600 10700 33800 11000 31700 Average 19900 45200 20100 48800 22000 48700 Stdev 25000 40000 25500 40200 27800 39800 p (t-test) 2.2E11 2.4E13 1.7E10 Min 297 873 297 873 297 873 Max 127000 146000 127000 146000 127000 146000 n (Patient) 205 112 221 96 236 81 sCr only Median 11000 28600 10900 31500 11200 31500 Average 20000 45400 20300 48800 22200 47500 Stdev 24700 40600 24900 41400 27400 41100 p (t-test) 2.8E11 6.1E13 1.2E9 Min 297 873 297 873 297 873 Max 127000 146000 127000 146000 127000 146000 n (Patient) 208 108 223 93 235 81 UO only Median 12400 25100 12500 28600 12700 30000 Average 26300 47200 26300 48500 26300 49300 Stdev 31200 42100 31100 43100 31000 43400 p (t-test) 2.0E4 1.3E4 8.7E5 Min 297 873 297 873 297 873 Max 146000 140000 146000 140000 146000 140000 n (Patient) 275 40 278 37 279 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.70 0.67 0.74 0.73 0.67 0.74 0.71 0.67 SE 0.031 0.032 0.049 0.032 0.033 0.051 0.035 0.036 0.052 p Value 9.6E12 2.8E10 5.0E4 2.0E14 3.4E12 7.3E4 1.0E11 5.7E9 7.4E4 nCohort Non- 205 208 275 221 223 278 236 235 279 persistent nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 89% 88% 92% 92% 90% 92% 93% 90% 92% Specificity 33% 32% 28% 32% 31% 27% 31% 30% 27% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 71% 69% 70% 76% 74% 70% 78% 74% 69% Specificity 61% 60% 53% 61% 60% 53% 59% 58% 52% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 46% 45% 45% 50% 48% 46% 49% 47% 47% Specificity 86% 86% 78% 86% 85% 78% 83% 83% 78% OR Quartile 2 4.05 3.40 4.71 5.21 4.27 4.26 5.60 3.95 4.12 p Value 3.9E5 2.2E4 0.012 3.1E5 1.3E4 0.019 1.2E4 5.7E4 0.022 Lower limit of 2.08 1.77 1.41 2.39 2.03 1.27 2.33 1.81 1.23 95% CI Upper limit of 7.88 6.50 15.7 11.3 8.98 14.3 13.4 8.63 13.8 95% CI OR Quartile 3 3.74 3.42 2.60 4.98 4.33 2.61 5.10 3.99 2.49 p Value 1.6E7 1.1E6 0.0089 6.0E9 8.5E8 0.011 4.6E8 1.3E6 0.016 Lower limit of 2.28 2.09 1.27 2.90 2.53 1.24 2.84 2.28 1.18 95% CI Upper limit of 6.13 5.61 5.33 8.56 7.40 5.50 9.16 7.00 5.27 95% CI OR Quartile 4 5.07 4.93 2.87 5.91 5.21 2.96 4.78 4.18 3.13 p Value 4.0E9 7.8E9 0.0025 2.1E10 3.2E9 0.0026 2.9E8 3.7E7 0.0017 Lower limit of 2.95 2.87 1.45 3.41 3.02 1.46 2.75 2.41 1.54 95% CI Upper limit of 8.72 8.47 5.69 10.2 9.00 6.00 8.31 7.26 6.39 95% CI

TABLE-US-00038 TABLE 8.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10100 23400 10600 31500 10800 31500 Average 18900 42900 18900 46800 20700 46900 Stdev 23700 39500 23400 40500 26300 39900 p (t-test) 7.7E11 9.3E14 2.4E11 Min 419 297 297 399 297 399 Max 121000 146000 121000 146000 121000 146000 n (Patient) 186 131 204 113 219 98 sCr only Median 11000 22400 10900 29300 11000 27300 Average 19500 42800 19400 46000 21400 44900 Stdev 23700 40400 23600 41200 26500 40600 p (t-test) 4.0E10 2.3E12 2.6E9 Min 419 297 297 399 297 399 Max 121000 146000 121000 146000 121000 146000 n (Patient) 192 124 206 110 218 98 UO only Median 12400 23400 12400 23400 12400 24700 Average 26000 42000 26000 42700 26000 43100 Stdev 31400 38800 31200 39800 31200 40000 p (t-test) 8.4E4 7.3E4 5.6E4 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 256 59 260 55 261 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.65 0.73 0.71 0.65 0.73 0.70 0.65 SE 0.030 0.031 0.042 0.031 0.032 0.043 0.032 0.033 0.044 p Value 2.2E11 7.7E9 3.0E4 4.2E14 2.8E11 6.8E4 1.0E12 3.7E9 7.2E4 nCohort Non- 186 192 256 204 206 260 219 218 261 persistent nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 88% 86% 93% 90% 89% 93% 93% 91% 93% Specificity 34% 32% 29% 33% 33% 29% 33% 32% 29% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 68% 66% 68% 73% 70% 67% 74% 70% 67% Specificity 62% 60% 54% 62% 61% 53% 61% 59% 53% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 43% 42% 39% 48% 45% 40% 48% 44% 41% Specificity 87% 86% 78% 87% 86% 78% 85% 83% 78% OR Quartile 2 3.68 3.00 5.70 4.64 3.94 5.17 6.37 4.68 5.04 p Value 2.4E5 2.9E4 0.0012 1.2E5 5.6E5 0.0022 9.4E6 4.6E5 0.0026 Lower limit of 2.01 1.66 1.99 2.33 2.02 1.80 2.81 2.23 1.76 95% CI Upper limit of 6.74 5.44 16.3 9.21 7.67 14.8 14.4 9.82 14.4 95% CI OR Quartile 3 3.51 2.98 2.46 4.36 3.60 2.36 4.52 3.45 2.28 p Value 1.8E7 5.6E6 0.0032 8.2E9 3.8E7 0.0061 2.3E8 2.0E6 0.0088 Lower limit of 2.19 1.86 1.35 2.64 2.20 1.28 2.66 2.07 1.23 95% CI Upper limit of 5.63 4.77 4.48 7.20 5.90 4.36 7.66 5.75 4.22 95% CI OR Quartile 4 5.04 4.41 2.28 6.27 5.09 2.37 5.19 3.95 2.46 p Value 8.7E9 7.5E8 0.0072 7.7E11 4.4E9 0.0058 2.6E9 5.0E7 0.0042 Lower limit of 2.90 2.57 1.25 3.61 2.95 1.28 3.02 2.31 1.33 95% CI Upper limit of 8.74 7.58 4.16 10.9 8.76 4.39 8.93 6.75 4.56 95% CI

TABLE-US-00039 TABLE 8.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9450 22000 9580 28600 9980 27300 Average 18500 41600 18300 44600 20200 44700 Stdev 23100 39200 22800 39900 25200 40100 p (t-test) 2.5E10 9.6E13 1.2E10 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 120000 146000 n (Patient) 175 142 190 127 205 112 sCr only Median 10600 22000 9980 28600 10800 22700 Average 18900 41900 18700 44700 20600 44200 Stdev 23000 40000 22800 40600 25200 40800 p (t-test) 4.4E10 3.1E12 8.4E10 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 120000 146000 n (Patient) 182 134 195 121 208 108 UO only Median 12400 21900 12400 22000 12400 22000 Average 25800 40300 25800 41300 25800 41300 Stdev 31100 38700 30900 39700 30900 39700 p (t-test) 0.0014 8.6E4 8.6E4 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 246 69 251 64 251 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.69 0.64 0.73 0.71 0.64 0.72 0.70 0.64 SE 0.030 0.031 0.039 0.030 0.031 0.041 0.031 0.032 0.041 p Value 1.2E11 1.2E9 5.0E4 1.8E14 3.1E12 8.1E4 6.4E12 8.5E10 8.1E4 nCohort Non- 175 182 246 190 195 251 205 208 251 persistent nCohort Persistent 142 134 69 127 121 64 112 108 64 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 87% 86% 91% 90% 88% 91% 91% 90% 91% Specificity 35% 33% 30% 35% 33% 29% 34% 33% 29% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 67% 66% 64% 70% 69% 64% 71% 69% 64% Specificity 63% 62% 54% 63% 62% 53% 61% 60% 53% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 40% 40% 36% 44% 44% 38% 44% 43% 38% Specificity 87% 86% 78% 87% 87% 78% 85% 84% 78% OR Quartile 2 3.69 2.98 4.43 4.67 3.82 3.96 5.18 4.28 3.96 p Value 1.2E5 2.0E4 9.3E4 3.0E6 3.2E5 0.0022 5.9E6 3.4E5 0.0022 Lower limit of 2.06 1.67 1.84 2.44 2.03 1.64 2.54 2.15 1.64 95% CI Upper limit of 6.61 5.29 10.7 8.91 7.19 9.59 10.5 8.52 9.59 95% CI OR Quartile 3 3.51 3.24 2.04 4.02 3.71 2.04 3.74 3.42 2.04 p Value 1.3E7 8.2E7 0.011 1.5E8 1.0E7 0.014 1.6E7 1.1E6 0.014 Lower limit of 2.20 2.03 1.17 2.48 2.29 1.16 2.28 2.09 1.16 95% CI Upper limit of 5.58 5.17 3.54 6.49 6.02 3.60 6.13 5.61 3.60 95% CI OR Quartile 4 4.43 4.24 2.02 5.46 5.07 2.14 4.37 3.93 2.14 p Value 1.3E7 2.1E7 0.017 1.8E9 6.2E9 0.011 6.4E8 4.7E7 0.011 Lower limit of 2.55 2.46 1.14 3.14 2.93 1.19 2.56 2.31 1.19 95% CI Upper limit of 7.70 7.31 3.59 9.48 8.76 3.85 7.45 6.70 3.85 95% CI

TABLE-US-00040 TABLE 8.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9450 22000 9600 28600 9980 24700 Average 18300 41500 18400 44300 19800 44400 Stdev 22900 39100 22800 39900 24400 40500 p (t-test) 2.0E10 2.1E12 6.9E11 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 116000 146000 n (Patient) 173 144 189 128 201 116 sCr only Median 10800 22000 10200 27300 10800 22700 Average 19100 41400 18800 43900 20200 44100 Stdev 23100 39900 22900 40400 24400 41100 p (t-test) 1.4E9 1.3E11 3.8E10 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 116000 146000 n (Patient) 180 136 192 124 204 112 UO only Median 12100 22000 12100 22000 12100 22000 Average 25500 39700 25700 40200 25700 40200 Stdev 31400 37400 31200 38400 31200 38400 p (t-test) 0.0012 0.0013 0.0013 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 239 76 245 70 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.65 0.72 0.71 0.64 0.71 0.70 0.64 SE 0.030 0.031 0.038 0.030 0.031 0.039 0.031 0.032 0.039 p Value 1.4E11 6.5E9 1.3E4 1.1E13 1.4E11 3.9E4 1.1E11 8.0E10 3.9E4 nCohort Non- 173 180 239 189 192 245 201 204 245 persistent nCohort Persistent 144 136 76 128 124 70 116 112 70 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 87% 85% 91% 89% 88% 90% 91% 89% 90% Specificity 35% 33% 30% 34% 33% 29% 34% 33% 29% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 67% 65% 66% 70% 69% 66% 70% 69% 66% Specificity 64% 62% 55% 63% 62% 54% 61% 60% 54% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 40% 40% 38% 44% 43% 39% 43% 42% 39% Specificity 87% 86% 79% 87% 86% 79% 85% 84% 79% OR Quartile 2 3.49 2.83 4.25 4.27 3.63 3.75 4.88 4.08 3.75 p Value 2.0E5 3.3E4 5.9E4 6.6E6 4.2E5 0.0018 6.0E6 3.6E5 0.0018 Lower limit of 1.97 1.60 1.86 2.27 1.96 1.64 2.46 2.09 1.64 95% CI Upper limit of 6.21 4.99 9.70 8.02 6.74 8.57 9.70 7.93 8.57 95% CI OR Quartile 3 3.49 3.05 2.33 3.88 3.55 2.28 3.65 3.34 2.28 p Value 1.3E7 2.5E6 0.0020 2.8E8 2.0E7 0.0036 1.9E7 1.3E6 0.0036 Lower limit of 2.19 1.92 1.36 2.40 2.20 1.31 2.24 2.05 1.31 95% CI Upper limit of 5.56 4.84 3.99 6.26 5.73 3.96 5.94 5.44 3.96 95% CI OR Quartile 4 4.63 4.08 2.33 5.35 4.77 2.33 4.32 3.89 2.33 p Value 7.2E8 4.1E7 0.0029 2.7E9 2.0E8 0.0036 8.1E8 5.7E7 0.0036 Lower limit of 2.65 2.37 1.33 3.08 2.76 1.32 2.53 2.28 1.32 95% CI Upper limit of 8.08 7.04 4.08 9.29 8.22 4.12 7.37 6.62 4.12 95% CI

TABLE-US-00041 TABLE 8.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9450 22000 9510 28600 9680 24700 Average 17900 41300 17700 44200 19600 43900 Stdev 22400 39000 22200 39600 24300 40100 p (t-test) 1.5E10 4.6E13 8.4E11 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 116000 146000 n (Patient) 169 148 184 133 197 120 sCr only Median 10800 22000 10200 27300 10800 22700 Average 18700 41200 18500 43600 20000 43700 Stdev 22700 39800 22600 40300 24100 40900 p (t-test) 1.0E9 1.0E11 3.2E10 Min 419 297 297 399 297 399 Max 116000 146000 116000 146000 116000 146000 n (Patient) 176 140 188 128 200 116 UO only Median 11900 23400 11900 22700 11900 22700 Average 24400 42200 24500 42400 24500 42400 Stdev 29800 39400 29800 39900 29800 39900 p (t-test) 2.9E5 3.3E5 3.3E5 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 234 81 237 78 237 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.67 0.73 0.71 0.66 0.71 0.70 0.66 SE 0.030 0.031 0.037 0.029 0.030 0.037 0.031 0.032 0.037 p Value 1.4E11 4.0E9 5.2E6 8.0E15 8.8E12 1.3E5 5.9E12 5.9E10 1.3E5 nCohort Non- 169 176 234 184 188 237 197 200 237 persistent nCohort Persistent 148 140 81 133 128 78 120 116 78 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 86% 86% 91% 89% 88% 91% 90% 90% 91% Specificity 35% 34% 31% 35% 34% 30% 34% 34% 30% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 66% 65% 68% 70% 68% 68% 70% 68% 68% Specificity 64% 62% 56% 64% 62% 56% 62% 60% 56% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 40% 39% 40% 44% 42% 40% 42% 41% 40% Specificity 88% 86% 80% 88% 87% 80% 85% 84% 80% OR Quartile 2 3.43 3.03 4.70 4.20 3.89 4.43 4.64 4.37 4.43 p Value 2.1E5 1.3E4 2.3E4 5.2E6 1.6E5 4.1E4 6.2E6 1.4E5 4.1E4 Lower limit of 1.95 1.72 2.06 2.26 2.10 1.94 2.38 2.24 1.94 95% CI Upper limit of 6.06 5.34 10.7 7.78 7.21 10.1 9.02 8.50 10.1 95% CI OR Quartile 3 3.47 3.02 2.69 4.16 3.50 2.67 3.80 3.27 2.67 p Value 1.4E7 2.7E6 2.7E4 5.0E9 2.3E7 3.8E4 7.0E8 1.5E6 3.8E4 Lower limit of 2.18 1.90 1.58 2.58 2.18 1.55 2.34 2.02 1.55 95% CI Upper limit of 5.51 4.79 4.59 6.70 5.62 4.57 6.16 5.30 4.57 95% CI OR Quartile 4 4.67 4.10 2.60 5.69 4.76 2.60 4.28 3.85 2.60 p Value 8.1E8 4.6E7 6.4E4 1.3E9 2.4E8 7.2E4 1.0E7 6.9E7 7.2E4 Lower limit of 2.66 2.37 1.50 3.25 2.75 1.49 2.51 2.26 1.49 95% CI Upper limit of 8.21 7.09 4.50 9.99 8.23 4.52 7.31 6.55 4.52 95% CI

TABLE-US-00042 TABLE 8.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 350000 595000 365000 595000 377000 605000 Average 435000 599000 444000 605000 451000 613000 Stdev 256000 279000 261000 277000 260000 285000 p (t-test) 1.2E7 5.6E7 1.7E6 Min 13600 105000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 206 121 222 105 238 89 sCr only Median 350000 596000 359000 594000 375000 590000 Average 432000 602000 443000 604000 450000 607000 Stdev 255000 276000 261000 273000 261000 278000 p (t-test) 3.8E8 5.1E7 2.9E6 Min 13600 105000 13600 151000 13600 154000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 208 118 223 103 236 90 UO only Median 404000 700000 404000 765000 406000 765000 Average 469000 677000 468000 691000 470000 693000 Stdev 264000 283000 264000 283000 264000 285000 p (t-test) 2.3E6 7.2E7 1.1E6 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 281 44 283 42 285 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.68 0.71 0.67 0.67 0.72 0.66 0.66 0.72 SE 0.032 0.032 0.046 0.033 0.033 0.047 0.035 0.035 0.048 p Value 9.0E8 2.5E8 7.4E6 4.5E7 3.3E7 3.0E6 3.2E6 3.1E6 5.1E6 nCohort Non- 206 208 281 222 223 283 238 236 285 persistent nCohort Persistent 121 118 44 105 103 42 89 90 40 Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 85% 86% 91% 86% 86% 90% 85% 87% 90% Specificity 31% 31% 27% 30% 30% 27% 29% 30% 27% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 66% 68% 75% 67% 67% 79% 67% 68% 80% Specificity 59% 60% 54% 58% 58% 54% 56% 57% 54% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 39% 39% 50% 39% 39% 52% 42% 39% 52% Specificity 83% 83% 79% 82% 81% 79% 81% 80% 79% OR Quartile 2 2.58 2.70 3.77 2.59 2.79 3.55 2.39 2.74 3.33 p Value 0.0014 1.0E3 0.014 0.0025 0.0015 0.019 0.0089 0.0031 0.027 Lower limit of 1.44 1.49 1.31 1.40 1.48 1.23 1.24 1.40 1.15 95% CI Upper limit of 4.61 4.88 10.9 4.81 5.24 10.3 4.58 5.35 9.67 95% CI OR Quartile 3 2.83 3.17 3.48 2.72 2.79 4.32 2.67 2.76 4.70 p Value 1.3E5 2.0E6 7.0E4 5.2E5 4.1E5 2.1E4 1.7E4 9.9E5 1.8E4 Lower limit of 1.77 1.97 1.69 1.68 1.71 1.99 1.60 1.66 2.09 95% CI Upper limit of 4.52 5.10 7.17 4.42 4.54 9.35 4.45 4.61 10.6 95% CI OR Quartile 4 3.10 3.05 3.68 2.83 2.74 4.09 3.05 2.56 4.06 p Value 1.7E5 2.2E5 9.9E5 8.4E5 1.5E4 3.7E5 3.9E5 5.2E4 5.7E5 Lower limit of 1.85 1.82 1.91 1.68 1.63 2.09 1.79 1.51 2.05 95% CI Upper limit of 5.20 5.11 7.10 4.75 4.60 7.98 5.19 4.35 8.03 95% CI

TABLE-US-00043 TABLE 8.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 338000 594000 359000 586000 371000 597000 Average 420000 596000 433000 599000 439000 609000 Stdev 248000 280000 253000 282000 253000 287000 p (t-test) 5.0E9 7.2E8 1.0E7 Min 13600 105000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 187 140 204 123 219 108 sCr only Median 341000 590000 359000 576000 371000 578000 Average 424000 593000 437000 589000 443000 594000 Stdev 253000 275000 259000 276000 259000 278000 p (t-test) 2.7E8 1.0E6 2.0E6 Min 13600 105000 13600 151000 13600 154000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 192 134 205 121 217 109 UO only Median 398000 600000 400000 607000 402000 607000 Average 462000 638000 462000 646000 463000 646000 Stdev 262000 290000 260000 293000 260000 295000 p (t-test) 3.2E6 1.5E6 2.5E6 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 260 65 263 62 265 60 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.68 0.68 0.67 0.66 0.68 0.67 0.66 0.68 SE 0.030 0.031 0.040 0.031 0.032 0.040 0.033 0.033 0.041 p Value 1.3E9 7.6E9 6.7E6 4.7E8 4.9E7 4.9E6 1.3E7 1.3E6 8.7E6 nCohort Non- 187 192 260 204 205 263 219 217 265 persistent nCohort Persistent 140 134 65 123 121 62 108 109 60 Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 86% 86% 89% 86% 86% 89% 86% 86% 88% Specificity 33% 33% 28% 32% 32% 28% 31% 31% 28% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 66% 66% 68% 65% 64% 69% 66% 65% 70% Specificity 61% 61% 54% 59% 59% 54% 58% 58% 54% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 38% 37% 43% 38% 36% 45% 40% 37% 45% Specificity 84% 83% 79% 83% 81% 79% 82% 81% 79% OR Quartile 2 2.98 2.96 3.30 2.92 2.84 3.08 2.73 2.80 2.93 p Value 1.5E4 2.0E4 0.0048 3.8E4 5.4E4 0.0081 0.0014 0.0011 0.011 Lower limit of 1.70 1.67 1.44 1.62 1.57 1.34 1.48 1.51 1.28 95% CI Upper limit of 5.22 5.23 7.55 5.26 5.13 7.06 5.06 5.18 6.75 95% CI OR Quartile 3 3.06 3.15 2.48 2.66 2.56 2.70 2.60 2.54 2.78 p Value 1.6E6 1.1E6 0.0019 3.6E5 7.3E5 0.0010 9.3E5 1.3E4 9.0E4 Lower limit of 1.94 1.99 1.40 1.67 1.61 1.49 1.61 1.58 1.52 95% CI Upper limit of 4.83 5.00 4.41 4.23 4.08 4.87 4.20 4.09 5.07 95% CI OR Quartile 4 3.32 2.98 2.89 2.99 2.51 3.19 3.05 2.42 3.12 p Value 6.9E6 3.5E5 3.0E4 3.1E5 4.1E4 9.7E5 2.4E5 7.9E4 1.5E4 Lower limit of 1.97 1.78 1.62 1.78 1.51 1.78 1.82 1.44 1.73 95% CI Upper limit of 5.60 4.99 5.13 5.00 4.19 5.71 5.13 4.04 5.63 95% CI

TABLE-US-00044 TABLE 8.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 323000 595000 339000 594000 342000 599000 Average 407000 598000 417000 603000 427000 610000 Stdev 244000 276000 246000 280000 249000 282000 p (t-test) 1.3E10 6.4E10 2.9E9 Min 13600 105000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 176 151 190 137 205 122 sCr only Median 326000 594000 339000 582000 342000 586000 Average 411000 598000 422000 598000 432000 601000 Stdev 248000 272000 252000 274000 255000 275000 p (t-test) 3.0E10 6.3E9 4.2E8 Min 13600 105000 13600 151000 13600 154000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 182 144 194 132 207 119 UO only Median 380000 607000 382000 641000 389000 609000 Average 453000 642000 455000 647000 456000 643000 Stdev 258000 286000 257000 289000 258000 290000 p (t-test) 9.1E8 1.1E7 2.6E7 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 249 76 253 72 254 71 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.69 0.69 0.69 0.69 0.69 0.68 0.69 SE 0.029 0.030 0.037 0.030 0.031 0.038 0.031 0.032 0.038 p Value 5.1E12 1.7E11 1.5E7 1.3E10 1.1E9 2.8E7 1.3E9 1.3E8 6.6E7 nCohort Non- 176 182 249 190 194 253 205 207 254 persistent nCohort Persistent 151 144 76 137 132 72 122 119 71 Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 87% 87% 89% 87% 87% 89% 87% 87% 89% Specificity 35% 35% 29% 34% 34% 29% 32% 32% 29% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 66% 67% 68% 66% 66% 69% 66% 66% 69% Specificity 64% 64% 55% 61% 61% 55% 60% 59% 55% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 38% 38% 43% 39% 37% 44% 39% 37% 44% Specificity 86% 85% 80% 85% 83% 80% 83% 82% 80% OR Quartile 2 3.56 3.48 3.53 3.36 3.41 3.24 3.15 3.32 3.18 p Value 9.8E6 1.8E5 0.0016 4.2E5 4.6E5 0.0032 1.9E4 1.3E4 0.0039 Lower limit of 2.03 1.97 1.61 1.88 1.89 1.48 1.72 1.79 1.45 95% CI Upper limit of 6.26 6.17 7.70 6.00 6.15 7.10 5.74 6.14 6.96 95% CI OR Quartile 3 3.43 3.63 2.69 3.00 3.00 2.82 2.90 2.89 2.74 p Value 1.2E7 4.3E8 3.6E4 2.5E6 3.0E6 2.9E4 8.0E6 9.8E6 4.3E4 Lower limit of 2.17 2.29 1.56 1.90 1.89 1.61 1.82 1.81 1.56 95% CI Upper limit of 5.41 5.75 4.64 4.74 4.76 4.93 4.64 4.63 4.79 95% CI OR Quartile 4 3.66 3.30 3.13 3.50 2.88 3.25 3.26 2.61 3.08 p Value 2.1E6 8.4E6 4.8E5 2.7E6 5.6E5 3.6E5 7.4E6 2.4E4 8.2E5 Lower limit of 2.14 1.95 1.81 2.07 1.72 1.86 1.95 1.56 1.76 95% CI Upper limit of 6.26 5.58 5.43 5.92 4.82 5.68 5.47 4.35 5.40 95% CI

TABLE-US-00045 TABLE 8.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 321000 590000 339000 586000 342000 595000 Average 406000 595000 417000 601000 425000 606000 Stdev 246000 274000 247000 279000 250000 280000 p (t-test) 1.9E10 9.9E10 3.2E9 Min 13600 105000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 173 154 188 139 200 127 sCr only Median 326000 594000 334000 582000 341000 590000 Average 408000 598000 417000 600000 425000 605000 Stdev 247000 272000 250000 274000 252000 275000 p (t-test) 1.5E10 1.2E9 3.9E9 Min 13600 105000 13600 151000 13600 154000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 179 147 190 136 202 124 UO only Median 377000 596000 382000 602000 389000 600000 Average 449000 632000 451000 637000 453000 634000 Stdev 257000 285000 256000 289000 257000 290000 p (t-test) 8.9E8 1.0E7 2.4E7 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 240 85 245 80 246 79 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.69 0.69 0.69 0.69 0.69 0.69 0.68 SE 0.029 0.029 0.035 0.030 0.030 0.036 0.031 0.031 0.036 p Value 5.3E12 5.7E12 9.1E8 1.7E10 1.3E10 1.8E7 1.0E9 7.6E10 4.3E7 nCohort Non- 173 179 240 188 190 245 200 202 246 persistent nCohort Persistent 154 147 85 139 136 80 127 124 79 Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 87% 87% 91% 87% 88% 90% 87% 88% 90% Specificity 36% 35% 30% 34% 34% 30% 33% 33% 30% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 66% 67% 67% 65% 66% 68% 66% 67% 67% Specificity 64% 64% 56% 61% 62% 56% 60% 60% 55% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 37% 37% 41% 38% 38% 42% 39% 38% 42% Specificity 86% 85% 80% 85% 84% 80% 84% 83% 80% OR Quartile 2 3.74 3.66 4.21 3.47 3.64 3.82 3.42 3.61 3.74 p Value 4.4E6 8.6E6 3.0E4 2.6E5 1.8E5 7.6E4 6.2E5 4.2E5 9.1E4 Lower limit of 2.13 2.07 1.93 1.94 2.02 1.75 1.87 1.95 1.72 95% CI Upper limit of 6.57 6.48 9.16 6.20 6.57 8.33 6.23 6.66 8.17 95% CI OR Quartile 3 3.51 3.71 2.57 2.99 3.14 2.59 2.93 3.09 2.52 p Value 6.8E8 2.5E8 3.6E4 2.6E6 1.1E6 4.4E4 5.5E6 2.4E6 6.7E4 Lower limit of 2.23 2.34 1.53 1.89 1.98 1.52 1.84 1.93 1.48 95% CI Upper limit of 5.54 5.87 4.32 4.71 4.97 4.41 4.66 4.93 4.29 95% CI OR Quartile 4 3.48 3.37 2.87 3.38 3.08 3.03 3.18 2.91 2.88 p Value 5.0E6 6.7E6 1.2E4 5.1E6 2.1E5 6.4E5 1.2E5 4.6E5 1.4E4 Lower limit of 2.04 1.98 1.68 2.00 1.83 1.76 1.90 1.74 1.67 95% CI Upper limit of 5.94 5.71 4.92 5.70 5.17 5.23 5.33 4.87 4.98 95% CI

TABLE-US-00046 TABLE 8.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 314000 577000 327000 572000 339000 578000 Average 407000 590000 417000 595000 424000 602000 Stdev 248000 273000 250000 276000 252000 277000 p (t-test) 6.5E10 2.6E9 5.7E9 Min 13600 105000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 169 158 183 144 196 131 sCr only Median 321000 586000 328000 577000 340000 582000 Average 406000 595000 416000 597000 424000 602000 Stdev 246000 272000 249000 274000 252000 275000 p (t-test) 1.8E10 1.4E9 5.1E9 Min 13600 105000 13600 151000 13600 154000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 175 151 186 140 198 128 UO only Median 371000 602000 375000 607000 377000 605000 Average 442000 640000 443000 644000 444000 641000 Stdev 252000 287000 251000 289000 252000 289000 p (t-test) 2.8E9 2.2E9 5.8E9 Min 13600 135000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 235 90 237 88 238 87 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.70 0.69 0.69 0.70 0.69 0.69 0.70 SE 0.029 0.029 0.034 0.030 0.030 0.034 0.031 0.031 0.035 p Value 1.4E11 4.7E12 2.7E9 2.1E10 1.2E10 3.0E9 9.8E10 7.8E10 8.1E9 nCohort Non- 169 175 235 183 186 237 196 198 238 persistent nCohort Persistent 158 151 90 144 140 88 131 128 87 Cutoff Quartile 2 260000 260000 262000 260000 260000 262000 260000 260000 262000 Sensitivity 87% 87% 91% 88% 87% 91% 88% 88% 91% Specificity 36% 35% 31% 35% 34% 31% 34% 33% 31% Cutoff Quartile 3 437000 433000 437000 437000 433000 437000 437000 433000 437000 Sensitivity 66% 67% 68% 65% 66% 68% 66% 66% 68% Specificity 64% 65% 57% 62% 62% 57% 61% 61% 56% Cutoff Quartile 4 707000 704000 708000 707000 704000 708000 707000 704000 708000 Sensitivity 36% 37% 42% 37% 37% 43% 37% 38% 43% Specificity 85% 85% 81% 84% 84% 81% 83% 83% 81% OR Quartile 2 3.68 3.59 4.62 3.76 3.56 4.45 3.65 3.50 4.37 p Value 4.3E6 8.6E6 1.1E4 7.4E6 1.8E5 1.7E4 2.4E5 4.5E5 2.0E4 Lower limit of 2.11 2.05 2.12 2.11 1.99 2.05 2.00 1.92 2.01 95% CI Upper limit of 6.43 6.31 10.0 6.72 6.35 9.68 6.66 6.39 9.51 95% CI OR Quartile 3 3.50 3.68 2.74 3.03 3.10 2.79 3.06 3.04 2.71 p Value 7.0E8 2.6E8 1.1E4 1.7E6 1.2E6 1.0E4 2.2E6 2.7E6 1.6E4 Lower limit of 2.22 2.33 1.64 1.93 1.96 1.66 1.92 1.91 1.62 95% CI Upper limit of 5.52 5.83 4.58 4.78 4.91 4.67 4.85 4.84 4.56 95% CI OR Quartile 4 3.25 3.38 3.17 3.09 3.07 3.33 2.95 2.89 3.17 p Value 1.5E5 7.2E6 2.1E5 2.2E5 2.3E5 9.9E6 3.8E5 5.1E5 2.3E5 Lower limit of 1.90 1.99 1.86 1.84 1.83 1.95 1.76 1.73 1.86 95% CI Upper limit of 5.55 5.75 5.40 5.21 5.17 5.69 4.94 4.84 5.42 95% CI

Example 9. Use of Metalloproteinase Inhibitor 1 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0145] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 1 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0146] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0147] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00047 TABLE 9.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 7870 21100 9400 20500 9450 22400 Average 15500 36800 18800 38800 19400 41100 Stdev 22400 36200 24100 38000 25100 38400 p (t-test) 1.6E8 4.3E8 3.9E9 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 119 198 158 159 179 138 sCr only Median 8850 20700 9980 20700 9560 23100 Average 16600 37100 18200 39700 19100 42000 Stdev 22300 37000 22300 39000 24000 39400 p (t-test) 3.2E8 3.4E9 5.1E10 Min 475 297 419 297 399 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 130 186 162 154 184 132 UO only Median 11800 27400 12100 29500 12100 31500 Average 24600 43300 25100 45500 25300 47500 Stdev 30500 38400 30600 39800 30600 40500 p (t-test) 2.0E5 1.9E5 9.4E6 Min 297 873 297 873 297 873 Max 146000 140000 146000 140000 146000 140000 n (Patient) 241 74 256 59 263 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.70 0.68 0.68 0.68 0.68 0.70 0.70 0.69 SE 0.028 0.029 0.038 0.030 0.030 0.041 0.030 0.030 0.043 p Value 6.7E16 7.2E12 1.0E6 1.7E9 2.5E9 7.7E6 2.7E11 4.0E11 7.8E6 nCohort Non- 119 130 241 158 162 256 179 184 263 persistent nCohort Persistent 198 186 74 159 154 59 138 132 52 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 86% 84% 92% 86% 85% 92% 88% 86% 90% Specificity 43% 38% 30% 36% 35% 29% 35% 33% 28% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 65% 65% 70% 64% 64% 71% 69% 70% 73% Specificity 74% 71% 56% 64% 64% 55% 64% 64% 54% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 34% 35% 39% 37% 38% 41% 40% 41% 42% Specificity 90% 89% 79% 87% 88% 79% 86% 86% 78% OR Quartile 2 4.55 3.38 4.92 3.51 3.01 4.39 3.77 3.14 3.68 p Value 3.8E8 6.8E6 3.8E4 9.1E6 8.3E5 0.0024 1.2E5 1.2E4 0.0078 Lower limit of 2.65 1.99 2.05 2.02 1.74 1.69 2.08 1.75 1.41 95% CI Upper limit of 7.81 5.75 11.9 6.12 5.21 11.4 6.83 5.63 9.62 95% CI OR Quartile 3 5.19 4.40 3.01 3.17 3.14 2.98 3.97 4.11 3.23 p Value 1.3E10 1.8E9 1.1E4 8.2E7 1.0E6 5.0E4 1.1E8 6.8E9 4.8E4 Lower limit of 3.14 2.72 1.72 2.00 1.98 1.61 2.48 2.55 1.67 95% CI Upper limit of 8.58 7.13 5.27 5.02 4.97 5.51 6.37 6.63 6.25 95% CI OR Quartile 4 4.66 4.45 2.46 3.85 4.41 2.51 4.08 4.40 2.65 p Value 5.6E6 3.5E6 0.0016 2.5E6 3.3E7 0.0026 3.8E7 1.0E7 0.0022 Lower limit of 2.40 2.37 1.40 2.20 2.49 1.38 2.37 2.55 1.42 95% CI Upper limit of 9.07 8.37 4.31 6.74 7.80 4.56 7.02 7.60 4.94 95% CI

TABLE-US-00048 TABLE 9.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 7070 20500 9020 20700 9010 22400 Average 15500 36100 17600 38500 18200 40400 Stdev 22900 35900 22700 37800 24100 37900 p (t-test) 7.2E8 1.2E8 1.2E9 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 112 205 147 170 165 152 sCr only Median 8650 20500 9980 20500 9450 22000 Average 16600 36700 18300 38600 18900 39900 Stdev 22600 36700 22800 38400 24300 38400 p (t-test) 9.4E8 3.1E8 1.0E8 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 126 190 154 162 169 147 UO only Median 11600 21900 12100 21900 12100 24700 Average 24400 39900 25100 41000 25200 41900 Stdev 30500 37400 30600 38700 30600 39300 p (t-test) 1.6E4 2.6E4 2.0E4 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 222 93 238 77 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.70 0.66 0.69 0.68 0.65 0.71 0.69 0.65 SE 0.028 0.029 0.035 0.029 0.030 0.038 0.029 0.030 0.039 p Value 4.4E16 1.7E11 3.2E6 4.3E11 3.8E9 5.3E5 1.1E13 1.1E10 7.5E5 nCohort Non- 112 126 222 147 154 238 165 169 245 persistent nCohort Persistent 205 190 93 170 162 77 152 147 70 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 86% 84% 92% 87% 86% 92% 89% 87% 91% Specificity 45% 39% 32% 39% 36% 31% 38% 36% 30% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 63% 64% 67% 64% 63% 66% 68% 67% 67% Specificity 74% 71% 57% 65% 64% 55% 66% 64% 55% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 34% 34% 37% 36% 36% 36% 39% 38% 37% Specificity 90% 89% 80% 88% 87% 79% 87% 86% 78% OR Quartile 2 4.89 3.39 5.90 4.26 3.45 5.24 4.78 3.71 4.53 p Value 9.0E9 6.1E6 2.2E5 3.5E7 1.0E5 2.2E4 2.5E7 8.1E6 7.8E4 Lower limit of 2.85 2.00 2.60 2.44 1.99 2.18 2.64 2.09 1.88 95% CI Upper limit of 8.41 5.76 13.4 7.44 5.99 12.6 8.66 6.60 10.9 95% CI OR Quartile 3 4.96 4.22 2.63 3.28 2.98 2.40 4.09 3.63 2.47 p Value 7.2E10 5.6E9 1.9E4 4.5E7 3.0E6 0.0014 3.8E9 5.6E8 0.0015 Lower limit of 2.98 2.60 1.58 2.07 1.88 1.40 2.56 2.28 1.41 95% CI Upper limit of 8.26 6.85 4.36 5.20 4.70 4.11 6.54 5.79 4.31 95% CI OR Quartile 4 4.66 4.16 2.27 4.11 3.84 2.10 4.35 3.91 2.14 p Value 1.1E5 9.6E6 0.0027 2.0E6 3.5E6 0.0094 3.0E7 1.3E6 0.0091 Lower limit of 2.34 2.21 1.33 2.29 2.17 1.20 2.48 2.25 1.21 95% CI Upper limit of 9.25 7.82 3.87 7.38 6.78 3.66 7.63 6.78 3.79 95% CI

TABLE-US-00049 TABLE 9.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 6980 20500 9010 20500 9010 21900 Average 15500 36000 17500 38200 18400 39200 Stdev 23000 35800 22800 37600 24500 37600 p (t-test) 9.9E8 1.7E8 1.4E8 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 111 206 144 173 158 159 sCr only Median 8510 20500 9450 20500 9450 20800 Average 16800 36400 18400 38100 19200 38700 Stdev 22700 36700 23000 38200 24700 38100 p (t-test) 1.8E7 7.7E8 1.1E7 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 124 192 151 165 163 153 UO only Median 11600 20500 11900 20900 12000 21700 Average 24900 37300 25300 38000 25500 38600 Stdev 31100 36600 31100 37300 31100 37800 p (t-test) 0.0019 0.0022 0.0021 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 212 103 225 90 232 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.69 0.64 0.70 0.67 0.63 0.70 0.68 0.63 SE 0.028 0.029 0.034 0.029 0.030 0.036 0.029 0.030 0.037 p Value 6.7E16 3.3E11 6.2E5 1.3E11 5.2E9 2.8E4 3.1E12 1.5E9 4.3E4 nCohort Non- 111 124 212 144 151 225 158 163 232 persistent nCohort Persistent 206 192 103 173 165 90 159 153 83 Cutoff Quartile 2 6030 6020 6080 6030 6020 6080 6030 6020 6080 Sensitivity 86% 84% 89% 87% 86% 89% 87% 86% 88% Specificity 45% 40% 32% 40% 37% 31% 37% 36% 30% Cutoff Quartile 3 14200 14100 14200 14200 14100 14200 14200 14100 14200 Sensitivity 63% 63% 63% 64% 62% 63% 66% 65% 64% Specificity 74% 70% 56% 66% 64% 55% 66% 64% 55% Cutoff Quartile 4 35900 35400 36300 35900 35400 36300 35900 35400 36300 Sensitivity 33% 34% 34% 36% 36% 34% 38% 37% 35% Specificity 90% 89% 79% 88% 87% 79% 87% 86% 78% OR Quartile 2 5.00 3.53 3.95 4.50 3.64 3.54 4.14 3.47 3.09 p Value 5.9E9 3.2E6 9.2E5 1.3E7 4.2E6 5.4E4 9.8E7 1.4E5 0.0021 Lower limit of 2.91 2.08 1.98 2.57 2.10 1.73 2.34 1.98 1.51 95% CI Upper limit of 8.60 6.00 7.86 7.86 6.31 7.24 7.32 6.09 6.34 95% CI OR Quartile 3 4.84 4.01 2.19 3.39 2.90 2.12 3.74 3.23 2.14 p Value 1.3E9 1.8E8 0.0015 2.5E7 5.0E6 0.0034 2.5E8 5.9E7 0.0040 Lower limit of 2.91 2.47 1.35 2.13 1.84 1.28 2.35 2.04 1.27 95% CI Upper limit of 8.05 6.50 3.55 5.38 4.58 3.51 5.96 5.12 3.58 95% CI OR Quartile 4 4.58 4.02 1.97 4.28 3.65 1.94 4.18 3.51 1.95 p Value 1.4E5 1.6E5 0.012 1.6E6 8.1E6 0.016 8.0E7 7.6E6 0.017 Lower limit of 2.30 2.14 1.16 2.36 2.07 1.13 2.37 2.03 1.13 95% CI Upper limit of 9.10 7.56 3.32 7.74 6.43 3.32 7.38 6.09 3.39 95% CI

TABLE-US-00050 TABLE 9.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 7070 20500 9010 20500 9010 21700 Average 15600 35900 17600 38000 18500 38800 Stdev 23000 35800 22900 37600 24600 37500 p (t-test) 1.5E7 2.8E8 2.9E8 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 110 207 143 174 156 161 sCr only Median 8510 20500 9980 19900 9560 20700 Average 16800 36400 18500 37900 19300 38500 Stdev 22700 36700 23000 38200 24700 38100 p (t-test) 1.8E7 1.3E7 1.8E7 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 124 192 150 166 162 154 UO only Median 11800 20500 11900 20500 11900 21300 Average 25100 36400 25300 37300 25500 37600 Stdev 31300 36300 31300 36700 31400 36900 p (t-test) 0.0044 0.0034 0.0038 Min 297 399 297 399 297 399 Max 146000 140000 146000 140000 146000 140000 n (Patient) 208 107 220 95 226 89 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.72 0.69 0.62 0.69 0.67 SE 0.028 0.029 0.034 0.029 0.030 p Value 2.7E15 3.3E11 2.3E4 5.1E11 1.6E8 nCohort Non- 110 124 208 143 150 persistent nCohort 207 192 107 174 166 Persistent Cutoff Quartile 2 6030 6020 6080 6030 6020 Sensitivity 86% 84% 88% 87% 86% Specificity 45% 40% 32% 39% 37% Cutoff Quartile 3 14200 14100 14200 14200 14100 Sensitivity 63% 63% 62% 63% 62% Specificity 74% 70% 56% 66% 63% Cutoff Quartile 4 35900 35400 36300 35900 35400 Sensitivity 33% 34% 34% 36% 36% Specificity 90% 89% 79% 88% 87% OR Quartile 2 4.74 3.53 3.36 4.23 3.43 p Value 1.6E8 3.2E6 2.5E4 3.2E7 9.6E6 Lower limit of 2.76 2.08 1.76 2.43 1.99 95% CI Upper limit of 8.13 6.00 6.43 7.34 5.91 95% CI OR Quartile 3 4.72 4.01 2.03 3.30 2.82 p Value 2.4E9 1.8E8 0.0036 4.4E7 8.4E6 Lower limit of 2.83 2.47 1.26 2.08 1.79 95% CI Upper limit of 7.85 6.50 3.27 5.24 4.46 95% CI OR Quartile 4 4.50 4.02 1.95 4.21 3.58 p Value 1.8E5 1.6E5 0.013 2.1E6 1.1E5 Lower limit of 2.26 2.14 1.15 2.32 2.03 95% CI Upper limit of 8.94 7.56 3.28 7.61 6.33 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.63 0.70 0.68 0.63 SE 0.035 0.029 0.030 0.036 p Value 2.9E4 8.7E12 5.0E9 4.1E4 nCohort Non- 220 156 162 226 persistent nCohort 95 161 154 89 Persistent Cutoff Quartile 2 6080 6030 6020 6080 Sensitivity 88% 87% 86% 88% Specificity 31% 37% 35% 30% Cutoff Quartile 3 14200 14200 14100 14200 Sensitivity 63% 66% 64% 64% Specificity 55% 66% 64% 55% Cutoff Quartile 4 36300 35900 35400 36300 Sensitivity 35% 37% 36% 35% Specificity 79% 87% 86% 79% OR Quartile 2 3.42 3.95 3.26 3.05 p Value 4.9E4 1.7E6 3.0E5 0.0016 Lower limit of 1.71 2.25 1.87 1.53 95% CI Upper limit of 6.81 6.92 5.67 6.10 95% CI OR Quartile 3 2.13 3.75 3.14 2.20 p Value 0.0027 2.5E8 1.0E6 0.0022 Lower limit of 1.30 2.35 1.98 1.33 95% CI Upper limit of 3.50 5.96 4.97 3.66 95% CI OR Quartile 4 2.01 4.04 3.45 1.98 p Value 0.010 1.4E6 1.0E5 0.013 Lower limit of 1.18 2.29 1.99 1.15 95% CI Upper limit of 3.43 7.13 5.99 3.40 95% CI

TABLE-US-00051 TABLE 9.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 6950 20500 8810 20500 8870 21300 Average 14700 35900 17100 37900 18100 38500 Stdev 21600 35900 22000 37600 24000 37500 p (t-test) 4.5E8 1.7E8 3.0E8 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 106 211 138 179 150 167 sCr only Median 8210 20500 9380 20500 9380 21100 Average 15900 36600 17700 38100 18600 38700 Stdev 21400 36800 22000 38200 23900 38000 p (t-test) 3.8E8 2.7E8 4.1E8 Min 475 297 419 297 419 297 Max 116000 146000 116000 146000 116000 146000 n (Patient) 121 195 146 170 158 158 UO only Median 11200 21300 11600 21300 11800 21500 Average 23600 38400 24100 39000 24400 39000 Stdev 29300 38100 29600 38400 29800 38700 p (t-test) 1.5E4 1.9E4 2.9E4 Min 297 399 297 399 297 399 Max 127000 146000 127000 146000 127000 146000 n (Patient) 202 113 212 103 217 98 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.73 0.70 0.65 0.69 0.68 SE 0.028 0.029 0.033 0.029 0.030 p Value 2.2E16 1.9E12 7.3E6 2.6E11 1.1E9 nCohort Non- 106 121 202 138 146 persistent nCohort 211 195 113 179 170 Persistent Cutoff Quartile 2 6030 6020 6080 6030 6020 Sensitivity 85% 85% 88% 87% 86% Specificity 45% 40% 33% 40% 38% Cutoff Quartile 3 14200 14100 14200 14200 14100 Sensitivity 63% 63% 64% 63% 62% Specificity 75% 71% 57% 66% 64% Cutoff Quartile 4 35900 35400 36300 35900 35400 Sensitivity 34% 34% 35% 36% 36% Specificity 92% 90% 80% 88% 88% OR Quartile 2 4.81 3.74 3.73 4.28 3.68 p Value 1.2E8 1.2E6 6.8E5 2.1E7 3.0E6 Lower limit of 2.80 2.20 1.95 2.47 2.13 95% CI Upper limit of 8.25 6.37 7.14 7.41 6.35 95% CI OR Quartile 3 4.89 4.20 2.37 3.24 2.99 p Value 2.0E9 8.9E9 3.6E4 7.1E7 2.9E6 Lower limit of 2.91 2.57 1.47 2.03 1.89 95% CI Upper limit of 8.21 6.84 3.81 5.15 4.74 95% CI OR Quartile 4 5.47 4.75 2.13 4.24 3.98 p Value 6.9E6 4.4E6 0.0042 2.7E6 3.6E6 Lower limit of 2.61 2.44 1.27 2.32 2.22 95% CI Upper limit of 11.5 9.25 3.59 7.76 7.14 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.65 0.70 0.69 0.64 SE 0.034 0.029 0.030 0.035 p Value 1.7E5 1.0E11 3.7E10 3.5E5 nCohort Non- 212 150 158 217 persistent nCohort 103 167 158 98 Persistent Cutoff Quartile 2 6080 6030 6020 6080 Sensitivity 89% 87% 86% 89% Specificity 32% 38% 36% 31% Cutoff Quartile 3 14200 14200 14100 14200 Sensitivity 64% 65% 65% 64% Specificity 57% 66% 65% 56% Cutoff Quartile 4 36300 35900 35400 36300 Sensitivity 35% 37% 37% 35% Specificity 80% 87% 87% 79% OR Quartile 2 3.95 4.04 3.49 3.61 p Value 9.2E5 8.8E7 1.0E5 2.6E4 Lower limit of 1.98 2.32 2.00 1.81 95% CI Upper limit of 7.86 7.05 6.08 7.19 95% CI OR Quartile 3 2.33 3.55 3.32 2.31 p Value 6.5E4 8.2E8 3.4E7 8.6E4 Lower limit of 1.43 2.24 2.09 1.41 95% CI Upper limit of 3.78 5.65 5.26 3.78 95% CI OR Quartile 4 2.11 3.97 3.78 2.03 p Value 0.0053 2.6E6 3.4E6 0.0088 Lower limit of 1.25 2.23 2.16 1.20 95% CI Upper limit of 3.57 7.05 6.64 3.45 95% CI

TABLE-US-00052 TABLE 9.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 279000 564000 321000 571000 342000 577000 Average 363000 566000 410000 572000 418000 589000 Stdev 236000 270000 253000 274000 249000 279000 p (t-test) 5.9E11 6.3E8 1.3E8 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 114 213 155 172 179 148 sCr only Median 280000 567000 314000 586000 340000 594000 Average 365000 572000 394000 586000 409000 600000 Stdev 235000 268000 237000 276000 244000 276000 p (t-test) 9.2E12 8.8E11 1.6E10 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 124 202 157 169 182 144 UO only Median 400000 595000 402000 660000 400000 693000 Average 457000 619000 461000 643000 460000 673000 Stdev 260000 289000 261000 288000 261000 280000 p (t-test) 3.7E6 1.5E6 8.5E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 245 80 261 64 269 56 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.72 0.73 0.66 0.68 0.70 SE 0.028 0.028 0.037 0.029 0.029 p Value 1.1E15 2.2E16 8.6E6 2.5E9 1.1E12 nCohort Non- 114 124 245 155 157 persistent nCohort 213 202 80 172 169 Persistent Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 85% 86% 85% 85% 86% Specificity 43% 43% 28% 36% 37% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 61% 62% 65% 62% 63% Specificity 70% 70% 55% 63% 64% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 33% 34% 44% 34% 37% Specificity 90% 90% 81% 85% 87% OR Quartile 2 4.11 4.45 2.22 3.18 3.54 p Value 1.3E7 3.4E8 0.020 2.0E5 4.5E6 Lower limit of 2.43 2.62 1.13 1.87 2.06 95% CI Upper limit of 6.95 7.57 4.36 5.40 6.07 95% CI OR Quartile 3 3.69 3.90 2.24 2.69 3.11 p Value 1.5E7 2.5E8 0.0025 1.5E5 8.6E7 Lower limit of 2.27 2.42 1.33 1.72 1.98 95% CI Upper limit of 6.00 6.29 3.79 4.20 4.89 95% CI OR Quartile 4 4.68 4.43 3.28 3.00 3.97 p Value 9.7E6 5.9E6 1.9E5 7.5E5 1.7E6 Lower limit of 2.36 2.33 1.90 1.74 2.26 95% CI Upper limit of 9.28 8.43 5.65 5.16 6.98 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.68 0.68 0.70 0.71 SE 0.040 0.030 0.029 0.041 p Value 4.0E6 2.2E9 8.8E12 2.1E7 nCohort Non- 261 179 182 269 persistent nCohort 64 148 144 56 Persistent Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 89% 86% 88% 91% Specificity 28% 35% 35% 28% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 69% 63% 65% 75% Specificity 54% 60% 62% 55% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 47% 38% 40% 50% Specificity 80% 85% 86% 80% OR Quartile 2 3.22 3.39 3.80 4.02 p Value 0.0057 2.1E5 6.6E6 0.0044 Lower limit of 1.41 1.93 2.13 1.54 95% CI Upper limit of 7.39 5.95 6.78 10.4 95% CI OR Quartile 3 2.63 2.57 2.92 3.67 p Value 0.0012 3.6E5 3.7E6 9.0E5 Lower limit of 1.47 1.64 1.85 1.91 95% CI Upper limit of 4.70 4.03 4.59 7.03 95% CI OR Quartile 4 3.55 3.58 4.11 3.98 p Value 1.7E5 2.6E6 2.6E7 7.0E6 Lower limit of 1.99 2.10 2.40 2.18 95% CI Upper limit of 6.32 6.10 7.05 7.28 95% CI

TABLE-US-00053 TABLE 9.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 272000 565000 300000 573000 314000 578000 Average 348000 568000 389000 579000 397000 594000 Stdev 224000 270000 237000 276000 237000 278000 p (t-test) 2.1E12 1.9E10 3.2E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 108 219 144 183 164 163 sCr only Median 277000 571000 299000 578000 314000 582000 Average 356000 574000 385000 585000 399000 592000 Stdev 228000 268000 236000 273000 241000 274000 p (t-test) 7.4E13 1.2E11 6.4E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 120 206 149 177 166 160 UO only Median 375000 590000 382000 602000 377000 609000 Average 446000 612000 451000 629000 451000 644000 Stdev 254000 290000 256000 290000 256000 287000 p (t-test) 3.7E7 2.3E7 4.7E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 225 100 241 84 248 77 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.74 0.74 0.67 0.70 0.72 SE 0.027 0.027 0.034 0.028 0.028 p Value 0 0 6.4E7 5.3E13 1.2E14 nCohort Non- 108 120 225 144 149 persistent nCohort 219 206 100 183 177 Persistent Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 85% 86% 86% 86% 86% Specificity 45% 44% 30% 39% 39% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 61% 63% 63% 62% 64% Specificity 72% 72% 56% 65% 66% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 33% 34% 42% 35% 36% Specificity 92% 90% 82% 88% 87% OR Quartile 2 4.68 4.83 2.60 3.84 4.06 p Value 1.1E8 7.0E9 0.0030 7.5E7 4.0E7 Lower limit of 2.76 2.83 1.38 2.25 2.36 95% CI Upper limit of 7.95 8.23 4.91 6.55 6.99 95% CI OR Quartile 3 4.10 4.24 2.13 3.11 3.50 p Value 3.4E8 6.3E9 0.0022 1.1E6 8.4E8 Lower limit of 2.48 2.60 1.31 1.97 2.21 95% CI Upper limit of 6.77 6.90 3.45 4.90 5.53 95% CI OR Quartile 4 5.50 4.63 3.35 3.76 3.78 p Value 6.0E6 5.7E6 6.1E6 7.4E6 5.0E6 Lower limit of 2.63 2.39 1.98 2.11 2.14 95% CI Upper limit of 11.5 8.98 5.66 6.72 6.69 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.68 0.71 0.71 0.69 SE 0.036 0.029 0.029 0.037 p Value 4.7E7 2.8E13 5.1E13 9.9E8 nCohort Non- 241 164 166 248 persistent nCohort 84 163 160 77 Persistent Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 89% 88% 88% 90% Specificity 30% 38% 37% 29% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 65% 63% 64% 69% Specificity 55% 63% 63% 56% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 44% 37% 37% 45% Specificity 81% 87% 86% 81% OR Quartile 2 3.55 4.35 4.17 3.60 p Value 8.5E4 3.4E7 7.0E7 0.0013 Lower limit of 1.69 2.47 2.37 1.65 95% CI Upper limit of 7.47 7.64 7.34 7.86 95% CI OR Quartile 3 2.34 2.90 3.03 2.77 p Value 0.0013 3.4E6 1.5E6 2.4E4 Lower limit of 1.39 1.85 1.93 1.61 95% CI Upper limit of 3.91 4.54 4.75 4.77 95% CI OR Quartile 4 3.43 4.07 3.63 3.56 p Value 7.4E6 7.8E7 3.5E6 5.8E6 Lower limit of 2.00 2.33 2.11 2.06 95% CI Upper limit of 5.88 7.11 6.26 6.17 95% CI

TABLE-US-00054 TABLE 9.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 270000 565000 298000 573000 303000 578000 Average 345000 569000 386000 579000 394000 590000 Stdev 223000 270000 238000 275000 238000 276000 p (t-test) 9.8E13 1.2E10 3.2E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 107 220 142 185 158 169 sCr only Median 275000 574000 295000 582000 300000 590000 Average 349000 576000 379000 587000 388000 595000 Stdev 223000 268000 233000 271000 235000 273000 p (t-test) 7.8E14 2.2E12 2.0E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 118 208 146 180 160 166 UO only Median 371000 595000 373000 598000 371000 602000 Average 440000 609000 446000 620000 447000 633000 Stdev 253000 286000 256000 285000 256000 283000 p (t-test) 1.1E7 1.5E7 3.7E8 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 216 109 230 95 237 88 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.75 0.75 0.67 0.71 0.72 SE 0.027 0.027 0.033 0.028 0.028 p Value 0 0 1.1E7 1.7E13 4.4E16 nCohort Non- 107 118 216 142 146 persistent nCohort 220 208 109 185 180 Persistent Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 85% 86% 86% 86% 87% Specificity 46% 45% 31% 39% 40% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 61% 63% 63% 62% 64% Specificity 73% 73% 56% 65% 67% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 33% 34% 40% 35% 36% Specificity 92% 91% 82% 87% 88% OR Quartile 2 4.79 5.03 2.76 3.98 4.28 p Value 7.3E9 3.1E9 0.0013 3.9E7 1.5E7 Lower limit of 2.82 2.95 1.49 2.33 2.49 95% CI Upper limit of 8.14 8.59 5.11 6.79 7.37 95% CI OR Quartile 3 4.27 4.57 2.24 3.12 3.61 p Value 1.8E8 1.6E9 8.5E4 1.0E6 4.5E8 Lower limit of 2.58 2.79 1.39 1.98 2.28 95% CI Upper limit of 7.08 7.49 3.59 4.92 5.72 95% CI OR Quartile 4 5.41 5.04 3.17 3.64 3.92 p Value 7.4E6 3.5E6 1.3E5 1.2E5 3.9E6 Lower limit of 2.58 2.54 1.89 2.04 2.20 95% CI Upper limit of 11.3 9.99 5.33 6.51 7.01 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.68 0.71 0.72 0.69 SE 0.034 0.028 0.028 0.035 p Value 1.7E7 8.4E14 2.0E15 4.2E8 nCohort Non- 230 158 160 237 persistent nCohort 95 169 166 88 Persistent Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 88% 88% 88% 89% Specificity 30% 39% 39% 30% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 65% 63% 64% 68% Specificity 56% 63% 64% 57% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 41% 36% 37% 42% Specificity 81% 87% 87% 81% OR Quartile 2 3.34 4.43 4.62 3.34 p Value 5.9E4 1.7E7 1.1E7 9.5E4 Lower limit of 1.68 2.54 2.62 1.63 95% CI Upper limit of 6.65 7.74 8.13 6.82 95% CI OR Quartile 3 2.40 2.90 3.19 2.79 p Value 5.4E4 3.4E6 5.0E7 1.0E4 Lower limit of 1.46 1.85 2.03 1.66 95% CI Upper limit of 3.94 4.55 5.02 4.67 95% CI OR Quartile 4 3.03 3.68 3.85 3.10 p Value 3.7E5 4.3E6 2.1E6 3.3E5 Lower limit of 1.79 2.11 2.20 1.82 95% CI Upper limit of 5.13 6.43 6.71 5.28 95% CI

TABLE-US-00055 TABLE 9.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 272000 565000 296000 568000 301000 574000 Average 346000 567000 386000 577000 393000 587000 Stdev 224000 270000 239000 274000 240000 275000 p (t-test) 2.2E12 1.7E10 6.5E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 106 221 140 187 155 172 sCr only Median 275000 574000 293000 577000 300000 582000 Average 349000 576000 378000 585000 388000 593000 Stdev 223000 268000 234000 271000 236000 272000 p (t-test) 7.8E14 3.0E12 3.0E12 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 118 208 144 182 158 168 UO only Median 375000 577000 375000 590000 375000 595000 Average 443000 597000 445000 612000 445000 620000 Stdev 255000 286000 255000 286000 256000 284000 p (t-test) 1.0E6 2.6E7 1.1E7 Min 13600 135000 13600 135000 13600 135000 Max 1120000 1090000 1120000 1090000 1120000 1090000 n (Patient) 211 114 223 102 229 96 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.74 0.75 0.66 0.71 0.72 SE 0.027 0.027 0.033 0.028 0.028 p Value 0 0 9.4E7 1.7E13 4.4E16 nCohort Non- 106 118 211 140 144 persistent nCohort 221 208 114 187 182 Persistent Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 85% 86% 86% 86% 87% Specificity 45% 45% 31% 40% 40% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 61% 63% 61% 62% 64% Specificity 73% 73% 56% 66% 67% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 33% 34% 39% 34% 35% Specificity 92% 91% 82% 87% 88% OR Quartile 2 4.55 5.03 2.73 4.13 4.44 p Value 2.0E8 3.1E9 0.0011 2.0E7 7.6E8 Lower limit of 2.68 2.95 1.49 2.42 2.58 95% CI Upper limit of 7.73 8.59 4.99 7.05 7.64 95% CI OR Quartile 3 4.17 4.57 2.02 3.13 3.63 p Value 3.1E8 1.6E9 0.0031 9.9E7 4.3E8 Lower limit of 2.51 2.79 1.27 1.98 2.29 95% CI Upper limit of 6.91 7.49 3.21 4.95 5.75 95% CI OR Quartile 4 5.32 5.04 2.86 3.53 3.80 p Value 9.2E6 3.5E6 6.3E5 2.0E5 6.6E6 Lower limit of 2.54 2.54 1.71 1.97 2.13 95% CI Upper limit of 11.1 9.99 4.79 6.30 6.78 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.67 0.71 0.72 0.68 SE 0.033 0.028 0.028 0.034 p Value 2.2E7 1.2E13 2.2E15 8.9E8 nCohort Non- 223 155 158 229 persistent nCohort 102 172 168 96 Persistent Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 89% 88% 88% 90% Specificity 31% 39% 39% 31% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 64% 62% 64% 66% Specificity 56% 63% 65% 56% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 39% 35% 36% 40% Specificity 81% 86% 87% 81% OR Quartile 2 3.78 4.67 4.78 3.86 p Value 1.4E4 6.6E8 6.0E8 2.0E4 Lower limit of 1.90 2.67 2.71 1.90 95% CI Upper limit of 7.52 8.16 8.41 7.88 95% CI OR Quartile 3 2.24 2.83 3.19 2.46 p Value 0.0010 5.6E6 5.0E7 3.6E4 Lower limit of 1.38 1.81 2.03 1.50 95% CI Upper limit of 3.63 4.43 5.03 4.04 95% CI OR Quartile 4 2.78 3.51 3.72 2.75 p Value 1.2E4 9.8E6 3.7E6 1.5E4 Lower limit of 1.65 2.01 2.13 1.63 95% CI Upper limit of 4.68 6.11 6.49 4.66 95% CI

TABLE-US-00056 TABLE 9.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 272000 564000 293000 565000 294000 571000 Average 347000 562000 383000 575000 389000 585000 Stdev 227000 271000 238000 274000 239000 274000 p (t-test) 1.6E11 1.9E10 4.2E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 102 225 135 192 149 178 sCr only Median 275000 568000 293000 571000 303000 574000 Average 351000 571000 381000 579000 390000 586000 Stdev 225000 269000 236000 272000 238000 273000 p (t-test) 8.4E13 3.2E11 3.4E11 Min 13600 105000 13600 105000 13600 105000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 115 211 140 186 154 172 UO only Median 369000 576000 363000 595000 367000 595000 Average 436000 601000 434000 618000 436000 623000 Stdev 250000 288000 249000 286000 250000 285000 p (t-test) 1.1E7 5.6E9 4.2E9 Min 13600 135000 13600 135000 13600 135000 Max 1040000 1120000 1040000 1120000 1040000 1120000 n (Patient) 204 121 214 111 219 106 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.74 0.74 0.67 0.71 0.72 SE 0.028 0.027 0.032 0.028 0.028 p Value 0 0 8.0E8 1.3E13 1.4E14 nCohort Non- 102 115 204 135 140 persistent nCohort 225 211 121 192 186 Persistent Cutoff Quartile 2 260000 260000 262000 260000 260000 Sensitivity 84% 85% 87% 86% 86% Specificity 45% 44% 32% 41% 40% Cutoff Quartile 3 437000 433000 437000 437000 433000 Sensitivity 60% 62% 62% 62% 63% Specificity 73% 72% 57% 67% 67% Cutoff Quartile 4 707000 704000 708000 707000 704000 Sensitivity 32% 34% 39% 34% 34% Specificity 91% 90% 83% 87% 87% OR Quartile 2 4.31 4.63 3.07 4.20 4.10 p Value 5.9E8 1.4E8 2.7E4 1.3E7 2.3E7 Lower limit of 2.54 2.72 1.68 2.47 2.40 95% CI Upper limit of 7.31 7.86 5.61 7.15 7.00 95% CI OR Quartile 3 4.04 4.25 2.15 3.26 3.47 p Value 8.3E8 9.3E9 0.0011 5.2E7 1.3E7 Lower limit of 2.42 2.59 1.36 2.06 2.18 95% CI Upper limit of 6.73 6.96 3.40 5.17 5.50 95% CI OR Quartile 4 4.96 4.79 3.07 3.55 3.56 p Value 2.1E5 7.0E6 2.1E5 2.5E5 1.8E5 Lower limit of 2.37 2.42 1.83 1.97 1.99 95% CI Upper limit of 10.4 9.50 5.14 6.41 6.35 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.69 0.71 0.71 0.69 SE 0.032 0.028 0.028 0.032 p Value 3.1E9 3.4E14 6.5E14 2.0E9 nCohort Non- 214 149 154 219 persistent nCohort 111 178 172 106 Persistent Cutoff Quartile 2 262000 260000 260000 262000 Sensitivity 90% 88% 87% 91% Specificity 33% 40% 39% 32% Cutoff Quartile 3 437000 437000 433000 437000 Sensitivity 65% 62% 63% 66% Specificity 57% 64% 64% 58% Cutoff Quartile 4 708000 707000 704000 708000 Sensitivity 41% 35% 35% 41% Specificity 83% 87% 86% 82% OR Quartile 2 4.42 4.78 4.35 4.61 p Value 2.1E5 3.0E8 1.8E7 2.5E5 Lower limit of 2.23 2.75 2.50 2.26 95% CI Upper limit of 8.77 8.32 7.56 9.37 95% CI OR Quartile 3 2.50 3.00 3.04 2.63 p Value 1.6E4 1.9E6 1.4E6 8.5E5 Lower limit of 1.55 1.91 1.93 1.63 95% CI Upper limit of 4.01 4.72 4.77 4.27 95% CI OR Quartile 4 3.26 3.75 3.48 3.15 p Value 7.9E6 5.8E6 1.1E5 1.5E5 Lower limit of 1.94 2.12 2.00 1.87 95% CI Upper limit of 5.48 6.64 6.07 5.30 95% CI

Example 10. Use of Metalloproteinase Inhibitor 2 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0148] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 2 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0149] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0150] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00057 TABLE 10.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9920 16000 10100 15400 10000 15100 Average 12700 33200 13500 32200 13000 31900 Stdev 10100 58100 10900 57100 10500 56600 p (t-test) 0.0084 0.027 0.034 Min 200 658 200 658 200 658 Max 42400 465000 42400 465000 38600 465000 n (Patient) 57 260 46 271 41 276 sCr only Median 12000 14800 12000 14800 11600 14800 Average 16600 33200 16600 33100 15800 33100 Stdev 13400 60100 13600 59900 12500 59400 p (t-test) 0.017 0.020 0.016 Min 200 658 200 658 200 658 Max 63200 465000 63200 465000 63200 465000 n (Patient) 76 240 74 242 70 246 UO only Median 10600 21700 10300 21200 10100 19600 Average 19200 46300 19200 42300 19300 39700 Stdev 38500 68200 40400 63900 42200 61000 p (t-test) 9.9E6 1.1E4 6.3E4 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 194 121 173 142 156 159 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.67 0.58 0.74 0.65 0.57 SE 0.036 0.037 0.030 0.040 0.037 p Value 2.8E6 0.037 6.7E16 2.7E4 0.042 nCohort 57 76 194 46 74 Recovered nCohort Non- 260 240 121 271 242 recovered Cutoff Quartile 2 7990 7980 8020 7990 7980 Sensitivity 79% 77% 93% 78% 77% Specificity 42% 30% 37% 41% 31% Cutoff Quartile 3 13500 13500 13500 13500 13500 Sensitivity 54% 52% 69% 53% 52% Specificity 68% 57% 62% 67% 57% Cutoff Quartile 4 28900 28100 29400 28900 28100 Sensitivity 28% 28% 40% 27% 28% Specificity 89% 84% 85% 87% 84% OR Quartile 2 2.71 1.43 8.15 2.47 1.50 p Value 0.0012 0.23 1.1E7 0.0066 0.17 Lower limit of 1.48 0.803 3.76 1.29 0.842 95% CI Upper limit of 4.96 2.53 17.7 4.76 2.66 95% CI OR Quartile 3 2.57 1.42 3.68 2.34 1.43 p Value 0.0024 0.19 1.2E7 0.012 0.19 Lower limit of 1.40 0.842 2.27 1.21 0.844 95% CI Upper limit of 4.72 2.38 5.97 4.54 2.41 95% CI OR Quartile 4 3.38 2.07 3.72 2.50 1.98 p Value 0.0071 0.036 1.3E6 0.045 0.049 Lower limit of 1.39 1.05 2.19 1.02 1.00 95% CI Upper limit of 8.22 4.07 6.33 6.15 3.90 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.73 0.66 0.59 0.72 SE 0.029 0.042 0.037 0.029 p Value 5.1E15 1.6E4 0.018 1.6E14 nCohort 173 41 70 156 Recovered nCohort Non- 142 276 246 159 recovered Cutoff Quartile 2 8020 7990 7980 8020 Sensitivity 91% 78% 77% 89% Specificity 38% 44% 33% 39% Cutoff Quartile 3 13500 13500 13500 13500 Sensitivity 67% 53% 52% 66% Specificity 64% 68% 57% 66% Cutoff Quartile 4 29400 28900 28100 29400 Sensitivity 37% 27% 28% 35% Specificity 85% 88% 86% 85% OR Quartile 2 6.12 2.76 1.66 5.03 p Value 4.2E8 0.0034 0.087 6.8E8 Lower limit of 3.20 1.40 0.929 2.80 95% CI Upper limit of 11.7 5.44 2.97 9.04 95% CI OR Quartile 3 3.53 2.42 1.45 3.78 p Value 1.2E7 0.013 0.18 2.3E8 Lower limit of 2.21 1.20 0.847 2.37 95% CI Upper limit of 5.63 4.87 2.47 6.02 95% CI OR Quartile 4 3.37 2.69 2.34 2.91 p Value 9.8E6 0.046 0.022 1.2E4 Lower limit of 1.97 1.02 1.13 1.69 95% CI Upper limit of 5.77 7.10 4.83 5.01 95% CI

TABLE-US-00058 TABLE 10.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 18100 10900 17200 10600 16100 Average 13600 35800 14200 34600 13700 34100 Stdev 11500 61500 12100 60300 12000 59500 p (t-test) 8.0E4 0.0031 0.0045 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 90 227 79 238 71 246 sCr only Median 12000 16000 12000 16000 11400 16600 Average 16700 35900 16700 35700 16000 35600 Stdev 14200 63700 14300 63400 13600 62800 p (t-test) 0.0023 0.0028 0.0022 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 106 211 104 213 99 218 UO only Median 11400 21700 11200 21100 10900 19500 Average 20000 49400 19900 45100 19900 42300 Stdev 37100 73200 38400 68700 39800 65300 p (t-test) 3.4E6 3.9E5 2.0E4 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 212 103 194 121 178 137 Recovery Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.66 0.59 0.71 0.64 0.59 SE 0.032 0.033 0.032 0.034 0.033 p Value 5.3E7 0.0065 7.9E11 3.3E5 0.0075 nCohort 90 106 212 79 104 Recovered nCohort Non- 227 211 103 238 213 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 Sensitivity 79% 77% 90% 78% 77% Specificity 34% 28% 33% 34% 29% Cutoff Quartile 3 13500 13500 13500 13500 13500 Sensitivity 56% 54% 68% 55% 54% Specificity 66% 57% 58% 65% 57% Cutoff Quartile 4 28900 28900 29400 28900 28900 Sensitivity 31% 30% 41% 30% 30% Specificity 90% 85% 83% 89% 85% OR Quartile 2 1.96 1.31 4.49 1.86 1.36 p Value 0.014 0.32 3.7E5 0.029 0.26 Lower limit of 1.14 0.768 2.20 1.06 0.798 95% CI Upper limit of 3.36 2.22 9.15 3.24 2.31 95% CI OR Quartile 3 2.46 1.50 2.99 2.23 1.51 p Value 5.1E4 0.089 1.5E5 0.0029 0.087 Lower limit of 1.48 0.940 1.82 1.32 0.942 95% CI Upper limit of 4.09 2.41 4.91 3.78 2.42 95% CI OR Quartile 4 4.10 2.45 3.26 3.31 2.36 p Value 2.0E4 0.0039 1.2E5 0.0017 0.0056 Lower limit of 1.95 1.33 1.92 1.57 1.29 95% CI Upper limit of 8.62 4.50 5.53 6.98 4.34 95% CI Recovery Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.69 0.65 0.60 0.69 SE 0.031 0.035 0.033 0.030 p Value 6.2E10 9.4E6 0.0018 7.6E10 nCohort 194 71 99 178 Recovered nCohort Non- 121 246 218 137 recovered Cutoff Quartile 2 8020 7990 7990 8020 Sensitivity 88% 78% 78% 87% Specificity 34% 37% 30% 34% Cutoff Quartile 3 13500 13500 13500 13500 Sensitivity 65% 54% 54% 65% Specificity 59% 65% 58% 61% Cutoff Quartile 4 29400 28900 28900 29400 Sensitivity 38% 30% 31% 36% Specificity 83% 90% 87% 83% OR Quartile 2 3.85 2.10 1.50 3.45 p Value 2.9E5 0.011 0.14 3.3E5 Lower limit of 2.05 1.19 0.879 1.92 95% CI Upper limit of 7.24 3.72 2.56 6.18 95% CI OR Quartile 3 2.74 2.20 1.57 2.93 p Value 2.8E5 0.0048 0.064 5.3E6 Lower limit of 1.71 1.27 0.973 1.84 95% CI Upper limit of 4.39 3.81 2.54 4.65 95% CI OR Quartile 4 2.99 3.86 2.94 2.75 p Value 4.2E5 0.0014 0.0012 1.6E4 Lower limit of 1.77 1.69 1.53 1.62 95% CI Upper limit of 5.06 8.82 5.62 4.65 95% CI

TABLE-US-00059 TABLE 10.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11300 18600 11300 18100 11000 17900 Average 15000 37600 15200 36800 14600 36000 Stdev 13100 64600 13400 63700 12800 62400 p (t-test) 2.5E4 5.9E4 9.1E4 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 114 203 107 210 97 220 sCr only Median 11900 18000 12000 17900 11600 17900 Average 16800 38000 17000 37500 16400 37400 Stdev 14800 66600 14900 66100 14300 65400 p (t-test) 4.9E4 7.4E4 6.3E4 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 127 190 124 193 119 198 UO only Median 11600 21500 11500 21400 11300 20600 Average 20700 48500 20800 45900 20100 44000 Stdev 37700 73600 38500 70900 38900 67800 p (t-test) 1.3E5 5.7E5 8.9E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 214 101 204 111 190 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.61 0.69 0.64 0.60 0.68 0.64 0.61 0.68 SE 0.031 0.032 0.033 0.032 0.032 0.033 0.032 0.032 0.031 p Value 2.5E6 8.2E4 1.7E8 1.3E5 0.0016 4.5E8 6.7E6 5.3E4 7.1E9 nCohort 114 127 214 107 124 204 97 119 190 Recovered nCohort Non- 203 190 101 210 193 111 220 198 125 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 80% 79% 87% 80% 79% 86% 80% 79% 86% Specificity 34% 31% 31% 35% 31% 31% 36% 32% 33% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 57% 55% 65% 57% 55% 64% 56% 55% 64% Specificity 62% 57% 57% 63% 57% 57% 63% 58% 59% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 33% 32% 41% 31% 32% 39% 31% 32% 38% Specificity 88% 85% 82% 87% 85% 82% 89% 87% 83% OR Quartile 2 2.12 1.78 3.02 2.11 1.76 2.93 2.26 1.80 3.08 p Value 0.0046 0.028 8.7E4 0.0050 0.032 6.8E4 0.0026 0.026 2.1E4 Lower limit of 1.26 1.06 1.57 1.25 1.05 1.57 1.33 1.07 1.70 95% CI Upper limit of 3.56 2.98 5.79 3.57 2.94 5.44 3.84 3.01 5.58 95% CI OR Quartile 3 2.20 1.67 2.50 2.19 1.63 2.39 2.15 1.69 2.55 p Value 9.9E4 0.027 2.5E4 0.0013 0.035 3.5E4 0.0022 0.025 8.0E5 Lower limit of 1.38 1.06 1.53 1.36 1.04 1.48 1.32 1.07 1.60 95% CI Upper limit of 3.52 2.63 4.09 3.53 2.57 3.84 3.51 2.68 4.07 95% CI OR Quartile 4 3.44 2.69 3.16 3.04 2.55 2.95 3.57 3.07 2.98 p Value 1.3E4 7.5E4 2.0E5 5.7E4 0.0014 5.3E5 2.9E4 2.7E4 4.7E5 Lower limit of 1.83 1.51 1.86 1.62 1.44 1.75 1.79 1.68 1.76 95% CI Upper limit of 6.47 4.78 5.38 5.73 4.54 4.99 7.12 5.63 5.03 95% CI

TABLE-US-00060 TABLE 10.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11400 18600 11300 18400 10900 18200 Average 17300 38500 17300 37400 17000 36500 Stdev 22300 66200 22900 64900 23500 63300 p (t-test) 4.3E4 9.4E4 0.0017 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 134 183 125 192 114 203 sCr only Median 11800 18200 11800 18100 11600 18100 Average 18000 38600 18100 38300 17800 38200 Stdev 22400 67300 22600 66900 22400 66500 p (t-test) 6.0E4 7.8E4 6.9E4 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 140 177 138 179 135 182 UO only Median 11600 21400 11400 21500 11400 20600 Average 20700 49000 20600 46900 20200 44700 Stdev 37500 74400 38100 71700 38500 68700 p (t-test) 1.0E5 2.8E5 6.8E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 216 99 207 108 194 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.68 0.64 0.62 0.68 0.65 0.62 0.67 SE 0.031 0.031 0.034 0.031 0.031 0.033 0.031 0.031 0.032 p Value 3.5E6 9.1E5 9.1E8 5.6E6 1.4E4 4.5E8 2.0E6 7.2E5 4.2E8 nCohort Recovered 134 140 216 125 138 207 114 135 194 nCohort Non- 183 177 99 192 179 108 203 182 121 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 82% 82% 86% 82% 82% 86% 82% 81% 85% Specificity 34% 34% 30% 35% 33% 31% 37% 33% 31% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 57% 56% 65% 57% 56% 65% 57% 56% 64% Specificity 60% 57% 56% 61% 57% 57% 61% 58% 58% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 33% 33% 41% 32% 33% 40% 32% 34% 38% Specificity 86% 85% 82% 86% 85% 83% 86% 86% 83% OR Quartile 2 2.38 2.29 2.61 2.44 2.21 2.77 2.62 2.18 2.62 p Value 0.0011 0.0018 0.0031 7.6E4 0.0026 0.0013 3.0E4 0.0032 0.0012 Lower limit of 1.41 1.36 1.38 1.45 1.32 1.49 1.55 1.30 1.46 95% CI Upper limit of 3.99 3.85 4.94 4.09 3.71 5.16 4.41 3.65 4.71 95% CI OR Quartile 3 1.99 1.69 2.37 2.08 1.69 2.49 2.08 1.74 2.44 p Value 0.0028 0.021 5.8E4 0.0018 0.021 2.0E4 0.0022 0.015 1.8E4 Lower limit of 1.27 1.08 1.45 1.31 1.08 1.54 1.30 1.11 1.53 95% CI Upper limit of 3.14 2.65 3.88 3.29 2.65 4.03 3.32 2.74 3.90 95% CI OR Quartile 4 3.03 2.83 3.31 2.84 2.74 3.14 2.82 3.08 2.99 p Value 1.6E4 2.6E4 1.0E5 4.7E4 4.1E4 2.1E5 7.9E4 1.3E4 4.2E5 Lower limit of 1.70 1.62 1.95 1.58 1.57 1.86 1.54 1.73 1.77 95% CI Upper limit of 5.38 4.96 5.63 5.08 4.79 5.32 5.17 5.47 5.06 95% CI

TABLE-US-00061 TABLE 10.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery stalls within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11900 19800 11900 20000 11900 20000 Average 20700 42300 20600 42000 20600 42000 Stdev 38800 67400 39100 66700 39100 66700 p (t-test) 3.4E4 3.9E4 3.9E4 Min 200 1490 200 1490 200 1490 Max 465000 428000 465000 428000 465000 428000 n (Patient) 188 129 185 132 185 132 sCr only Median 11800 18800 12000 18300 12000 18500 Average 18600 40600 18700 40000 18500 40200 Stdev 22400 70800 22500 70200 22300 70000 p (t-test) 2.0E4 3.4E4 2.6E4 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 160 157 157 160 156 161 UO only Median 11500 21500 11500 21500 11400 21500 Average 20500 48000 20500 47400 20000 47400 Stdev 37700 72900 37900 72000 37500 71500 p (t-test) 1.4E5 1.8E5 1.1E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 211 104 208 107 205 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.62 0.68 0.64 0.61 0.68 0.64 0.62 0.68 SE 0.032 0.031 0.033 0.032 0.031 0.033 0.032 0.031 0.033 p Value 3.2E5 1.8E4 9.2E8 1.6E5 4.8E4 5.0E8 1.6E5 2.4E4 2.9E8 nCohort Recovered 188 160 211 185 157 208 185 156 205 nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 83% 82% 85% 83% 81% 85% 83% 81% 85% Specificity 30% 31% 30% 31% 31% 30% 31% 31% 30% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 60% 57% 65% 60% 56% 65% 60% 56% 65% Specificity 56% 56% 57% 57% 55% 58% 57% 56% 58% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 36% 34% 41% 36% 34% 41% 36% 34% 41% Specificity 82% 84% 83% 82% 83% 83% 82% 84% 83% OR Quartile 2 2.12 2.01 2.34 2.23 1.97 2.47 2.23 2.00 2.37 p Value 0.0080 0.0092 0.0062 0.0046 0.011 0.0035 0.0046 0.0092 0.0046 Lower limit of 1.22 1.19 1.27 1.28 1.17 1.35 1.28 1.19 1.31 95% CI Upper limit of 3.68 3.39 4.30 3.87 3.31 4.54 3.87 3.37 4.31 95% CI OR Quartile 3 1.91 1.68 2.54 1.96 1.56 2.58 1.96 1.60 2.62 p Value 0.0051 0.022 1.8E4 0.0037 0.050 1.2E4 0.0037 0.038 8.6E5 Lower limit of 1.21 1.08 1.56 1.24 1.00 1.59 1.24 1.03 1.62 95% CI Upper limit of 3.02 2.62 4.13 3.08 2.43 4.19 3.08 2.49 4.24 95% CI OR Quartile 4 2.51 2.70 3.43 2.55 2.57 3.45 2.55 2.72 3.48 p Value 4.9E4 2.6E4 5.3E6 4.1E4 5.3E4 4.5E6 4.1E4 2.7E4 3.8E6 Lower limit of 1.50 1.58 2.02 1.52 1.51 2.03 1.52 1.59 2.05 95% CI Upper limit of 4.21 4.61 5.82 4.28 4.38 5.86 4.28 4.65 5.91 95% CI

TABLE-US-00062 TABLE 10.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 94400 115000 94100 114000 92400 114000 Average 101000 126000 101000 125000 99500 125000 Stdev 32200 45000 31900 44800 32900 44600 p (t-test) 2.7E4 0.0010 8.8E4 Min 57600 57000 57600 57000 57600 57000 Max 213000 299000 213000 299000 213000 299000 n (Patient) 52 275 42 285 38 289 sCr only Median 96000 116000 96000 116000 96000 115000 Average 101000 127000 101000 127000 101000 127000 Stdev 26600 46300 26000 46300 26400 46100 p (t-test) 1.3E5 1.1E5 2.6E5 Min 57600 57000 57600 57000 57600 57000 Max 213000 299000 213000 299000 213000 299000 n (Patient) 69 257 67 259 63 263 UO only Median 104000 121000 104000 120000 102000 119000 Average 117000 130000 115000 131000 115000 129000 Stdev 43200 44400 41100 46100 41900 45300 p (t-test) 0.0058 9.9E4 0.0047 Min 57000 64800 57000 64800 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 197 128 176 149 159 166 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.61 0.70 0.69 0.62 0.72 0.69 0.61 SE 0.035 0.033 0.032 0.039 0.033 0.031 0.038 0.034 0.031 p Value 2.0E8 2.3E8 3.9E4 4.2E7 1.6E8 1.4E4 1.6E8 4.7E8 3.3E4 nCohort Recovered 52 69 197 42 67 176 38 63 159 nCohort Non- 275 257 128 285 259 149 289 263 166 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 78% 78% 85% 78% 78% 84% 78% 78% 83% Specificity 42% 38% 31% 43% 37% 32% 47% 38% 33% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 55% 56% 60% 54% 56% 60% 54% 55% 58% Specificity 77% 71% 56% 76% 72% 58% 79% 71% 58% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 28% 30% 32% 28% 30% 32% 27% 30% 30% Specificity 92% 93% 79% 93% 94% 80% 92% 94% 79% OR Quartile 2 2.63 2.17 2.63 2.59 2.11 2.49 3.16 2.18 2.46 p Value 0.0023 0.0077 9.1E4 0.0055 0.011 8.9E4 0.0012 0.0094 7.3E4 Lower limit of 1.41 1.23 1.49 1.32 1.19 1.46 1.58 1.21 1.46 95% CI Upper limit of 4.89 3.84 4.67 5.07 3.75 4.28 6.34 3.91 4.16 95% CI OR Quartile 3 4.12 3.07 1.95 3.76 3.16 2.04 4.40 3.07 1.98 p Value 5.4E5 1.3E4 0.0038 5.1E4 1.1E4 0.0016 3.6E4 2.4E4 0.0024 Lower limit of 2.07 1.73 1.24 1.78 1.76 1.31 1.95 1.69 1.27 95% CI Upper limit of 8.19 5.46 3.06 7.94 5.68 3.19 9.92 5.59 3.08 95% CI OR Quartile 4 4.75 5.48 1.79 4.99 6.79 1.86 4.39 6.22 1.60 p Value 0.0037 4.4E4 0.024 0.0088 3.3E4 0.017 0.016 6.2E4 0.070 Lower limit of 1.66 2.12 1.08 1.50 2.39 1.12 1.31 2.18 0.962 95% CI Upper limit of 13.6 14.1 2.97 16.6 19.3 3.08 14.7 17.7 2.66 95% CI

TABLE-US-00063 TABLE 10.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 97900 116000 97400 115000 96000 114000 Average 108000 127000 110000 125000 110000 125000 Stdev 35600 45800 37400 45400 38900 44900 p (t-test) 4.8E4 0.0059 0.012 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 87 240 76 251 69 258 sCr only Median 98100 117000 98100 117000 98000 117000 Average 107000 129000 106000 128000 107000 128000 Stdev 32600 46900 32400 46800 32900 46600 p (t-test) 2.4E5 2.4E5 8.9E5 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 101 226 99 228 94 233 UO only Median 105000 123000 105000 120000 104000 120000 Average 117000 133000 116000 131000 116000 129000 Stdev 42700 45300 42100 45900 42900 44600 p (t-test) 0.0019 0.0029 0.0066 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 217 108 198 127 181 144 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.66 0.62 0.62 0.66 0.61 0.63 0.65 0.61 SE 0.033 0.031 0.034 0.035 0.031 0.032 0.036 0.032 0.032 p Value 5.8E6 4.8E7 2.1E4 3.4E4 4.5E7 5.1E4 4.5E4 3.5E6 3.6E4 nCohort Recovered 87 101 217 76 99 198 69 94 181 nCohort Non- 240 226 108 251 228 127 258 233 144 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 78% 79% 86% 78% 79% 84% 78% 79% 84% Specificity 34% 35% 30% 34% 34% 31% 36% 34% 32% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 57% 58% 62% 55% 57% 60% 54% 57% 59% Specificity 69% 66% 56% 66% 67% 56% 65% 66% 57% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 29% 30% 34% 27% 30% 32% 27% 30% 31% Specificity 85% 86% 79% 83% 87% 79% 81% 86% 79% OR Quartile 2 1.90 2.02 2.71 1.81 1.96 2.38 2.00 1.89 2.48 p Value 0.019 0.0082 0.0015 0.037 0.012 0.0026 0.017 0.018 0.0011 Lower limit of 1.11 1.20 1.46 1.03 1.16 1.35 1.13 1.11 1.44 95% CI Upper limit of 3.26 3.40 5.02 3.17 3.31 4.19 3.55 3.21 4.28 95% CI OR Quartile 3 2.96 2.67 2.06 2.35 2.70 1.90 2.22 2.53 1.90 p Value 4.6E5 8.6E5 0.0027 0.0018 7.9E5 0.0054 0.0046 2.6E4 0.0045 Lower limit of 1.76 1.64 1.28 1.38 1.65 1.21 1.28 1.54 1.22 95% CI Upper limit of 4.98 4.35 3.30 4.01 4.42 2.99 3.87 4.17 2.96 95% CI OR Quartile 4 2.30 2.67 1.99 1.84 2.87 1.83 1.57 2.62 1.66 p Value 0.012 0.0023 0.0088 0.070 0.0014 0.020 0.18 0.0036 0.050 Lower limit of 1.20 1.42 1.19 0.951 1.50 1.10 0.810 1.37 1.00 95% CI Upper limit of 4.41 5.03 3.33 3.55 5.49 3.03 3.05 5.02 2.74 95% CI

TABLE-US-00064 TABLE 10.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 98600 117000 98600 117000 98000 116000 Average 112000 127000 112000 126000 112000 126000 Stdev 40700 45000 40800 44900 41900 44400 p (t-test) 0.0049 0.0082 0.012 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 111 216 104 223 94 233 sCr only Median 98600 118000 98600 118000 98600 118000 Average 111000 129000 110000 129000 109000 129000 Stdev 38500 45900 37700 46000 37600 46000 p (t-test) 2.8E4 1.2E4 1.6E4 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 124 203 121 206 116 211 UO only Median 104000 125000 103000 125000 101000 123000 Average 115000 137000 114000 136000 114000 134000 Stdev 41400 46000 40600 46800 41200 45800 p (t-test) 1.9E5 1.7E5 7.8E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 219 106 208 117 193 132 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.62 0.64 0.67 0.62 0.65 0.66 0.62 0.64 0.65 SE 0.032 0.031 0.033 0.032 0.031 0.032 0.033 0.031 0.031 p Value 9.1E5 5.0E6 5.3E7 2.7E4 1.7E6 5.8E7 2.2E4 3.4E6 8.7E7 nCohort Recovered 111 124 219 104 121 208 94 116 193 nCohort Non- 216 203 106 223 206 117 233 211 132 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 78% 79% 89% 78% 79% 87% 78% 78% 86% Specificity 32% 31% 32% 31% 31% 32% 33% 31% 33% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 58% 59% 66% 57% 59% 65% 57% 59% 64% Specificity 66% 65% 58% 65% 65% 58% 66% 66% 59% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 29% 31% 39% 29% 31% 37% 28% 31% 34% Specificity 83% 84% 81% 83% 85% 81% 82% 85% 81% OR Quartile 2 1.66 1.71 3.60 1.54 1.69 3.16 1.76 1.61 3.07 p Value 0.055 0.039 1.6E4 0.11 0.044 2.5E4 0.037 0.066 1.6E4 Lower limit of 0.990 1.03 1.85 0.912 1.01 1.71 1.03 0.968 1.72 95% CI Upper limit of 2.77 2.83 7.01 2.59 2.80 5.85 2.98 2.69 5.49 95% CI OR Quartile 3 2.69 2.63 2.63 2.55 2.73 2.58 2.53 2.71 2.53 p Value 4.7E5 4.2E5 8.5E5 1.5E4 2.4E5 7.6E5 2.6E4 3.4E5 6.9E5 Lower limit of 1.67 1.66 1.63 1.57 1.71 1.61 1.54 1.69 1.60 95% CI Upper limit of 4.33 4.17 4.27 4.13 4.35 4.12 4.17 4.34 3.99 95% CI OR Quartile 4 1.99 2.29 2.74 1.92 2.58 2.52 1.75 2.59 2.18 p Value 0.019 0.0041 1.4E4 0.028 0.0014 4.1E4 0.066 0.0016 0.0026 Lower limit of 1.12 1.30 1.63 1.07 1.44 1.51 0.964 1.43 1.31 95% CI Upper limit of 3.54 4.02 4.60 3.45 4.61 4.20 3.19 4.69 3.62 95% CI

TABLE-US-00065 TABLE 10.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 98600 119000 98600 118000 98100 118000 Average 112000 128000 112000 128000 111000 128000 Stdev 40900 45100 41200 44900 39400 45300 p (t-test) 0.0012 0.0023 8.2E4 Min 57600 57000 57600 57000 57600 57000 Max 269000 299000 269000 299000 257000 299000 n (Patient) 134 193 125 202 113 214 sCr only Median 98700 120000 98600 121000 98700 120000 Average 111000 130000 110000 130000 110000 130000 Stdev 39400 45800 38700 45900 38400 46000 p (t-test) 1.2E4 3.3E5 5.7E5 Min 57600 57000 57600 57000 57600 57000 Max 269000 299000 269000 299000 269000 299000 n (Patient) 139 188 137 190 133 194 UO only Median 103000 128000 103000 124000 103000 123000 Average 114000 139000 114000 136000 114000 134000 Stdev 39800 47800 40400 47200 41200 46000 p (t-test) 9.4E7 1.2E5 7.2E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 220 105 211 114 198 127 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.65 0.68 0.63 0.66 0.66 0.64 0.65 0.65 SE 0.031 0.030 0.033 0.031 0.030 0.032 0.031 0.030 0.032 p Value 8.4E6 9.0E7 4.4E8 2.0E5 1.2E7 5.9E7 5.3E6 5.9E7 1.1E6 nCohort Recovered 134 139 220 125 137 211 113 133 198 nCohort Non- 193 188 105 202 190 114 214 194 127 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 80% 80% 89% 80% 81% 87% 80% 79% 86% Specificity 33% 32% 31% 33% 33% 31% 35% 32% 32% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 61% 62% 67% 60% 62% 64% 59% 61% 64% Specificity 66% 65% 58% 66% 66% 57% 66% 66% 59% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 31% 32% 40% 30% 33% 38% 30% 32% 35% Specificity 83% 84% 82% 83% 85% 82% 84% 86% 81% OR Quartile 2 1.99 1.95 3.54 1.92 2.02 3.00 2.10 1.78 2.83 p Value 0.0075 0.0094 1.9E4 0.012 0.0064 4.7E4 0.0046 0.026 4.6E4 Lower limit of 1.20 1.18 1.82 1.15 1.22 1.62 1.26 1.07 1.58 95% CI Upper limit of 3.31 3.24 6.89 3.18 3.35 5.56 3.50 2.94 5.05 95% CI OR Quartile 3 3.01 3.05 2.73 2.85 3.24 2.39 2.83 3.10 2.49 p Value 2.6E6 1.7E6 5.1E5 9.8E6 5.4E7 2.7E4 1.9E5 1.5E6 9.8E5 Lower limit of 1.90 1.93 1.68 1.79 2.05 1.50 1.76 1.96 1.57 95% CI Upper limit of 4.76 4.82 4.44 4.53 5.14 3.83 4.55 4.92 3.94 95% CI OR Quartile 4 2.12 2.49 3.00 2.14 2.83 2.67 2.25 2.89 2.23 p Value 0.0066 0.0011 3.4E5 0.0073 2.9E4 1.8E4 0.0063 2.8E4 0.0020 Lower limit of 1.23 1.44 1.78 1.23 1.61 1.60 1.26 1.63 1.34 95% CI Upper limit of 3.66 4.32 5.04 3.74 4.98 4.47 4.03 5.11 3.71 95% CI

TABLE-US-00066 TABLE 10.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 101000 119000 101000 120000 101000 119000 Average 114000 132000 114000 132000 114000 131000 Stdev 40800 46600 40900 46200 40900 46200 p (t-test) 4.5E4 3.1E4 4.3E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 187 140 184 143 183 144 sCr only Median 101000 118000 99700 120000 100000 119000 Average 113000 130000 112000 131000 112000 130000 Stdev 38800 47200 37800 47400 37900 47400 p (t-test) 4.7E4 6.7E5 1.5E4 Min 57600 57000 57600 57000 57600 57000 Max 269000 299000 269000 299000 269000 299000 n (Patient) 159 168 156 171 154 173 UO only Median 103000 124000 103000 125000 103000 124000 Average 114000 138000 114000 137000 114000 137000 Stdev 39600 48200 39800 47700 40100 47300 p (t-test) 3.0E6 3.1E6 5.1E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 215 110 212 113 209 116 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.62 0.66 0.63 0.64 0.67 0.63 0.63 0.67 SE 0.031 0.031 0.033 0.031 0.030 0.032 0.031 0.031 0.032 p Value 5.0E5 8.3E5 4.7E7 1.9E5 8.0E6 2.1E7 3.2E5 3.2E5 2.0E7 nCohort Recovered 187 159 215 184 156 212 183 154 209 nCohort Non- 140 168 110 143 171 113 144 173 116 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 83% 80% 86% 83% 81% 87% 83% 80% 87% Specificity 31% 31% 31% 32% 31% 31% 31% 31% 32% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 61% 60% 65% 61% 60% 65% 60% 60% 66% Specificity 58% 60% 58% 58% 61% 58% 58% 60% 58% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 33% 32% 39% 34% 33% 39% 33% 33% 38% Specificity 81% 82% 82% 82% 84% 82% 81% 84% 82% OR Quartile 2 2.17 1.82 2.81 2.28 1.92 2.95 2.15 1.73 3.11 p Value 0.0047 0.021 0.0010 0.0026 0.012 5.7E4 0.0048 0.033 3.1E4 Lower limit of 1.27 1.10 1.51 1.33 1.15 1.59 1.26 1.04 1.68 95% CI Upper limit of 3.72 3.03 5.20 3.91 3.18 5.47 3.67 2.87 5.75 95% CI OR Quartile 3 2.11 2.18 2.58 2.16 2.36 2.62 2.10 2.24 2.66 p Value 0.0010 5.4E4 9.8E5 7.1E4 1.5E4 6.7E5 0.0011 3.5E4 4.6E5 Lower limit of 1.35 1.40 1.60 1.38 1.51 1.63 1.35 1.44 1.66 95% CI Upper limit of 3.30 3.40 4.16 3.37 3.68 4.21 3.28 3.49 4.27 95% CI OR Quartile 4 2.05 2.22 2.90 2.23 2.62 2.92 2.19 2.54 2.75 p Value 0.0054 0.0028 5.5E5 0.0020 4.0E4 4.7E5 0.0025 6.2E4 1.1E4 Lower limit of 1.24 1.32 1.73 1.34 1.54 1.74 1.32 1.49 1.64 95% CI Upper limit of 3.41 3.73 4.86 3.71 4.46 4.89 3.64 4.32 4.60 95% CI

Example 11. Use of Metalloproteinase Inhibitor 2 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0151] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 2 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0152] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0153] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00067 TABLE 11.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 17900 10400 17900 10100 17900 Average 15300 36900 14700 36700 14500 36400 Stdev 13900 63700 13300 63200 13300 62700 p (t-test) 5.8E4 5.1E4 6.3E4 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 108 209 104 213 100 217 sCr only Median 12000 16000 11800 16000 11500 16600 Average 17000 37300 17000 37100 17000 36900 Stdev 14700 66400 14800 66100 14900 65800 p (t-test) 8.2E4 9.5E4 0.0011 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 126 190 124 192 122 194 UO only Median 11400 25100 11000 22700 11000 21700 Average 20500 51500 19900 48500 19900 46000 Stdev 38100 74800 38900 70600 39600 68200 p (t-test) 1.9E6 5.3E6 2.4E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 222 93 208 107 198 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.59 0.74 0.66 0.60 0.74 0.66 0.60 0.72 SE 0.031 0.032 0.033 0.031 0.032 0.031 0.031 0.032 0.031 p Value 1.6E6 0.0031 5.1E13 2.3E7 0.0023 5.3E15 1.3E7 0.0017 2.8E13 nCohort Recovered 108 126 222 104 124 208 100 122 198 nCohort Non- 209 190 93 213 192 107 217 194 117 recovered Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 81% 79% 92% 82% 79% 93% 82% 79% 91% Specificity 37% 31% 32% 38% 31% 35% 39% 32% 34% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 56% 53% 71% 56% 54% 69% 57% 54% 68% Specificity 61% 55% 59% 62% 56% 60% 64% 57% 60% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 32% 32% 44% 32% 32% 43% 32% 31% 41% Specificity 87% 86% 83% 88% 85% 84% 89% 85% 84% OR Quartile 2 2.56 1.68 5.90 2.79 1.74 7.56 2.83 1.81 5.04 p Value 4.2E4 0.048 2.2E5 1.3E4 0.034 1.2E6 1.1E4 0.024 3.9E6 Lower limit of 1.52 1.01 2.60 1.65 1.04 3.34 1.67 1.08 2.54 95% CI Upper limit of 4.33 2.81 13.4 4.72 2.92 17.1 4.80 3.03 10.0 95% CI OR Quartile 3 2.00 1.37 3.45 2.15 1.45 3.31 2.33 1.54 3.13 p Value 0.0042 0.17 3.2E6 0.0018 0.11 2.1E6 7.1E4 0.065 3.2E6 Lower limit of 1.24 0.874 2.05 1.33 0.922 2.02 1.43 0.974 1.94 95% CI Upper limit of 3.21 2.16 5.82 3.48 2.29 5.43 3.79 2.42 5.06 95% CI OR Quartile 4 3.10 2.84 3.82 3.60 2.74 4.00 3.77 2.65 3.75 p Value 4.6E4 4.7E4 1.1E6 1.7E4 7.2E4 3.6E7 1.6E4 0.0011 1.1E6 Lower limit of 1.65 1.58 2.23 1.85 1.53 2.35 1.89 1.48 2.20 95% CI Upper limit of 5.83 5.09 6.54 7.01 4.92 6.82 7.51 4.76 6.38 95% CI

TABLE-US-00068 TABLE 11.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11300 19300 11100 19300 11000 19300 Average 15500 40000 15400 39800 14900 39500 Stdev 13800 67800 13800 67400 13300 66600 p (t-test) 4.4E5 4.7E5 4.7E5 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 136 181 134 183 129 188 sCr only Median 12000 18700 12000 18600 11800 18200 Average 16900 40600 16900 40500 16900 40200 Stdev 14700 70200 14700 70000 14800 69600 p (t-test) 6.5E5 7.4E5 8.9E5 Min 200 658 200 658 200 658 Max 76000 465000 76000 465000 76000 465000 n (Patient) 149 168 148 169 146 171 UO only Median 11600 22100 11400 22100 11300 21700 Average 20600 52500 20300 51100 20100 47800 Stdev 37600 76500 38000 74400 38800 70600 p (t-test) 1.3E6 1.9E6 9.6E6 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 226 89 220 95 207 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.61 0.72 0.66 0.61 0.72 0.67 0.62 0.71 SE 0.030 0.031 0.034 0.030 0.031 0.033 0.030 0.031 0.032 p Value 4.5E7 3.4E4 2.3E10 1.8E7 3.2E4 2.0E11 3.8E8 2.4E4 3.5E11 nCohort Recovered 136 149 226 134 148 220 129 146 207 nCohort Non- 181 168 89 183 169 95 188 171 108 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 81% 79% 89% 81% 79% 89% 81% 80% 88% Specificity 33% 30% 31% 34% 30% 31% 34% 30% 32% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 59% 56% 69% 59% 56% 68% 60% 57% 68% Specificity 61% 56% 57% 62% 57% 58% 64% 58% 59% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 34% 35% 44% 34% 34% 44% 35% 34% 43% Specificity 87% 85% 82% 87% 85% 83% 88% 85% 84% OR Quartile 2 2.14 1.59 3.47 2.22 1.62 3.88 2.26 1.68 3.42 p Value 0.0039 0.075 6.6E4 0.0026 0.065 2.0E4 0.0020 0.048 2.0E4 Lower limit of 1.28 0.954 1.70 1.32 0.970 1.90 1.35 1.00 1.79 95% CI Upper limit of 3.58 2.66 7.11 3.72 2.70 7.94 3.80 2.80 6.55 95% CI OR Quartile 3 2.21 1.64 2.90 2.34 1.68 2.96 2.57 1.78 2.99 p Value 6.1E4 0.029 5.9E5 2.6E4 0.022 2.9E5 6.2E5 0.012 1.1E5 Lower limit of 1.41 1.05 1.72 1.48 1.08 1.78 1.62 1.14 1.84 95% CI Upper limit of 3.49 2.56 4.87 3.70 2.63 4.92 4.08 2.78 4.88 95% CI OR Quartile 4 3.42 3.04 3.63 3.61 2.99 3.92 4.02 2.89 3.91 p Value 3.7E5 8.0E5 3.0E6 2.2E5 1.0E4 6.3E7 9.9E6 1.7E4 5.2E7 Lower limit of 1.91 1.75 2.11 2.00 1.72 2.29 2.17 1.66 2.30 95% CI Upper limit of 6.12 5.29 6.23 6.54 5.20 6.71 7.44 5.03 6.67 95% CI

TABLE-US-00069 TABLE 11.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11300 19300 11300 19300 11000 19300 Average 17200 41100 17300 40700 16800 40600 Stdev 21500 69500 21700 69200 21600 68400 p (t-test) 5.7E5 7.8E5 6.3E5 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 154 163 152 165 148 169 sCr only Median 11500 19000 11500 18900 11400 18800 Average 17900 41500 17900 41300 17900 41200 Stdev 21500 71000 21600 70800 21600 70600 p (t-test) 7.0E5 8.0E5 8.9E5 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 161 156 160 157 159 158 UO only Median 11900 21500 11900 21500 11500 21500 Average 21500 49500 21600 49100 21200 46900 Stdev 38600 75700 38600 75400 39400 71800 p (t-test) 2.1E5 2.7E5 5.4E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 224 91 223 92 212 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.63 0.68 0.65 0.63 0.68 0.67 0.63 0.69 SE 0.030 0.031 0.035 0.030 0.031 0.035 0.030 0.031 0.033 p Value 3.0E7 2.0E5 2.2E7 4.5E7 1.8E5 3.3E7 3.5E8 1.6E5 1.3E8 nCohort Recovered 154 161 224 152 160 223 148 159 212 nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 83% 81% 86% 83% 82% 86% 83% 82% 87% Specificity 33% 31% 29% 34% 31% 30% 34% 31% 31% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 60% 58% 66% 60% 59% 65% 61% 59% 66% Specificity 60% 58% 56% 61% 58% 56% 62% 58% 58% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 36% 37% 42% 36% 36% 41% 36% 36% 41% Specificity 86% 86% 82% 86% 86% 82% 87% 86% 83% OR Quartile 2 2.39 1.97 2.51 2.47 2.01 2.55 2.65 2.04 3.13 p Value 0.0012 0.011 0.0059 7.8E4 0.0092 0.0049 3.1E4 0.0076 5.8E4 Lower limit of 1.41 1.17 1.30 1.46 1.19 1.33 1.56 1.21 1.63 95% CI Upper limit of 4.05 3.33 4.82 4.19 3.39 4.91 4.49 3.45 6.00 95% CI OR Quartile 3 2.30 1.91 2.49 2.30 1.96 2.39 2.56 2.02 2.63 p Value 2.9E4 0.0043 4.3E4 2.9E4 0.0030 7.0E4 4.8E5 0.0021 1.1E4 Lower limit of 1.47 1.23 1.50 1.47 1.26 1.44 1.63 1.29 1.61 95% CI Upper limit of 3.61 2.99 4.13 3.61 3.07 3.96 4.04 3.15 4.30 95% CI OR Quartile 4 3.59 3.45 3.20 3.47 3.40 3.12 3.83 3.34 3.26 p Value 7.7E6 9.5E6 2.2E5 1.3E5 1.3E5 3.1E5 4.6E6 1.7E5 1.2E5 Lower limit of 2.05 2.00 1.87 1.98 1.96 1.83 2.16 1.93 1.92 95% CI Upper limit of 6.29 5.98 5.47 6.08 5.88 5.34 6.81 5.77 5.53 95% CI

TABLE-US-00070 TABLE 11.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11500 19100 11400 19000 11300 19200 Average 19000 41300 18900 40900 18600 40800 Stdev 25200 71400 25300 70700 25400 69900 p (t-test) 1.8E4 2.2E4 1.8E4 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 168 149 165 152 161 156 sCr only Median 11900 18800 11900 18700 11800 18600 Average 19300 41600 19300 41400 19300 41200 Stdev 25100 72300 25100 72100 25200 71900 p (t-test) 1.9E4 2.2E4 2.4E4 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 172 145 171 146 170 147 UO only Median 11900 21500 11800 21500 11500 21500 Average 21600 49100 21500 49100 21300 47200 Stdev 38600 75500 38600 75100 39200 72500 p (t-test) 2.6E5 2.4E5 5.3E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 223 92 222 93 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.67 0.64 0.62 0.68 0.65 0.62 0.68 SE 0.031 0.032 0.035 0.031 0.032 0.035 0.031 0.032 0.033 p Value 1.0E5 1.2E4 6.6E7 7.2E6 1.1E4 2.8E7 8.9E7 1.0E4 5.3E8 nCohort Recovered 168 172 223 165 171 222 161 170 214 nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 83% 81% 85% 83% 82% 85% 83% 82% 86% Specificity 32% 30% 29% 32% 30% 29% 33% 31% 30% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 60% 58% 65% 60% 58% 66% 61% 59% 66% Specificity 58% 56% 56% 59% 57% 56% 60% 57% 57% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 36% 37% 41% 36% 36% 42% 36% 36% 41% Specificity 84% 84% 82% 84% 84% 82% 85% 84% 82% OR Quartile 2 2.18 1.89 2.29 2.29 1.93 2.34 2.45 1.96 2.71 p Value 0.0042 0.018 0.011 0.0023 0.015 0.0091 9.9E4 0.013 0.0021 Lower limit of 1.28 1.11 1.21 1.34 1.13 1.23 1.44 1.15 1.44 95% CI Upper limit of 3.72 3.22 4.34 3.91 3.27 4.42 4.19 3.33 5.12 95% CI OR Quartile 3 2.08 1.78 2.39 2.13 1.83 2.46 2.36 1.87 2.66 p Value 0.0014 0.011 7.0E4 9.7E4 0.0082 4.7E4 1.9E4 0.0059 1.0E4 Lower limit of 1.33 1.14 1.44 1.36 1.17 1.48 1.50 1.20 1.63 95% CI Upper limit of 3.25 2.78 3.96 3.33 2.86 4.06 3.70 2.93 4.36 95% CI OR Quartile 4 2.88 3.09 3.12 2.95 3.04 3.29 3.20 2.99 3.16 p Value 9.3E5 3.2E5 3.1E5 7.4E5 4.2E5 1.3E5 2.8E5 5.5E5 2.0E5 Lower limit of 1.70 1.82 1.83 1.73 1.79 1.92 1.86 1.76 1.86 95% CI Upper limit of 4.90 5.27 5.34 5.03 5.17 5.61 5.50 5.08 5.38 95% CI

TABLE-US-00071 TABLE 11.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11900 20900 11900 20900 11800 21100 Average 21500 43700 21400 43400 21400 43300 Stdev 39800 69300 39900 68800 40000 68500 p (t-test) 3.4E4 3.7E4 4.0E4 Min 200 1490 200 1490 200 1490 Max 465000 428000 465000 428000 465000 428000 n (Patient) 203 114 201 116 200 117 sCr only Median 11900 19000 11900 19000 11900 19000 Average 19100 44000 19100 44000 19100 44000 Stdev 24400 75300 24400 75300 24400 75300 p (t-test) 3.4E5 3.4E5 3.4E5 Min 200 658 200 658 200 658 Max 215000 465000 215000 465000 215000 465000 n (Patient) 185 132 185 132 185 132 UO only Median 11800 21500 11700 21500 11700 21500 Average 21700 47200 21600 47200 21600 46600 Stdev 39100 73500 39200 73100 39400 72500 p (t-test) 7.4E5 6.6E5 9.6E5 Min 200 2170 200 2170 200 2170 Max 465000 428000 465000 428000 465000 428000 n (Patient) 217 98 216 99 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.63 0.67 0.64 0.63 0.67 0.65 0.63 0.67 SE 0.033 0.032 0.034 0.033 0.032 0.034 0.033 0.032 0.034 p Value 1.4E5 4.9E5 1.2E6 1.1E5 4.9E5 5.1E7 8.0E6 4.9E5 6.9E7 nCohort Recovered 203 185 217 201 185 216 200 185 214 nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 7990 7990 8020 7990 7990 8020 7990 7990 8020 Sensitivity 83% 83% 84% 84% 83% 84% 84% 83% 84% Specificity 30% 30% 29% 30% 30% 29% 30% 30% 29% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 62% 59% 65% 62% 59% 66% 62% 59% 65% Specificity 57% 56% 57% 57% 56% 57% 57% 56% 57% Cutoff Quartile 4 28900 28900 29400 28900 28900 29400 28900 28900 29400 Sensitivity 39% 39% 41% 39% 39% 41% 38% 39% 41% Specificity 82% 84% 82% 83% 84% 82% 82% 84% 82% OR Quartile 2 2.10 2.06 2.10 2.17 2.06 2.14 2.21 2.06 2.22 p Value 0.012 0.0099 0.017 0.0084 0.0099 0.015 0.0070 0.0099 0.011 Lower limit of 1.18 1.19 1.14 1.22 1.19 1.16 1.24 1.19 1.20 95% CI Upper limit of 3.74 3.56 3.86 3.87 3.56 3.93 3.94 3.56 4.08 95% CI OR Quartile 3 2.16 1.85 2.46 2.14 1.85 2.53 2.20 1.85 2.50 p Value 0.0013 0.0075 3.6E4 0.0014 0.0075 2.4E4 9.5E4 0.0075 2.5E4 Lower limit of 1.35 1.18 1.50 1.34 1.18 1.54 1.38 1.18 1.53 95% CI Upper limit of 3.45 2.92 4.04 3.42 2.92 4.15 3.51 2.92 4.09 95% CI OR Quartile 4 2.92 3.39 3.15 3.01 3.39 3.31 2.95 3.39 3.16 p Value 5.8E5 6.2E6 2.3E5 3.6E5 6.2E6 1.0E5 4.8E5 6.2E6 2.0E5 Lower limit of 1.73 2.00 1.85 1.78 2.00 1.95 1.75 2.00 1.86 95% CI Upper limit of 4.91 5.75 5.36 5.07 5.75 5.63 4.96 5.75 5.38 95% CI

TABLE-US-00072 TABLE 11.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 97900 117000 97500 117000 97500 117000 Average 107000 129000 107000 128000 107000 128000 Stdev 34500 46400 34800 46300 35400 46100 p (t-test) 2.0E5 4.4E5 1.0E4 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 105 222 102 225 98 229 sCr only Median 97900 120000 97900 120000 97900 120000 Average 106000 131000 106000 131000 106000 131000 Stdev 32400 47500 32700 47300 32600 47200 p (t-test) 5.5E7 7.3E7 6.2E7 Min 57600 57000 57600 57000 57600 57000 Max 257000 299000 257000 299000 257000 299000 n (Patient) 121 205 119 207 117 209 UO only Median 106000 123000 105000 124000 104000 123000 Average 118000 132000 116000 134000 115000 133000 Stdev 43100 45000 41300 46900 41800 46000 p (t-test) 0.0068 2.9E4 6.0E4 Min 57000 70200 57000 70200 57000 70200 Max 299000 281000 299000 281000 299000 281000 n (Patient) 226 99 213 112 202 123 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.68 0.62 0.66 0.68 0.63 0.66 0.68 0.63 SE 0.031 0.030 0.035 0.031 0.030 0.033 0.031 0.030 0.032 p Value 7.3E8 1.9E9 9.0E4 2.6E7 1.6E9 4.9E5 7.9E7 9.3E10 5.1E5 nCohort Recovered 105 121 226 102 119 213 98 117 202 nCohort Non- 222 205 99 225 207 112 229 209 123 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 80% 80% 86% 80% 80% 87% 79% 80% 86% Specificity 35% 34% 30% 35% 34% 31% 35% 34% 32% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 59% 60% 61% 58% 60% 62% 58% 60% 60% Specificity 68% 67% 54% 68% 67% 56% 67% 68% 56% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 32% 33% 35% 31% 33% 37% 31% 33% 34% Specificity 89% 88% 79% 88% 88% 81% 88% 89% 80% OR Quartile 2 2.14 2.05 2.56 2.12 2.13 2.90 2.00 2.07 2.89 p Value 0.0039 0.0057 0.0036 0.0045 0.0037 7.0E4 0.0093 0.0053 4.4E4 Lower limit of 1.28 1.23 1.36 1.26 1.28 1.57 1.19 1.24 1.60 95% CI Upper limit of 3.59 3.41 4.82 3.57 3.54 5.38 3.38 3.44 5.23 95% CI OR Quartile 3 2.95 3.04 1.84 2.91 3.06 2.03 2.81 3.09 1.92 p Value 1.4E5 3.7E6 0.013 2.1E5 3.5E6 0.0029 4.7E5 3.3E6 0.0051 Lower limit of 1.81 1.90 1.14 1.78 1.91 1.27 1.71 1.92 1.22 95% CI Upper limit of 4.81 4.86 2.97 4.77 4.92 3.24 4.61 4.98 3.02 95% CI OR Quartile 4 3.57 3.79 2.08 3.39 3.67 2.42 3.16 3.94 2.10 p Value 1.7E4 3.2E5 0.0059 3.2E4 5.0E5 7.3E4 7.2E4 3.0E5 0.0042 Lower limit of 1.84 2.02 1.24 1.74 1.96 1.45 1.62 2.07 1.26 95% CI Upper limit of 6.94 7.11 3.51 6.59 6.88 4.05 6.14 7.51 3.49 95% CI

TABLE-US-00073 TABLE 11.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 98000 120000 97900 119000 98000 118000 Average 111000 129000 111000 129000 112000 128000 Stdev 41500 44400 41600 44300 42200 44200 p (t-test) 2.4E4 2.5E4 8.6E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 134 193 133 194 128 199 sCr only Median 98600 121000 98600 121000 98600 121000 Average 110000 131000 110000 131000 110000 131000 Stdev 39300 45700 39400 45600 39500 45400 p (t-test) 1.9E5 2.1E5 2.0E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 146 181 145 182 143 184 UO only Median 104000 124000 104000 125000 104000 125000 Average 116000 136000 115000 138000 115000 135000 Stdev 41900 46400 40800 47500 41300 46100 p (t-test) 1.5E4 1.5E5 4.3E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 231 94 225 100 210 115 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.66 0.65 0.66 0.66 0.67 0.65 0.66 0.66 SE 0.030 0.030 0.035 0.030 0.030 0.034 0.030 0.030 0.032 p Value 2.0E7 4.7E8 1.3E5 1.7E7 4.0E8 1.0E6 1.6E6 2.8E8 9.4E7 nCohort Recovered 134 146 231 133 145 225 128 143 210 nCohort Non- 193 181 94 194 182 100 199 184 115 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 82% 82% 88% 82% 82% 89% 81% 82% 87% Specificity 35% 34% 30% 35% 34% 31% 34% 34% 31% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 61% 62% 65% 61% 62% 66% 60% 62% 64% Specificity 66% 64% 56% 66% 65% 57% 66% 65% 58% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 31% 33% 38% 31% 32% 39% 30% 33% 37% Specificity 84% 84% 80% 83% 84% 81% 83% 85% 81% OR Quartile 2 2.44 2.27 3.28 2.48 2.30 3.65 2.22 2.23 3.06 p Value 6.1E4 0.0017 7.2E4 4.8E4 0.0013 2.2E4 0.0021 0.0020 3.8E4 Lower limit of 1.46 1.36 1.65 1.49 1.38 1.84 1.34 1.34 1.65 95% CI Upper limit of 4.06 3.77 6.53 4.14 3.84 7.26 3.69 3.71 5.66 95% CI OR Quartile 3 3.01 2.93 2.34 3.10 3.02 2.56 2.90 3.03 2.45 p Value 2.6E6 3.1E6 8.1E4 1.5E6 1.8E6 1.7E4 6.4E6 1.8E6 1.8E4 Lower limit of 1.90 1.87 1.42 1.96 1.92 1.57 1.83 1.92 1.53 95% CI Upper limit of 4.76 4.61 3.84 4.92 4.75 4.18 4.60 4.77 3.92 95% CI OR Quartile 4 2.30 2.59 2.50 2.26 2.54 2.71 2.08 2.66 2.45 p Value 0.0030 6.0E4 6.6E4 0.0036 7.5E4 1.8E4 0.0091 4.7E4 6.3E4 Lower limit of 1.33 1.50 1.47 1.30 1.48 1.61 1.20 1.54 1.46 95% CI Upper limit of 3.98 4.45 4.23 3.91 4.38 4.56 3.60 4.61 4.08 95% CI

TABLE-US-00074 TABLE 11.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 98800 120000 98600 120000 98600 120000 Average 114000 129000 114000 129000 114000 128000 Stdev 42700 44200 43000 43900 43300 43800 p (t-test) 0.0018 0.0017 0.0029 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 154 173 152 175 148 179 sCr only Median 99200 122000 99100 121000 99000 122000 Average 113000 131000 113000 131000 112000 131000 Stdev 41100 45200 41200 45000 41200 45000 p (t-test) 1.7E4 1.9E4 1.3E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 161 166 160 167 159 168 UO only Median 104000 124000 104000 125000 103000 127000 Average 115000 138000 115000 139000 114000 138000 Stdev 41100 47300 40900 47000 40200 47200 p (t-test) 2.2E5 7.1E6 2.8E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 230 95 228 97 215 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.65 0.66 0.64 0.65 0.67 0.63 0.65 0.68 SE 0.030 0.030 0.034 0.030 0.030 0.034 0.030 0.030 0.033 p Value 1.0E5 1.1E6 2.2E6 5.4E6 9.6E7 4.5E7 1.1E5 4.2E7 6.7E8 nCohort Recovered 154 161 230 152 160 228 148 159 215 nCohort Non- 173 166 95 175 167 97 179 168 110 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 83% 83% 88% 83% 83% 89% 82% 83% 87% Specificity 34% 33% 30% 34% 33% 31% 34% 33% 31% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 62% 63% 66% 62% 63% 67% 62% 63% 67% Specificity 63% 63% 57% 64% 63% 57% 64% 64% 59% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 31% 33% 39% 30% 32% 40% 30% 33% 39% Specificity 81% 83% 80% 81% 82% 81% 81% 83% 82% OR Quartile 2 2.43 2.32 3.34 2.51 2.36 3.46 2.34 2.40 3.10 p Value 7.5E4 0.0015 5.9E4 4.7E4 0.0012 4.0E4 0.0011 9.5E4 4.3E4 Lower limit of 1.45 1.38 1.68 1.50 1.40 1.74 1.40 1.43 1.65 95% CI Upper limit of 4.07 3.89 6.65 4.21 3.96 6.89 3.91 4.02 5.83 95% CI OR Quartile 3 2.76 2.82 2.56 2.91 2.90 2.69 2.93 2.98 2.91 p Value 9.2E6 5.7E6 2.2E4 3.3E6 3.4E6 9.5E5 3.2E6 2.0E6 1.4E5 Lower limit of 1.76 1.80 1.55 1.86 1.85 1.64 1.86 1.90 1.80 95% CI Upper limit of 4.32 4.42 4.22 4.57 4.54 4.43 4.60 4.67 4.71 95% CI OR Quartile 4 1.90 2.29 2.62 1.84 2.25 2.89 1.85 2.38 2.90 p Value 0.015 0.0018 3.2E4 0.021 0.0022 7.1E5 0.020 0.0012 5.5E5 Lower limit of 1.13 1.36 1.55 1.10 1.34 1.71 1.10 1.41 1.73 95% CI Upper limit of 3.19 3.86 4.44 3.09 3.79 4.89 3.12 4.02 4.86 95% CI

TABLE-US-00075 TABLE 11.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 99100 120000 98700 120000 98700 120000 Average 114000 130000 114000 130000 114000 129000 Stdev 42500 44300 42900 44000 43200 43800 p (t-test) 9.0E4 0.0010 0.0018 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 166 161 163 164 159 168 sCr only Median 99200 122000 99100 121000 99000 122000 Average 113000 131000 113000 131000 113000 131000 Stdev 41400 44900 41600 44800 41500 44700 p (t-test) 1.2E4 1.4E4 9.3E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 169 158 168 159 167 160 UO only Median 103000 130000 103000 129000 103000 128000 Average 114000 141000 114000 141000 114000 139000 Stdev 39500 48200 39500 48100 40000 47400 p (t-test) 1.1E7 1.6E7 9.5E7 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 226 99 225 100 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.65 0.70 0.64 0.65 0.69 0.64 0.66 0.68 SE 0.030 0.030 0.033 0.030 0.030 0.033 0.030 0.030 0.033 p Value 4.6E6 5.4E7 3.6E9 3.0E6 4.8E7 5.6E9 6.3E6 2.1E7 1.9E8 nCohort Recovered 166 169 226 163 168 225 159 167 217 nCohort Non- 161 158 99 164 159 100 168 160 108 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 83% 83% 89% 83% 83% 89% 82% 83% 87% Specificity 33% 33% 31% 33% 33% 31% 33% 33% 31% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 63% 63% 69% 63% 64% 68% 62% 64% 68% Specificity 62% 62% 58% 63% 62% 58% 63% 63% 59% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 32% 33% 42% 31% 33% 42% 31% 33% 40% Specificity 81% 82% 82% 81% 82% 82% 81% 83% 82% OR Quartile 2 2.29 2.34 3.59 2.41 2.38 3.65 2.24 2.42 3.00 p Value 0.0018 0.0015 2.7E4 9.6E4 0.0012 2.2E4 0.0022 9.7E4 6.5E4 Lower limit of 1.36 1.39 1.81 1.43 1.41 1.84 1.34 1.43 1.60 95% CI Upper limit of 3.86 3.96 7.14 4.05 4.02 7.26 3.74 4.09 5.64 95% CI OR Quartile 3 2.75 2.83 3.02 2.82 2.90 2.91 2.82 2.98 2.94 p Value 9.3E6 5.6E6 1.4E5 5.7E6 3.3E6 2.5E5 5.7E6 2.0E6 1.3E5 Lower limit of 1.76 1.81 1.83 1.80 1.85 1.77 1.80 1.90 1.81 95% CI Upper limit of 4.31 4.43 4.99 4.42 4.55 4.78 4.42 4.67 4.78 95% CI OR Quartile 4 2.02 2.27 3.43 1.92 2.24 3.35 1.93 2.36 3.02 p Value 0.0072 0.0018 4.3E6 0.012 0.0022 6.1E6 0.012 0.0012 2.9E5 Lower limit of 1.21 1.36 2.03 1.15 1.34 1.98 1.15 1.40 1.80 95% CI Upper limit of 3.37 3.81 5.79 3.21 3.74 5.66 3.22 3.96 5.07 95% CI

TABLE-US-00076 TABLE 11.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 101000 123000 101000 123000 101000 123000 Average 114000 135000 114000 135000 114000 135000 Stdev 40600 46500 40800 46200 40800 46100 p (t-test) 1.8E5 2.1E5 1.7E5 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 204 123 202 125 201 126 sCr only Median 101000 121000 101000 121000 101000 121000 Average 114000 131000 114000 131000 114000 131000 Stdev 41500 45600 41500 45600 41500 45600 p (t-test) 4.5E4 4.5E4 4.5E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 184 143 184 143 184 143 UO only Median 103000 125000 103000 125000 102000 126000 Average 114000 139000 114000 139000 114000 139000 Stdev 39400 48400 39500 48400 39600 47900 p (t-test) 6.0E7 8.8E7 6.3E7 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 220 105 219 106 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.64 0.68 0.66 0.64 0.68 0.66 0.64 0.68 SE 0.032 0.031 0.033 0.032 0.031 0.033 0.031 0.031 0.033 p Value 3.6E7 1.4E5 5.9E8 2.8E7 1.4E5 8.4E8 1.5E7 1.4E5 2.5E8 nCohort Recovered 204 184 220 202 184 219 201 184 217 nCohort Non- 123 143 105 125 143 106 126 143 108 recovered Cutoff Quartile 2 90200 90200 90200 90200 90200 90200 90200 90200 90200 Sensitivity 86% 83% 87% 86% 83% 87% 87% 83% 87% Specificity 32% 31% 30% 32% 31% 31% 32% 31% 31% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 65% 62% 68% 65% 62% 67% 65% 62% 68% Specificity 59% 59% 58% 59% 59% 58% 59% 59% 59% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 36% 34% 40% 35% 34% 40% 36% 34% 40% Specificity 81% 82% 82% 81% 82% 82% 82% 82% 82% OR Quartile 2 2.92 2.12 2.85 3.01 2.12 2.90 3.06 2.12 3.00 p Value 3.8E4 0.0058 0.0012 2.5E4 0.0058 9.6E4 2.0E4 0.0058 6.5E4 Lower limit of 1.62 1.24 1.51 1.67 1.24 1.54 1.70 1.24 1.60 95% CI Upper limit of 5.26 3.61 5.35 5.44 3.61 5.45 5.53 3.61 5.64 95% CI OR Quartile 3 2.66 2.40 2.91 2.64 2.40 2.80 2.70 2.40 2.94 p Value 3.6E5 1.3E4 1.9E5 3.8E5 1.3E4 3.2E5 2.4E5 1.3E4 1.3E5 Lower limit of 1.67 1.53 1.78 1.66 1.53 1.72 1.70 1.53 1.81 95% CI Upper limit of 4.23 3.75 4.74 4.19 3.75 4.55 4.29 3.75 4.78 95% CI OR Quartile 4 2.43 2.23 3.00 2.34 2.23 2.94 2.46 2.23 3.02 p Value 6.3E4 0.0020 3.4E5 0.0010 0.0020 4.7E5 5.3E4 0.0020 2.9E5 Lower limit of 1.46 1.34 1.78 1.41 1.34 1.75 1.48 1.34 1.80 95% CI Upper limit of 4.05 3.71 5.04 3.90 3.71 4.93 4.10 3.71 5.07 95% CI

Example 12. Use of Metalloproteinase Inhibitor 2 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0154] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 2 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0155] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0156] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00077 TABLE 12.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11600 23500 11600 25700 11900 28900 Average 17800 50100 18300 54600 20900 53600 Stdev 21800 77800 22100 82600 35200 78100 p (t-test) 5.7E8 3.8E9 5.5E7 Min 200 2940 200 2940 200 3000 Max 183000 428000 183000 428000 396000 428000 n (Patient) 205 112 221 96 236 81 sCr only Median 11800 21800 11800 25200 12000 24300 Average 19900 46400 20500 49500 23200 45800 Stdev 35400 70300 35500 73900 44300 65800 p (t-test) 1.1E5 3.7E6 5.9E4 Min 200 2940 200 2940 200 2940 Max 428000 396000 428000 396000 428000 371000 n (Patient) 208 108 223 93 235 81 UO only Median 12300 39600 12800 38200 12800 39600 Average 22100 79400 22400 81600 22400 83600 Stdev 34300 102000 34300 106000 34300 106000 p (t-test) 1.3E11 1.4E11 4.9E12 Min 200 5410 200 5410 200 5410 Max 396000 428000 396000 428000 396000 428000 n (Patient) 275 40 278 37 279 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.79 0.71 0.69 0.78 0.72 0.67 0.78 SE 0.032 0.033 0.044 0.033 0.034 0.047 0.035 0.036 0.047 p Value 1.5E9 3.6E7 1.3E10 8.6E11 1.4E8 3.6E9 7.4E10 2.7E6 1.2E9 nCohort Non- 205 208 275 221 223 278 236 235 279 persistent nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 85% 83% 90% 89% 87% 89% 90% 86% 89% Specificity 30% 29% 27% 31% 30% 27% 30% 29% 27% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 66% 64% 82% 69% 68% 81% 70% 67% 83% Specificity 59% 57% 55% 58% 57% 54% 57% 56% 54% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 46% 44% 65% 49% 47% 65% 51% 46% 67% Specificity 86% 85% 81% 85% 84% 80% 83% 82% 80% OR Quartile 2 2.42 2.07 3.37 3.43 2.90 3.05 3.93 2.59 2.94 p Value 0.0036 0.015 0.025 4.6E4 0.0019 0.041 6.0E4 0.0073 0.049 Lower limit of 1.34 1.15 1.16 1.72 1.48 1.04 1.80 1.29 1.01 95% CI Upper limit of 4.40 3.73 9.81 6.85 5.67 8.89 8.58 5.19 8.60 95% CI OR Quartile 3 2.75 2.37 5.66 3.03 2.83 5.02 3.12 2.52 5.90 p Value 3.6E5 4.3E4 6.4E5 1.9E5 6.3E5 2.2E4 3.9E5 6.2E4 1.3E4 Lower limit of 1.70 1.46 2.42 1.82 1.70 2.13 1.81 1.48 2.38 95% CI Upper limit of 4.44 3.82 13.2 5.03 4.71 11.8 5.36 4.28 14.6 95% CI OR Quartile 4 5.07 4.24 7.78 5.46 4.82 7.49 5.18 3.86 8.15 p Value 4.0E9 1.2E7 1.9E8 1.0E9 1.4E8 8.5E8 6.3E9 1.5E6 4.8E8 Lower limit of 2.95 2.48 3.80 3.17 2.80 3.58 2.97 2.23 3.84 95% CI Upper limit of 8.72 7.24 15.9 9.42 8.31 15.6 9.02 6.70 17.3 95% CI

TABLE-US-00078 TABLE 12.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11600 21200 11600 21900 11600 24800 Average 17500 45900 17600 50200 20300 49200 Stdev 21300 73300 21200 77700 35600 72600 p (t-test) 9.8E7 4.0E8 3.1E6 Min 200 658 200 2170 200 2170 Max 183000 428000 183000 428000 396000 428000 n (Patient) 186 131 204 113 219 98 sCr only Median 11900 19800 11800 21200 11900 21300 Average 20600 42000 20300 45200 23000 42300 Stdev 36700 66600 35800 69700 45200 61600 p (t-test) 2.7E4 3.7E5 0.0020 Min 200 658 200 2170 200 2170 Max 428000 396000 428000 396000 428000 371000 n (Patient) 192 124 206 110 218 98 UO only Median 12000 32200 12500 32200 12300 32400 Average 21600 62900 22000 64300 21900 65300 Stdev 34500 88900 34500 91700 34400 92300 p (t-test) 1.6E8 1.8E8 1.0E8 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 256 59 260 55 261 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.63 0.71 0.69 0.66 0.70 0.70 0.66 0.70 SE 0.031 0.032 0.040 0.032 0.033 0.042 0.033 0.034 0.042 p Value 6.8E8 5.2E5 1.4E7 1.2E9 1.1E6 1.8E6 7.7E10 6.4E6 1.2E6 nCohort Non- 186 192 256 204 206 260 219 218 261 persistent nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 82% 81% 83% 85% 84% 82% 88% 85% 81% Specificity 30% 29% 27% 30% 30% 27% 31% 29% 26% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 63% 60% 71% 65% 63% 69% 67% 63% 70% Specificity 59% 56% 55% 58% 57% 54% 58% 56% 54% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 41% 39% 53% 45% 42% 53% 47% 42% 54% Specificity 86% 84% 81% 86% 84% 81% 84% 83% 81% OR Quartile 2 2.02 1.67 1.81 2.47 2.15 1.63 3.16 2.30 1.58 p Value 0.012 0.064 0.11 0.0030 0.011 0.20 7.5E4 0.0087 0.22 Lower limit of 1.17 0.971 0.868 1.36 1.20 0.777 1.62 1.23 0.755 95% CI Upper limit of 3.50 2.88 3.77 4.47 3.87 3.40 6.17 4.28 3.31 95% CI OR Quartile 3 2.37 1.90 2.98 2.66 2.21 2.61 2.79 2.19 2.79 p Value 2.3E4 0.0059 5.0E4 6.0E5 0.0010 0.0025 5.6E5 0.0017 0.0015 Lower limit of 1.50 1.20 1.61 1.65 1.38 1.40 1.69 1.34 1.48 95% CI Upper limit of 3.75 3.01 5.51 4.28 3.56 4.86 4.61 3.57 5.25 95% CI OR Quartile 4 4.32 3.28 4.80 4.96 3.77 4.68 4.81 3.41 4.90 p Value 1.2E7 1.0E5 3.0E7 6.1E9 9.8E7 7.8E7 1.1E8 6.4E6 4.6E7 Lower limit of 2.51 1.94 2.63 2.89 2.22 2.54 2.81 2.00 2.64 95% CI Upper limit of 7.41 5.56 8.74 8.52 6.41 8.64 8.26 5.80 9.08 95% CI

TABLE-US-00079 TABLE 12.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11500 21100 11400 21400 11600 21600 Average 16700 44800 16500 48300 19900 46400 Stdev 18500 71600 18100 74800 35100 69800 p (t-test) 9.8E7 4.3E8 9.5E6 Min 200 658 200 2170 200 2170 Max 183000 428000 183000 428000 396000 428000 n (Patient) 175 142 190 127 205 112 sCr only Median 11800 19600 11600 20600 11800 20900 Average 19700 41600 19900 43600 23100 40400 Stdev 35700 65400 36300 67100 46100 59200 p (t-test) 1.6E4 6.2E5 0.0044 Min 200 658 200 2170 200 2170 Max 428000 396000 428000 396000 428000 371000 n (Patient) 182 134 195 121 208 108 UO only Median 12000 25100 12000 27000 12000 27000 Average 21200 58500 21500 60100 21500 60100 Stdev 33800 84800 33700 87500 33700 87500 p (t-test) 6.6E8 6.0E8 6.0E8 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 246 69 251 64 251 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.64 0.69 0.70 0.66 0.68 0.69 0.65 0.68 SE 0.031 0.032 0.038 0.031 0.032 0.040 0.032 0.033 0.040 p Value 2.5E8 2.0E5 4.0E7 2.2E10 4.0E7 4.7E6 2.6E9 6.4E6 4.7E6 nCohort Non- 175 182 246 190 195 251 205 208 251 persistent nCohort Persistent 142 134 69 127 121 64 112 108 64 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 82% 81% 83% 85% 83% 81% 87% 84% 81% Specificity 31% 29% 27% 32% 30% 27% 31% 30% 27% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 63% 60% 70% 65% 63% 67% 66% 63% 67% Specificity 60% 57% 55% 60% 58% 54% 59% 57% 54% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 39% 38% 48% 43% 40% 48% 43% 40% 48% Specificity 86% 85% 81% 86% 85% 81% 84% 83% 81% OR Quartile 2 2.09 1.71 1.78 2.62 2.19 1.58 2.94 2.27 1.58 p Value 0.0073 0.050 0.099 0.0010 0.0069 0.19 6.5E4 0.0070 0.19 Lower limit of 1.22 1.00 0.898 1.48 1.24 0.794 1.58 1.25 0.794 95% CI Upper limit of 3.58 2.91 3.52 4.67 3.87 3.14 5.45 4.13 3.14 95% CI OR Quartile 3 2.52 1.98 2.83 2.83 2.33 2.42 2.75 2.23 2.42 p Value 6.9E5 0.0032 3.6E4 1.3E5 3.8E4 0.0027 3.6E5 1.0E3 0.0027 Lower limit of 1.60 1.26 1.60 1.77 1.46 1.36 1.70 1.38 1.36 95% CI Upper limit of 3.97 3.11 5.00 4.51 3.71 4.32 4.44 3.59 4.32 95% CI OR Quartile 4 4.10 3.38 3.99 4.67 3.74 3.97 4.05 3.16 3.97 p Value 4.3E7 7.4E6 2.1E6 2.7E8 1.2E6 3.5E6 2.4E7 1.9E5 3.5E6 Lower limit of 2.37 1.98 2.25 2.71 2.20 2.22 2.38 1.87 2.22 95% CI Upper limit of 7.08 5.76 7.05 8.03 6.37 7.11 6.90 5.35 7.11 95% CI

TABLE-US-00080 TABLE 12.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11400 21100 11400 21300 11500 21500 Average 16700 44400 16600 48000 18100 48500 Stdev 18600 71100 18200 74600 23400 76100 p (t-test) 1.3E6 5.7E8 2.8E7 Min 200 658 200 2170 200 2170 Max 183000 428000 183000 428000 215000 428000 n (Patient) 173 144 189 128 201 116 sCr only Median 11700 19400 11500 20400 11600 20900 Average 19700 41300 19200 44100 20600 44300 Stdev 35900 65000 34900 67300 37100 68300 p (t-test) 2.1E4 2.1E5 8.1E5 Min 200 658 200 2170 200 2170 Max 428000 396000 428000 396000 428000 396000 n (Patient) 180 136 192 124 204 112 UO only Median 11900 24000 12000 27000 12000 27000 Average 20900 56100 21300 57800 21300 57800 Stdev 34000 81300 33900 84200 33900 84200 p (t-test) 1.5E7 1.1E7 1.1E7 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 239 76 245 70 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.64 0.70 0.69 0.67 0.69 0.69 0.66 0.69 SE 0.031 0.032 0.037 0.031 0.032 0.038 0.032 0.033 0.038 p Value 1.9E8 1.9E5 3.5E8 2.7E10 1.3E7 7.3E7 2.7E9 8.0E7 7.3E7 nCohort Non- 173 180 239 189 192 245 201 204 245 persistent nCohort Persistent 144 136 76 128 124 70 116 112 70 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 83% 81% 84% 85% 84% 83% 86% 85% 83% Specificity 31% 29% 28% 32% 31% 27% 31% 30% 27% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 62% 60% 70% 65% 63% 67% 66% 63% 67% Specificity 60% 57% 56% 60% 58% 55% 59% 57% 55% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 39% 38% 47% 42% 40% 49% 42% 40% 49% Specificity 86% 84% 82% 86% 85% 82% 85% 83% 82% OR Quartile 2 2.16 1.77 2.08 2.67 2.31 1.82 2.85 2.44 1.82 p Value 0.0050 0.037 0.035 8.3E4 0.0039 0.086 7.0E4 0.0034 0.086 Lower limit of 1.26 1.03 1.05 1.50 1.31 0.920 1.56 1.34 0.920 95% CI Upper limit of 3.70 3.01 4.09 4.74 4.07 3.60 5.23 4.43 3.60 95% CI OR Quartile 3 2.51 1.97 2.94 2.74 2.37 2.47 2.70 2.33 2.47 p Value 7.1E5 0.0033 1.3E4 2.1E5 2.6E4 0.0015 4.1E5 4.7E4 0.0015 Lower limit of 1.59 1.25 1.69 1.72 1.49 1.41 1.68 1.45 1.41 95% CI Upper limit of 3.96 3.10 5.11 4.37 3.77 4.31 4.34 3.74 4.31 95% CI OR Quartile 4 3.95 3.26 4.10 4.57 3.80 4.20 4.01 3.36 4.20 p Value 8.1E7 1.4E5 7.2E7 4.0E8 9.5E7 7.9E7 3.0E7 6.8E6 7.9E7 Lower limit of 2.29 1.91 2.35 2.66 2.23 2.38 2.36 1.98 2.38 95% CI Upper limit of 6.82 5.54 7.17 7.87 6.48 7.42 6.82 5.69 7.42 95% CI

TABLE-US-00081 TABLE 12.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11400 20900 11300 21400 11400 21600 Average 16600 43600 16500 46900 18100 47600 Stdev 18800 70300 18300 73400 23600 75000 p (t-test) 2.5E6 1.2E7 5.2E7 Min 200 658 200 2170 200 2170 Max 183000 428000 183000 428000 215000 428000 n (Patient) 169 148 184 133 197 120 sCr only Median 11600 19200 11500 20000 11600 20400 Average 19800 40600 19300 43300 20700 43300 Stdev 36300 64200 35200 66400 37400 67300 p (t-test) 3.4E4 3.9E5 1.5E4 Min 200 658 200 2170 200 2170 Max 428000 396000 428000 396000 428000 396000 n (Patient) 176 140 188 128 200 116 UO only Median 11700 25100 11900 24000 11900 24000 Average 20700 54400 21100 54500 21100 54500 Stdev 34300 79100 34400 80400 34400 80400 p (t-test) 2.6E7 4.8E7 4.8E7 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 234 81 237 78 237 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.63 0.71 0.70 0.66 0.70 0.69 0.66 0.70 SE 0.030 0.032 0.035 0.030 0.032 0.036 0.031 0.033 0.036 p Value 2.7E8 2.8E5 1.9E9 1.3E10 2.1E7 2.6E8 1.8E9 1.4E6 2.6E8 nCohort Non- 169 176 234 184 188 237 197 200 237 persistent nCohort Persistent 148 140 81 133 128 78 120 116 78 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 82% 81% 85% 85% 84% 85% 86% 84% 85% Specificity 31% 30% 29% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 62% 59% 72% 65% 62% 71% 66% 63% 71% Specificity 60% 57% 57% 61% 59% 57% 59% 57% 57% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 39% 37% 47% 41% 40% 46% 42% 40% 46% Specificity 86% 85% 82% 86% 85% 82% 85% 84% 82% OR Quartile 2 2.14 1.76 2.31 2.67 2.27 2.17 2.78 2.39 2.17 p Value 0.0051 0.038 0.015 7.0E4 0.0041 0.025 7.4E4 0.0036 0.025 Lower limit of 1.26 1.03 1.17 1.51 1.30 1.10 1.54 1.33 1.10 95% CI Upper limit of 3.66 2.98 4.53 4.70 3.98 4.27 5.04 4.29 4.27 95% CI OR Quartile 3 2.50 1.96 3.38 2.94 2.35 3.11 2.82 2.30 3.11 p Value 7.3E5 0.0034 1.3E5 5.2E6 2.8E4 5.3E5 1.7E5 5.2E4 5.3E5 Lower limit of 1.59 1.25 1.95 1.85 1.48 1.79 1.76 1.44 1.79 95% CI Upper limit of 3.93 3.08 5.85 4.68 3.73 5.39 4.52 3.67 5.39 95% CI OR Quartile 4 3.98 3.26 4.16 4.48 3.78 3.87 3.98 3.33 3.87 p Value 8.9E7 1.5E5 4.0E7 6.7E8 1.1E6 1.7E6 3.6E7 7.9E6 1.7E6 Lower limit of 2.29 1.91 2.40 2.60 2.22 2.22 2.34 1.96 2.22 95% CI Upper limit of 6.89 5.56 7.22 7.73 6.46 6.73 6.77 5.63 6.73 95% CI

TABLE-US-00082 TABLE 12.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starrts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 104000 123000 105000 120000 106000 120000 Average 115000 133000 118000 130000 118000 132000 Stdev 41600 45900 43500 44400 42600 46500 p (t-test) 4.0E4 0.027 0.014 Min 57000 64800 57000 64800 57000 64800 Max 299000 281000 299000 281000 299000 281000 n (Patient) 206 121 222 105 238 89 sCr only Median 104000 123000 105000 120000 106000 119000 Average 115000 134000 119000 128000 119000 129000 Stdev 41400 46300 44800 42000 44300 43000 p (t-test) 2.3E4 0.074 0.082 Min 57000 64800 57000 64800 57000 64800 Max 299000 281000 299000 270000 299000 270000 n (Patient) 208 118 223 103 236 90 UO only Median 106000 139000 106000 145000 106000 145000 Average 118000 149000 118000 151000 118000 153000 Stdev 41500 50100 41400 50200 41300 50900 p (t-test) 7.7E6 2.4E6 2.0E6 Min 57000 82200 57000 82200 57000 82200 Max 299000 281000 299000 281000 299000 281000 n (Patient) 281 44 283 42 285 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.64 0.71 0.60 0.59 0.72 0.60 0.59 0.72 SE 0.032 0.033 0.046 0.034 0.034 0.047 0.036 0.036 0.048 p Value 2.6E5 1.6E5 6.7E6 0.0036 0.0067 2.1E6 0.0049 0.017 2.9E6 nCohort Non- 206 208 281 222 223 283 238 236 285 persistent nCohort Persistent 121 118 44 105 103 42 89 90 40 Cutoff Quartile 2 90400 90300 90600 90400 90300 90600 90400 90300 90600 Sensitivity 84% 84% 91% 83% 83% 90% 82% 81% 90% Specificity 31% 30% 27% 29% 29% 27% 28% 28% 27% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 63% 64% 73% 60% 59% 76% 61% 59% 78% Specificity 57% 58% 53% 55% 54% 54% 54% 53% 54% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 34% 35% 50% 30% 30% 52% 34% 32% 52% Specificity 80% 80% 79% 77% 77% 79% 78% 78% 79% OR Quartile 2 2.37 2.26 3.77 1.96 1.90 3.55 1.75 1.63 3.33 p Value 0.0032 0.0052 0.014 0.024 0.032 0.019 0.072 0.11 0.027 Lower limit of 1.33 1.28 1.31 1.09 1.06 1.23 0.950 0.896 1.15 95% CI Upper limit of 4.19 4.02 10.9 3.51 3.41 10.3 3.23 2.97 9.67 95% CI OR Quartile 3 2.26 2.38 3.05 1.80 1.72 3.71 1.80 1.64 3.99 p Value 5.0E4 2.6E4 0.0019 0.015 0.024 5.8E4 0.021 0.048 4.9E4 Lower limit of 1.43 1.49 1.51 1.12 1.07 1.76 1.09 1.00 1.83 95% CI Upper limit of 3.59 3.79 6.17 2.88 2.77 7.84 2.95 2.68 8.69 95% CI OR Quartile 4 2.06 2.17 3.68 1.51 1.45 4.09 1.82 1.64 4.06 p Value 0.0053 0.0029 9.9E5 0.12 0.16 3.7E5 0.029 0.071 5.7E5 Lower limit of 1.24 1.30 1.91 0.895 0.860 2.09 1.06 0.959 2.05 95% CI Upper limit of 3.43 3.61 7.10 2.54 2.45 7.98 3.11 2.81 8.03 95% CI

TABLE-US-00083 TABLE 12.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 103000 122000 104000 121000 104000 123000 Average 115000 131000 117000 130000 116000 133000 Stdev 41800 45200 43100 44400 41900 46200 p (t-test) 5.6E4 0.0070 0.0013 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 187 140 204 123 219 108 sCr only Median 103000 123000 104000 120000 105000 120000 Average 115000 132000 117000 130000 117000 131000 Stdev 41500 45800 43100 44800 42100 46400 p (t-test) 4.2E4 0.013 0.0051 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 192 134 205 121 217 109 UO only Median 106000 132000 105000 133000 105000 133000 Average 117000 144000 116000 146000 116000 147000 Stdev 40900 49600 40700 49700 40600 50200 p (t-test) 5.7E6 1.2E6 1.1E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 260 65 263 62 265 60 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.63 0.68 0.61 0.60 0.70 0.63 0.61 0.70 SE 0.031 0.032 0.039 0.033 0.033 0.040 0.034 0.034 0.040 p Value 1.6E5 2.0E5 3.8E6 4.5E4 0.0015 7.0E7 1.8E4 0.0014 1.1E6 nCohort Non- 187 192 260 204 205 263 219 217 265 persistent nCohort Persistent 140 134 65 123 121 62 108 109 60 Cutoff Quartile 2 90400 90300 90600 90400 90300 90600 90400 90300 90600 Sensitivity 84% 83% 89% 83% 82% 89% 83% 82% 88% Specificity 32% 31% 28% 30% 29% 28% 29% 29% 28% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 61% 62% 68% 60% 59% 71% 61% 59% 72% Specificity 58% 58% 54% 56% 55% 55% 55% 54% 55% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 34% 34% 45% 33% 31% 47% 36% 34% 47% Specificity 81% 81% 80% 79% 79% 80% 80% 79% 80% OR Quartile 2 2.34 2.14 3.30 2.07 1.86 3.08 2.06 1.78 2.93 p Value 0.0021 0.0061 0.0048 0.010 0.027 0.0081 0.015 0.046 0.011 Lower limit of 1.36 1.24 1.44 1.19 1.07 1.34 1.15 1.01 1.28 95% CI Upper limit of 4.04 3.69 7.55 3.62 3.23 7.06 3.70 3.14 6.75 95% CI OR Quartile 3 2.23 2.28 2.48 1.91 1.74 2.96 1.94 1.70 3.06 p Value 4.6E4 3.5E4 0.0019 0.0052 0.016 3.9E4 0.0057 0.026 3.4E4 Lower limit of 1.42 1.45 1.40 1.21 1.11 1.62 1.21 1.06 1.66 95% CI Upper limit of 3.48 3.58 4.41 3.01 2.75 5.39 3.10 2.70 5.63 95% CI OR Quartile 4 2.19 2.12 3.15 1.86 1.68 3.48 2.31 1.96 3.42 p Value 0.0024 0.0037 9.3E5 0.017 0.047 2.7E5 0.0014 0.010 4.3E5 Lower limit of 1.32 1.28 1.77 1.12 1.01 1.94 1.38 1.17 1.90 95% CI Upper limit of 3.65 3.52 5.59 3.09 2.79 6.24 3.87 3.29 6.16 95% CI

TABLE-US-00084 TABLE 12.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 100000 120000 103000 120000 103000 122000 Average 114000 131000 116000 130000 115000 133000 Stdev 41600 44900 42800 44300 41600 45900 p (t-test) 2.4E4 0.0026 3.9E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 176 151 190 137 205 122 sCr only Median 101000 122000 104000 119000 104000 120000 Average 114000 132000 116000 130000 116000 132000 Stdev 41100 45700 42600 45000 41500 46600 p (t-test) 1.6E4 0.0046 0.0014 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 182 144 194 132 207 119 UO only Median 104000 133000 104000 133000 104000 133000 Average 115000 145000 115000 146000 115000 146000 Stdev 40400 48000 40200 48400 40200 48700 p (t-test) 1.6E7 4.8E8 7.4E8 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 249 76 253 72 254 71 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.64 0.71 0.62 0.61 0.72 0.64 0.62 0.71 SE 0.031 0.031 0.036 0.032 0.032 0.037 0.032 0.033 0.037 p Value 2.3E6 3.7E6 1.1E8 7.6E5 3.9E4 3.7E9 2.4E5 3.2E4 9.2E9 nCohort Non- 176 182 249 190 194 253 205 207 254 persistent nCohort Persistent 151 144 76 137 132 72 122 119 71 Cutoff Quartile 2 90400 90300 90600 90400 90300 90600 90400 90300 90600 Sensitivity 83% 83% 91% 82% 82% 90% 83% 82% 90% Specificity 32% 31% 30% 31% 30% 29% 30% 29% 29% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 62% 62% 71% 61% 60% 74% 62% 60% 73% Specificity 60% 60% 56% 58% 57% 57% 57% 56% 56% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 34% 34% 46% 33% 32% 47% 36% 34% 46% Specificity 82% 82% 81% 81% 79% 81% 81% 80% 81% OR Quartile 2 2.41 2.17 4.17 2.07 1.92 3.84 2.04 1.80 3.76 p Value 0.0012 0.0044 6.8E4 0.0081 0.018 0.0014 0.012 0.037 0.0017 Lower limit of 1.42 1.27 1.83 1.21 1.12 1.68 1.17 1.04 1.65 95% CI Upper limit of 4.11 3.70 9.50 3.54 3.29 8.76 3.56 3.12 8.58 95% CI OR Quartile 3 2.50 2.49 3.15 2.18 1.95 3.63 2.20 1.85 3.53 p Value 5.9E5 6.9E5 5.1E5 6.6E4 0.0035 1.3E5 7.8E4 0.0085 2.1E5 Lower limit of 1.60 1.59 1.81 1.39 1.25 2.03 1.39 1.17 1.97 95% CI Upper limit of 3.90 3.90 5.49 3.41 3.06 6.48 3.48 2.92 6.30 95% CI OR Quartile 4 2.39 2.33 3.67 2.02 1.80 3.82 2.48 2.13 3.63 p Value 9.1E4 0.0012 3.9E6 0.0064 0.023 2.6E6 4.9E4 0.0037 6.5E6 Lower limit of 1.43 1.40 2.11 1.22 1.08 2.18 1.49 1.28 2.07 95% CI Upper limit of 3.99 3.88 6.37 3.35 2.98 6.69 4.13 3.54 6.37 95% CI

TABLE-US-00085 TABLE 12.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 99600 120000 103000 120000 103000 123000 Average 113000 132000 115000 131000 114000 134000 Stdev 40000 46100 41400 45700 40300 47100 p (t-test) 4.6E5 5.8E4 1.0E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 173 154 188 139 200 127 sCr only Median 101000 123000 103000 120000 104000 123000 Average 112000 133000 115000 132000 114000 134000 Stdev 39400 46800 41200 46200 40100 47600 p (t-test) 1.8E5 5.9E4 1.0E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 179 147 190 136 202 124 UO only Median 103000 133000 103000 134000 104000 133000 Average 114000 146000 114000 148000 114000 148000 Stdev 39200 48500 38900 49000 38900 49300 p (t-test) 3.9E9 7.3E10 1.2E9 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 240 85 245 80 246 79 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.66 0.72 0.63 0.63 0.73 0.64 0.64 0.73 SE 0.030 0.031 0.034 0.031 0.032 0.035 0.032 0.032 0.035 p Value 4.6E7 3.6E7 5.7E11 2.1E5 3.7E5 1.3E11 9.2E6 1.7E5 3.9E11 nCohort Non- 173 179 240 188 190 245 200 202 246 persistent nCohort Persistent 154 147 85 139 136 80 127 124 79 Cutoff Quartile 2 90400 90300 90600 90400 90300 90600 90400 90300 90600 Sensitivity 84% 83% 92% 83% 82% 91% 83% 82% 91% Specificity 33% 32% 31% 31% 31% 30% 30% 30% 30% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 63% 63% 73% 62% 61% 75% 62% 61% 75% Specificity 61% 61% 58% 59% 58% 58% 57% 57% 58% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 34% 35% 47% 33% 33% 49% 36% 36% 48% Specificity 83% 83% 82% 81% 81% 82% 82% 82% 82% OR Quartile 2 2.54 2.28 4.97 2.14 2.05 4.51 2.05 1.96 4.43 p Value 6.2E4 0.0024 1.3E4 0.0056 0.0089 3.3E4 0.011 0.017 3.9E4 Lower limit of 1.49 1.34 2.19 1.25 1.20 1.98 1.18 1.13 1.94 95% CI Upper limit of 4.32 3.89 11.3 3.66 3.51 10.3 3.55 3.40 10.1 95% CI OR Quartile 3 2.69 2.68 3.71 2.29 2.15 4.14 2.23 2.09 4.03 p Value 1.5E5 1.7E5 2.2E6 3.0E4 8.2E4 8.9E7 5.7E4 0.0015 1.4E6 Lower limit of 1.72 1.71 2.16 1.46 1.37 2.35 1.41 1.33 2.29 95% CI Upper limit of 4.21 4.21 6.38 3.58 3.37 7.28 3.51 3.30 7.10 95% CI OR Quartile 4 2.43 2.54 4.19 2.09 2.04 4.47 2.59 2.54 4.25 p Value 7.5E4 4.0E4 2.1E7 0.0044 0.0056 8.7E8 2.7E4 3.5E4 2.3E7 Lower limit of 1.45 1.52 2.44 1.26 1.23 2.58 1.55 1.52 2.46 95% CI Upper limit of 4.07 4.24 7.20 3.47 3.39 7.73 4.31 4.23 7.37 95% CI

TABLE-US-00086 TABLE 12.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 99600 120000 102000 120000 103000 121000 Average 112000 132000 114000 131000 114000 133000 Stdev 39700 46200 41300 45600 40100 47100 p (t-test) 5.0E5 5.8E4 1.0E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 169 158 183 144 196 131 sCr only Median 101000 123000 103000 120000 104000 122000 Average 113000 132000 115000 131000 115000 133000 Stdev 39700 46600 41500 45900 40400 47300 p (t-test) 4.6E5 0.0013 2.6E4 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 175 151 186 140 198 128 UO only Median 103000 132000 102000 132000 103000 132000 Average 114000 144000 114000 145000 114000 145000 Stdev 39500 48000 39400 48000 39400 48300 p (t-test) 2.0E8 6.3E9 1.0E8 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 235 90 237 88 238 87 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.65 0.72 0.63 0.62 0.72 0.64 0.63 0.72 SE 0.030 0.031 0.034 0.031 0.032 0.034 0.032 0.032 0.034 p Value 8.4E7 1.2E6 1.8E10 2.1E5 1.0E4 3.5E11 1.1E5 4.9E5 9.8E11 nCohort Non- 169 175 235 183 186 237 196 198 238 persistent nCohort Persistent 158 151 90 144 140 88 131 128 87 Cutoff Quartile 2 90400 90300 90600 90400 90300 90600 90400 90300 90600 Sensitivity 83% 82% 91% 83% 81% 91% 82% 81% 91% Specificity 33% 31% 31% 31% 30% 31% 30% 29% 31% Cutoff Quartile 3 109000 109000 109000 109000 109000 109000 109000 109000 109000 Sensitivity 63% 63% 72% 62% 61% 74% 62% 61% 74% Specificity 62% 61% 58% 59% 58% 59% 58% 57% 58% Cutoff Quartile 4 137000 137000 137000 137000 137000 137000 137000 137000 137000 Sensitivity 34% 34% 44% 33% 32% 45% 36% 35% 45% Specificity 83% 82% 82% 81% 80% 82% 82% 81% 82% OR Quartile 2 2.34 2.10 4.62 2.15 1.89 4.45 2.02 1.80 4.37 p Value 0.0015 0.0054 1.1E4 0.0048 0.018 1.7E4 0.011 0.033 2.0E4 Lower limit of 1.39 1.25 2.12 1.26 1.11 2.05 1.17 1.05 2.01 95% CI Upper limit of 3.96 3.56 10.0 3.67 3.20 9.68 3.48 3.08 9.51 95% CI OR Quartile 3 2.68 2.67 3.63 2.33 2.14 4.01 2.21 2.07 3.91 p Value 1.5E5 1.8E5 1.8E6 2.1E4 8.5E4 5.0E7 6.1E4 0.0016 8.2E7 Lower limit of 1.72 1.70 2.14 1.49 1.37 2.33 1.40 1.32 2.27 95% CI Upper limit of 4.20 4.18 6.17 3.64 3.35 6.89 3.47 3.26 6.72 95% CI OR Quartile 4 2.44 2.37 3.68 2.05 1.91 3.87 2.57 2.36 3.68 p Value 7.6E4 0.0010 1.7E6 0.0056 0.012 7.5E7 2.9E4 9.6E4 1.9E6 Lower limit of 1.45 1.42 2.16 1.23 1.15 2.26 1.54 1.42 2.16 95% CI Upper limit of 4.09 3.96 6.27 3.40 3.16 6.61 4.29 3.93 6.30 95% CI

Example 13. Use of Metalloproteinase Inhibitor 2 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0157] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 2 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0158] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0159] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00087 TABLE 13.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11300 18000 11500 19500 11400 20900 Average 15600 37400 16300 42100 17400 44700 Stdev 13600 63200 14600 69300 20800 71900 p (t-test) 2.5E4 6.9E6 2.1E6 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 119 198 158 159 179 138 sCr only Median 12000 16000 11900 19200 11900 19600 Average 17300 37100 16800 41900 18500 43600 Stdev 14800 64900 14600 70200 22500 72900 p (t-test) 7.0E4 1.2E5 1.6E5 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 130 186 162 154 184 132 UO only Median 11600 31200 12000 32600 12000 35500 Average 20100 59500 20800 66400 21300 70300 Stdev 33400 81800 33200 89300 33300 93700 p (t-test) 4.6E9 3.6E10 1.4E10 Min 200 5410 200 5410 200 5410 Max 396000 428000 396000 428000 396000 428000 n (Patient) 241 74 256 59 263 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.59 0.76 0.65 0.63 0.76 0.67 0.64 0.76 SE 0.031 0.032 0.035 0.031 0.031 0.038 0.031 0.032 0.041 p Value 2.1E5 0.0066 6.1E14 1.5E6 5.4E5 8.5E12 5.2E8 7.3E6 9.5E11 nCohort Non- 119 130 241 158 162 256 179 184 263 persistent nCohort Persistent 198 186 74 159 154 59 138 132 52 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 80% 78% 93% 82% 81% 92% 85% 84% 90% Specificity 34% 30% 31% 32% 30% 29% 32% 32% 28% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 56% 53% 76% 60% 58% 76% 63% 61% 77% Specificity 60% 55% 58% 59% 57% 56% 60% 58% 55% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 33% 32% 51% 36% 36% 54% 39% 38% 58% Specificity 87% 85% 83% 85% 85% 82% 85% 84% 81% OR Quartile 2 2.06 1.56 6.11 2.08 1.79 4.39 2.67 2.43 3.68 p Value 0.0060 0.087 1.8E4 0.0063 0.028 0.0024 5.9E4 0.0019 0.0078 Lower limit of 1.23 0.937 2.37 1.23 1.06 1.69 1.53 1.39 1.41 95% CI Upper limit of 3.46 2.61 15.8 3.50 3.02 11.4 4.68 4.26 9.62 95% CI OR Quartile 3 1.89 1.37 4.24 2.18 1.85 4.07 2.54 2.09 4.10 p Value 0.0070 0.17 1.6E6 6.6E4 0.0071 2.2E5 6.6E5 0.0015 6.1E5 Lower limit of 1.19 0.873 2.35 1.39 1.18 2.13 1.61 1.33 2.06 95% CI Upper limit of 2.99 2.15 7.64 3.41 2.88 7.78 4.00 3.30 8.16 95% CI OR Quartile 4 3.39 2.56 5.15 3.28 3.19 5.27 3.78 3.26 5.96 p Value 1.1E4 0.0012 1.4E8 2.2E5 2.9E5 6.3E8 1.3E6 1.2E5 3.1E8 Lower limit of 1.83 1.45 2.92 1.90 1.85 2.89 2.21 1.92 3.17 95% CI Upper limit of 6.28 4.51 9.07 5.68 5.51 9.62 6.48 5.54 11.2 95% CI

TABLE-US-00088 TABLE 13.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 17900 11400 19300 11300 20000 Average 15200 36900 16000 40700 17100 42500 Stdev 13700 62200 14300 67300 21100 69000 p (t-test) 3.0E4 1.7E5 9.1E6 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 112 205 147 170 165 152 sCr only Median 11800 15700 11800 18800 11600 19300 Average 17200 36800 16800 40600 17800 41800 Stdev 14900 64200 14700 68700 21200 70000 p (t-test) 8.5E4 3.4E5 2.9E5 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 126 190 154 162 169 147 UO only Median 11400 22900 11700 22900 11900 27000 Average 19900 52100 20700 56200 21200 58100 Stdev 34300 74900 34000 80800 34100 83900 p (t-test) 2.9E7 9.4E8 8.4E8 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 222 93 238 77 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.59 0.73 0.65 0.62 0.72 0.67 0.64 0.71 SE 0.031 0.032 0.033 0.031 0.031 0.036 0.030 0.031 0.038 p Value 1.6E6 0.0039 1.9E12 7.9E7 1.1E4 1.3E9 1.7E8 9.4E6 1.8E8 nCohort Non- 112 126 222 147 154 238 165 169 245 persistent nCohort Persistent 205 190 93 170 162 77 152 147 70 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 81% 79% 89% 81% 80% 87% 84% 82% 86% Specificity 36% 31% 31% 32% 30% 29% 33% 31% 28% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 57% 54% 71% 60% 57% 70% 62% 59% 70% Specificity 62% 56% 59% 61% 58% 56% 61% 58% 56% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 33% 32% 46% 35% 35% 47% 38% 37% 49% Specificity 88% 85% 84% 86% 85% 82% 86% 85% 82% OR Quartile 2 2.36 1.68 3.74 2.03 1.66 2.74 2.67 2.13 2.35 p Value 0.0012 0.048 3.0E4 0.0075 0.052 0.0062 4.0E4 0.0056 0.021 Lower limit of 1.40 1.01 1.83 1.21 0.995 1.33 1.55 1.25 1.14 95% CI Upper limit of 3.98 2.81 7.65 3.40 2.79 5.63 4.59 3.63 4.86 95% CI OR Quartile 3 2.22 1.45 3.45 2.37 1.85 3.03 2.63 2.00 2.91 p Value 9.5E4 0.11 3.2E6 1.8E4 0.0071 8.3E5 3.0E5 0.0024 2.4E4 Lower limit of 1.38 0.921 2.05 1.51 1.18 1.74 1.67 1.28 1.65 95% CI Upper limit of 3.55 2.28 5.82 3.72 2.88 5.25 4.14 3.14 5.15 95% CI OR Quartile 4 3.70 2.60 4.44 3.19 3.01 3.98 3.70 3.34 4.20 p Value 7.6E5 0.0012 6.8E8 4.9E5 8.3E5 1.1E6 3.0E6 1.2E5 7.9E7 Lower limit of 1.93 1.46 2.58 1.82 1.74 2.28 2.14 1.95 2.38 95% CI Upper limit of 7.07 4.62 7.64 5.58 5.21 6.95 6.42 5.75 7.42 95% CI

TABLE-US-00089 TABLE 13.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 18000 11400 19300 11400 19300 Average 15200 36900 16000 40300 17300 41100 Stdev 13700 62000 14400 66800 21400 67800 p (t-test) 3.3E4 2.3E5 3.4E5 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 111 206 144 173 158 159 sCr only Median 11500 16000 11600 18600 11600 18800 Average 17200 36600 16900 40100 18100 40600 Stdev 15000 63900 14800 68100 21500 68900 p (t-test) 9.8E4 5.3E5 8.5E5 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 124 192 151 165 163 153 UO only Median 11400 21700 11600 21700 11800 21700 Average 20000 48700 20700 51100 21200 52200 Stdev 34800 72100 34700 76000 34700 78500 p (t-test) 2.8E6 1.8E6 2.0E6 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 212 103 225 90 232 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.60 0.71 0.65 0.62 0.70 0.65 0.63 0.69 SE 0.031 0.032 0.033 0.031 0.031 0.034 0.031 0.031 0.036 p Value 1.2E6 0.0030 1.8E10 8.5E7 1.7E4 1.3E8 5.0E7 6.1E5 1.7E7 nCohort Non- 111 124 212 144 151 225 158 163 232 persistent nCohort Persistent 206 192 103 173 165 90 159 153 83 Cutoff Quartile 2 7990 7980 8020 7990 7980 8020 7990 7980 8020 Sensitivity 81% 79% 87% 81% 79% 86% 82% 81% 84% Specificity 36% 31% 31% 32% 30% 29% 32% 31% 28% Cutoff Quartile 3 13500 13500 13500 13500 13500 13500 13500 13500 13500 Sensitivity 57% 54% 68% 60% 58% 68% 61% 59% 67% Specificity 63% 56% 58% 62% 58% 57% 61% 58% 56% Cutoff Quartile 4 28900 28100 29400 28900 28100 29400 28900 28100 29400 Sensitivity 33% 31% 43% 35% 34% 43% 36% 35% 45% Specificity 88% 85% 83% 86% 85% 82% 86% 85% 82% OR Quartile 2 2.41 1.74 3.13 1.99 1.64 2.46 2.23 1.89 2.14 p Value 9.3E4 0.034 5.8E4 0.0089 0.060 0.0070 0.0029 0.017 0.023 Lower limit of 1.43 1.04 1.63 1.19 0.979 1.28 1.32 1.12 1.11 95% CI Upper limit of 4.06 2.92 6.00 3.34 2.73 4.73 3.78 3.19 4.13 95% CI OR Quartile 3 2.29 1.53 2.99 2.44 1.90 2.78 2.42 2.00 2.64 p Value 6.2E4 0.066 1.5E5 1.2E4 0.0051 1.0E4 1.2E4 0.0025 3.0E4 Lower limit of 1.42 0.972 1.82 1.55 1.21 1.66 1.54 1.28 1.56 95% CI Upper limit of 3.68 2.41 4.91 3.84 2.96 4.64 3.80 3.12 4.48 95% CI OR Quartile 4 3.63 2.51 3.77 3.29 2.86 3.54 3.55 3.01 3.64 p Value 9.5E5 0.0017 1.0E6 3.8E5 1.7E4 4.4E6 7.4E6 6.3E5 3.7E6 Lower limit of 1.90 1.41 2.21 1.87 1.65 2.06 2.04 1.75 2.11 95% CI Upper limit of 6.95 4.47 6.43 5.80 4.95 6.06 6.18 5.17 6.29 95% CI

TABLE-US-00090 TABLE 13.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10600 17900 11300 19300 11300 19300 Average 15300 36700 16000 40200 17300 40800 Stdev 13700 61900 14400 66700 21500 67500 p (t-test) 4.0E4 2.7E5 4.3E5 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 110 207 143 174 156 161 sCr only Median 11500 16000 11600 18600 11500 18700 Average 17200 36600 16900 39900 18100 40400 Stdev 15000 63900 14900 68000 21600 68700 p (t-test) 9.8E4 6.2E5 1.0E4 Min 200 658 200 658 200 658 Max 76000 428000 76000 428000 215000 428000 n (Patient) 124 192 150 166 162 154 UO only Median 11400 21700 11600 21500 11700 21500 Average 20200 47300 20800 49200 21300 49800 Stdev 35100 71100 35000 74400 35200 76400 p (t-test) 8.5E6 5.9E6 8.6E6 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 208 107 220 95 226 89 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.65 0.60 0.69 0.65 0.62 SE 0.031 0.032 0.033 0.031 0.031 p Value 3.2E6 0.0030 3.4E9 9.4E7 1.8E4 nCohort Non- 110 124 208 143 150 persistent nCohort Persistent 207 192 107 174 166 Cutoff Quartile 2 7990 7980 8020 7990 7980 Sensitivity 81% 79% 86% 81% 80% Specificity 35% 31% 31% 32% 30% Cutoff Quartile 3 13500 13500 13500 13500 13500 Sensitivity 57% 54% 66% 60% 57% Specificity 63% 56% 58% 62% 58% Cutoff Quartile 4 28900 28100 29400 28900 28100 Sensitivity 32% 31% 41% 34% 34% Specificity 88% 85% 83% 86% 85% OR Quartile 2 2.29 1.74 2.73 2.03 1.66 p Value 0.0018 0.034 0.0015 0.0074 0.052 Lower limit of 1.36 1.04 1.47 1.21 0.995 95% CI Upper limit of 3.86 2.92 5.07 3.40 2.78 95% CI OR Quartile 3 2.23 1.53 2.74 2.38 1.85 p Value 9.1E4 0.066 4.8E5 1.8E4 0.0071 Lower limit of 1.39 0.972 1.69 1.51 1.18 95% CI Upper limit of 3.59 2.41 4.46 3.74 2.89 95% CI OR Quartile 4 3.57 2.51 3.45 3.24 2.81 p Value 1.2E4 0.0017 4.5E6 4.8E5 2.2E4 Lower limit of 1.87 1.41 2.03 1.84 1.62 95% CI Upper limit of 6.83 4.47 5.86 5.70 4.86 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.69 0.65 0.63 0.68 SE 0.034 0.031 0.031 0.035 p Value 4.8E8 3.8E7 6.6E5 4.3E7 nCohort Non- 220 156 162 226 persistent nCohort Persistent 95 161 154 89 Cutoff Quartile 2 8020 7990 7980 8020 Sensitivity 85% 83% 81% 84% Specificity 30% 33% 31% 29% Cutoff Quartile 3 13500 13500 13500 13500 Sensitivity 66% 61% 58% 66% Specificity 57% 61% 58% 56% Cutoff Quartile 4 29400 28900 28100 29400 Sensitivity 42% 36% 35% 43% Specificity 82% 86% 85% 82% OR Quartile 2 2.43 2.31 1.92 2.16 p Value 0.0064 0.0019 0.014 0.018 Lower limit of 1.28 1.36 1.14 1.14 95% CI Upper limit of 4.59 3.91 3.25 4.10 95% CI OR Quartile 3 2.59 2.42 1.94 2.52 p Value 2.0E4 1.2E4 0.0036 4.0E4 Lower limit of 1.57 1.54 1.24 1.51 95% CI Upper limit of 4.28 3.80 3.04 4.21 95% CI OR Quartile 4 3.38 3.43 2.96 3.36 p Value 8.1E6 1.3E5 8.1E5 1.1E5 Lower limit of 1.98 1.97 1.73 1.96 95% CI Upper limit of 5.76 5.97 5.08 5.77 95% CI

TABLE-US-00091 TABLE 13.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 10700 17900 11300 19300 11300 19300 Average 14900 36400 15500 39800 17000 40300 Stdev 12600 61500 13600 65900 21300 66500 p (t-test) 4.3E4 2.6E5 5.1E5 Min 200 658 200 658 200 658 Max 61200 428000 61200 428000 215000 428000 n (Patient) 106 211 138 179 150 167 sCr only Median 11600 16000 11600 18600 11500 18700 Average 16800 36500 16500 39700 17700 40200 Stdev 14200 63600 14100 67300 21300 68000 p (t-test) 8.9E4 5.4E5 9.1E5 Min 200 658 200 658 200 658 Max 63200 428000 63200 428000 215000 428000 n (Patient) 121 195 146 170 158 158 UO only Median 11200 21700 11400 21700 11500 21700 Average 19700 46600 20400 47800 21000 47900 Stdev 35400 69400 35400 71800 35700 73200 p (t-test) 7.4E6 8.7E6 1.5E5 Min 200 2170 200 2170 200 2170 Max 396000 428000 396000 428000 396000 428000 n (Patient) 202 113 212 103 217 98 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.64 0.60 0.71 0.65 0.62 SE 0.032 0.032 0.032 0.030 0.031 p Value 8.4E6 0.0031 3.8E11 4.1E7 1.1E4 nCohort Non- 106 121 202 138 146 persistent nCohort Persistent 211 195 113 179 170 Cutoff Quartile 2 7990 7980 8020 7990 7980 Sensitivity 80% 79% 87% 81% 79% Specificity 35% 31% 32% 33% 30% Cutoff Quartile 3 13500 13500 13500 13500 13500 Sensitivity 56% 54% 68% 60% 57% Specificity 62% 56% 60% 62% 58% Cutoff Quartile 4 28900 28100 29400 28900 28100 Sensitivity 32% 31% 42% 35% 34% Specificity 89% 85% 84% 87% 86% OR Quartile 2 2.16 1.72 3.03 2.06 1.66 p Value 0.0040 0.039 4.5E4 0.0059 0.052 Lower limit of 1.28 1.03 1.63 1.23 0.996 95% CI Upper limit of 3.64 2.88 5.63 3.46 2.78 95% CI OR Quartile 3 2.13 1.50 3.20 2.46 1.85 p Value 0.0019 0.083 2.7E6 1.1E4 0.0070 Lower limit of 1.32 0.948 1.97 1.56 1.18 95% CI Upper limit of 3.44 2.36 5.19 3.88 2.90 95% CI OR Quartile 4 3.72 2.60 3.78 3.53 3.08 p Value 1.1E4 0.0013 9.3E7 2.2E5 8.3E5 Lower limit of 1.91 1.45 2.22 1.97 1.76 95% CI Upper limit of 7.25 4.68 6.44 6.33 5.40 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.70 0.66 0.63 0.69 SE 0.033 0.030 0.031 0.034 p Value 1.3E9 3.0E7 4.2E5 1.1E8 nCohort Non- 212 150 158 217 persistent nCohort Persistent 103 167 158 98 Cutoff Quartile 2 8020 7990 7980 8020 Sensitivity 86% 83% 81% 86% Specificity 31% 33% 31% 30% Cutoff Quartile 3 13500 13500 13500 13500 Sensitivity 68% 60% 58% 68% Specificity 58% 61% 58% 58% Cutoff Quartile 4 29400 28900 28100 29400 Sensitivity 42% 36% 35% 42% Specificity 83% 87% 85% 82% OR Quartile 2 2.81 2.38 1.92 2.57 p Value 0.0014 0.0012 0.014 0.0037 Lower limit of 1.49 1.41 1.14 1.36 95% CI Upper limit of 5.30 4.02 3.23 4.85 95% CI OR Quartile 3 2.99 2.43 1.94 2.99 p Value 1.5E5 1.2E4 0.0036 2.0E5 Lower limit of 1.82 1.54 1.24 1.81 95% CI Upper limit of 4.91 3.81 3.04 4.95 95% CI OR Quartile 4 3.50 3.64 3.22 3.39 p Value 3.7E6 7.8E6 3.0E5 7.1E6 Lower limit of 2.06 2.07 1.86 1.99 95% CI Upper limit of 5.96 6.43 5.58 5.77 95% CI

TABLE-US-00092 TABLE 13.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 98000 117000 98700 119000 102000 120000 Average 109000 129000 113000 129000 116000 129000 Stdev 37500 45800 42900 43700 44400 42800 p (t-test) 8.6E5 9.6E4 0.012 Min 57600 57000 57000 64800 57000 64800 Max 277000 299000 299000 281000 299000 281000 n (Patient) 114 213 155 172 179 148 sCr only Median 98000 120000 98700 123000 103000 122000 Average 107000 131000 112000 131000 117000 128000 Stdev 35400 46600 41700 44300 45900 41000 p (t-test) 2.4E6 6.5E5 0.025 Min 57600 57000 57000 64800 57000 64800 Max 277000 299000 299000 281000 299000 270000 n (Patient) 124 202 157 169 182 144 UO only Median 106000 125000 106000 129000 105000 132000 Average 118000 134000 118000 140000 117000 145000 Stdev 42500 46600 41900 48100 41600 48700 p (t-test) 0.0039 2.4E4 1.6E5 Min 57000 70200 57000 70200 57000 77400 Max 299000 281000 299000 281000 299000 281000 n (Patient) 245 80 261 64 269 56 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.65 0.67 0.62 0.64 0.66 SE 0.031 0.030 0.037 0.030 0.030 p Value 4.4E7 4.0E9 0.0013 2.8E6 6.2E8 nCohort Non- 114 124 245 155 157 persistent nCohort Persistent 213 202 80 172 169 Cutoff Quartile 2 90400 90300 90600 90400 90300 Sensitivity 80% 80% 85% 83% 83% Specificity 34% 34% 28% 34% 34% Cutoff Quartile 3 109000 109000 109000 109000 109000 Sensitivity 58% 60% 62% 61% 63% Specificity 65% 66% 54% 62% 64% Cutoff Quartile 4 137000 137000 137000 137000 137000 Sensitivity 31% 33% 38% 31% 33% Specificity 87% 88% 79% 81% 83% OR Quartile 2 2.06 2.07 2.22 2.56 2.46 p Value 0.0058 0.0049 0.020 3.8E4 6.7E4 Lower limit of 1.23 1.25 1.13 1.52 1.46 95% CI Upper limit of 3.43 3.45 4.36 4.31 4.13 95% CI OR Quartile 3 2.58 2.92 1.95 2.55 2.95 p Value 8.2E5 6.8E6 0.012 3.9E5 2.5E6 Lower limit of 1.61 1.83 1.16 1.63 1.88 95% CI Upper limit of 4.13 4.65 3.27 3.98 4.63 95% CI OR Quartile 4 3.03 3.61 2.23 1.94 2.50 p Value 4.2E4 4.2E5 0.0041 0.012 7.0E4 Lower limit of 1.64 1.95 1.29 1.15 1.47 95% CI Upper limit of 5.60 6.66 3.85 3.25 4.24 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.66 0.62 0.62 0.69 SE 0.040 0.031 0.031 0.042 p Value 9.2E5 1.6E4 2.2E4 5.8E6 nCohort Non- 261 179 182 269 persistent nCohort Persistent 64 148 144 56 Cutoff Quartile 2 90600 90400 90300 90600 Sensitivity 89% 83% 82% 91% Specificity 28% 32% 31% 28% Cutoff Quartile 3 109000 109000 109000 109000 Sensitivity 66% 63% 63% 71% Specificity 54% 60% 60% 54% Cutoff Quartile 4 137000 137000 137000 137000 Sensitivity 41% 31% 32% 45% Specificity 79% 80% 80% 79% OR Quartile 2 3.22 2.30 2.02 4.02 p Value 0.0057 0.0022 0.0093 0.0044 Lower limit of 1.41 1.35 1.19 1.54 95% CI Upper limit of 7.39 3.92 3.42 10.4 95% CI OR Quartile 3 2.21 2.57 2.62 2.97 p Value 0.0065 3.6E5 2.7E5 6.8E4 Lower limit of 1.25 1.64 1.67 1.58 95% CI Upper limit of 3.91 4.03 4.12 5.56 95% CI OR Quartile 4 2.50 1.79 1.90 3.00 p Value 0.0019 0.024 0.013 3.5E4 Lower limit of 1.40 1.08 1.15 1.64 95% CI Upper limit of 4.47 2.97 3.16 5.48 95% CI

TABLE-US-00093 TABLE 13.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 97100 118000 98500 120000 99700 120000 Average 106000 130000 112000 129000 115000 129000 Stdev 33300 46500 42700 43700 44300 42800 p (t-test) 2.8E6 5.3E4 0.0050 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 108 219 144 183 164 163 sCr only Median 97500 120000 98700 121000 100000 121000 Average 105000 132000 111000 131000 115000 129000 Stdev 31200 47500 41100 44700 43800 43300 p (t-test) 8.4E8 6.2E5 0.0032 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 120 206 149 177 166 160 UO only Median 104000 124000 104000 128000 104000 130000 Average 116000 135000 116000 139000 116000 142000 Stdev 42300 45600 41600 46700 41300 47200 p (t-test) 5.8E4 3.7E5 5.6E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 225 100 241 84 248 77 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.68 0.69 0.64 0.65 0.66 SE 0.030 0.029 0.034 0.030 0.030 p Value 2.2E9 6.2E11 4.3E5 5.8E7 9.0E8 nCohort Non- 108 120 225 144 149 persistent nCohort Persistent 219 206 100 183 177 Cutoff Quartile 2 90400 90300 90600 90400 90300 Sensitivity 80% 81% 86% 83% 82% Specificity 36% 35% 30% 35% 34% Cutoff Quartile 3 109000 109000 109000 109000 109000 Sensitivity 59% 61% 64% 61% 62% Specificity 69% 68% 56% 64% 64% Cutoff Quartile 4 137000 137000 137000 137000 137000 Sensitivity 32% 33% 38% 31% 33% Specificity 89% 89% 80% 83% 84% OR Quartile 2 2.31 2.23 2.60 2.51 2.29 p Value 0.0014 0.0020 0.0030 4.4E4 0.0015 Lower limit of 1.38 1.34 1.38 1.50 1.37 95% CI Upper limit of 3.87 3.72 4.91 4.19 3.82 95% CI OR Quartile 3 3.18 3.33 2.26 2.79 2.97 p Value 3.3E6 7.1E7 9.9E4 8.4E6 2.4E6 Lower limit of 1.95 2.07 1.39 1.78 1.89 95% CI Upper limit of 5.18 5.36 3.68 4.38 4.68 95% CI OR Quartile 4 3.76 4.15 2.52 2.15 2.54 p Value 9.3E5 1.5E5 5.1E4 0.0048 6.9E4 Lower limit of 1.93 2.18 1.50 1.26 1.48 95% CI Upper limit of 7.30 7.90 4.25 3.67 4.35 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.67 0.63 0.63 0.69 SE 0.036 0.031 0.031 0.037 p Value 2.3E6 2.2E5 2.1E5 4.1E7 nCohort Non- 241 164 166 248 persistent nCohort Persistent 84 163 160 77 Cutoff Quartile 2 90600 90400 90300 90600 Sensitivity 89% 83% 82% 90% Specificity 30% 33% 32% 29% Cutoff Quartile 3 109000 109000 109000 109000 Sensitivity 67% 63% 62% 70% Specificity 56% 62% 62% 56% Cutoff Quartile 4 137000 137000 137000 137000 Sensitivity 40% 31% 32% 43% Specificity 80% 81% 81% 80% OR Quartile 2 3.55 2.37 2.12 3.60 p Value 8.5E4 0.0012 0.0045 0.0013 Lower limit of 1.69 1.41 1.26 1.65 95% CI Upper limit of 7.47 3.99 3.56 7.86 95% CI OR Quartile 3 2.50 2.75 2.72 2.99 p Value 5.4E4 9.3E6 1.2E5 9.0E5 Lower limit of 1.49 1.76 1.74 1.73 95% CI Upper limit of 4.21 4.30 4.26 5.18 95% CI OR Quartile 4 2.73 1.95 2.04 3.05 p Value 2.5E4 0.010 0.0065 7.0E5 Lower limit of 1.60 1.17 1.22 1.76 95% CI Upper limit of 4.68 3.26 3.40 5.27 95% CI

TABLE-US-00094 TABLE 13.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 97000 118000 98300 119000 99100 120000 Average 106000 130000 112000 129000 114000 129000 Stdev 33500 46400 43000 43500 44100 42900 p (t-test) 2.8E6 6.3E4 0.0036 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 107 220 142 185 158 169 sCr only Median 97100 120000 98500 121000 99100 121000 Average 104000 132000 111000 131000 113000 130000 Stdev 31100 47300 41300 44400 42900 43700 p (t-test) 4.6E8 5.1E5 5.6E4 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 118 208 146 180 160 166 UO only Median 104000 123000 104000 125000 104000 127000 Average 115000 135000 115000 138000 115000 141000 Stdev 41900 45600 41400 46400 41000 46900 p (t-test) 1.6E4 1.6E5 2.7E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 216 109 230 95 237 88 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.68 0.70 0.65 0.65 0.66 SE 0.030 0.029 0.033 0.030 0.030 p Value 1.4E9 8.6E12 6.1E6 4.8E7 2.8E8 nCohort Non- 107 118 216 142 146 persistent nCohort Persistent 220 208 109 185 180 Cutoff Quartile 2 90400 90300 90600 90400 90300 Sensitivity 80% 81% 86% 83% 82% Specificity 36% 36% 31% 35% 34% Cutoff Quartile 3 109000 109000 109000 109000 109000 Sensitivity 60% 61% 64% 61% 62% Specificity 69% 69% 57% 64% 65% Cutoff Quartile 4 137000 137000 137000 137000 137000 Sensitivity 32% 34% 38% 31% 33% Specificity 89% 90% 81% 82% 84% OR Quartile 2 2.36 2.32 2.76 2.60 2.41 p Value 0.0011 0.0012 0.0013 2.7E4 7.8E4 Lower limit of 1.41 1.39 1.49 1.55 1.44 95% CI Upper limit of 3.95 3.87 5.11 4.34 4.02 95% CI OR Quartile 3 3.30 3.57 2.37 2.80 3.07 p Value 1.8E6 2.1E7 3.6E4 8.2E6 1.3E6 Lower limit of 2.02 2.21 1.48 1.78 1.95 95% CI Upper limit of 5.39 5.78 3.82 4.40 4.83 95% CI OR Quartile 4 3.69 4.48 2.57 2.08 2.61 p Value 1.1E4 9.2E6 3.3E4 0.0069 5.4E4 Lower limit of 1.90 2.31 1.54 1.22 1.51 95% CI Upper limit of 7.18 8.69 4.31 3.55 4.49 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.67 0.63 0.65 0.69 SE 0.034 0.030 0.030 0.035 p Value 4.7E7 1.1E5 1.4E6 8.8E8 nCohort Non- 230 158 160 237 persistent nCohort Persistent 95 169 166 88 Cutoff Quartile 2 90600 90400 90300 90600 Sensitivity 89% 83% 83% 90% Specificity 31% 34% 33% 30% Cutoff Quartile 3 109000 109000 109000 109000 Sensitivity 66% 62% 63% 69% Specificity 57% 63% 63% 57% Cutoff Quartile 4 137000 137000 137000 137000 Sensitivity 39% 31% 33% 41% Specificity 80% 81% 82% 81% OR Quartile 2 3.80 2.44 2.34 3.83 p Value 2.4E4 7.6E4 0.0013 4.0E4 Lower limit of 1.86 1.45 1.39 1.82 95% CI Upper limit of 7.74 4.09 3.93 8.05 95% CI OR Quartile 3 2.56 2.75 2.87 2.99 p Value 2.2E4 9.3E6 4.2E6 3.8E5 Lower limit of 1.55 1.76 1.83 1.78 95% CI Upper limit of 4.22 4.31 4.50 5.03 95% CI OR Quartile 4 2.62 1.90 2.27 2.87 p Value 3.2E4 0.015 0.0020 1.0E4 Lower limit of 1.55 1.13 1.35 1.69 95% CI Upper limit of 4.44 3.17 3.83 4.90 95% CI

TABLE-US-00095 TABLE 13.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 96500 118000 98000 120000 98700 120000 Average 106000 129000 111000 130000 113000 129000 Stdev 33600 46300 41000 44600 42500 44100 p (t-test) 3.6E6 1.1E4 9.9E4 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 106 221 140 187 155 172 sCr only Median 97100 120000 98300 122000 98800 122000 Average 104000 132000 110000 131000 112000 131000 Stdev 31100 47300 39100 45500 41100 44900 p (t-test) 4.6E8 7.0E6 1.0E4 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 118 208 144 182 158 168 UO only Median 104000 124000 103000 127000 103000 129000 Average 114000 136000 114000 139000 114000 141000 Stdev 40300 47300 39900 47600 39700 48000 p (t-test) 2.3E5 8.8E7 1.7E7 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 211 114 223 102 229 96 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.68 0.70 0.66 0.66 0.67 SE 0.030 0.029 0.033 0.030 0.029 p Value 2.0E9 8.6E12 1.9E6 7.3E8 3.3E9 nCohort Non- 106 118 211 140 144 persistent nCohort Persistent 221 208 114 187 182 Cutoff Quartile 2 90400 90300 90600 90400 90300 Sensitivity 81% 81% 86% 83% 82% Specificity 37% 36% 31% 36% 35% Cutoff Quartile 3 109000 109000 109000 109000 109000 Sensitivity 59% 61% 64% 61% 63% Specificity 69% 69% 57% 65% 66% Cutoff Quartile 4 137000 137000 137000 137000 137000 Sensitivity 32% 34% 38% 31% 33% Specificity 89% 90% 82% 83% 85% OR Quartile 2 2.41 2.32 2.73 2.69 2.49 p Value 8.5E4 0.0012 0.0011 1.6E4 4.8E4 Lower limit of 1.44 1.39 1.49 1.61 1.49 95% CI Upper limit of 4.04 3.87 4.99 4.50 4.17 95% CI OR Quartile 3 3.22 3.57 2.39 2.97 3.25 p Value 3.0E6 2.1E7 2.7E4 2.9E6 4.3E7 Lower limit of 1.97 2.21 1.50 1.88 2.06 95% CI Upper limit of 5.26 5.78 3.83 4.68 5.13 95% CI OR Quartile 4 3.63 4.48 2.67 2.17 2.73 p Value 1.4E4 9.2E6 1.8E4 0.0047 3.4E4 Lower limit of 1.87 2.31 1.60 1.27 1.57 95% CI Upper limit of 7.06 8.69 4.47 3.72 4.72 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.69 0.64 0.65 0.70 SE 0.033 0.030 0.030 0.034 p Value 2.1E8 2.9E6 2.6E7 4.8E9 nCohort Non- 223 155 158 229 persistent nCohort Persistent 102 172 168 96 Cutoff Quartile 2 90600 90400 90300 90600 Sensitivity 89% 83% 83% 90% Specificity 31% 34% 34% 31% Cutoff Quartile 3 109000 109000 109000 109000 Sensitivity 68% 62% 63% 70% Specificity 58% 63% 64% 58% Cutoff Quartile 4 137000 137000 137000 137000 Sensitivity 40% 31% 33% 42% Specificity 82% 81% 83% 82% OR Quartile 2 3.78 2.56 2.42 3.86 p Value 1.4E4 3.8E4 8.4E4 2.0E4 Lower limit of 1.90 1.52 1.44 1.90 95% CI Upper limit of 7.52 4.31 4.06 7.88 95% CI OR Quartile 3 2.87 2.83 3.03 3.20 p Value 2.7E5 5.6E6 1.5E6 7.4E6 Lower limit of 1.75 1.81 1.93 1.92 95% CI Upper limit of 4.70 4.43 4.76 5.32 95% CI OR Quartile 4 2.98 1.94 2.36 3.18 p Value 3.9E5 0.012 0.0013 1.6E5 Lower limit of 1.77 1.15 1.40 1.88 95% CI Upper limit of 5.02 3.25 3.99 5.38 95% CI

TABLE-US-00096 TABLE 13.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 96500 118000 97900 119000 98600 120000 Average 105000 129000 111000 130000 113000 129000 Stdev 32700 46400 40700 44700 42500 44000 p (t-test) 3.3E6 1.0E4 8.3E4 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 102 225 135 192 149 178 sCr only Median 97200 120000 98500 120000 99100 120000 Average 105000 131000 110000 130000 113000 130000 Stdev 31400 47200 39500 45500 41400 44900 p (t-test) 1.6E7 3.3E5 4.1E4 Min 57600 57000 57600 57000 57600 57000 Max 252000 299000 299000 281000 299000 281000 n (Patient) 115 211 140 186 154 172 UO only Median 104000 123000 103000 125000 103000 125000 Average 115000 134000 114000 137000 114000 138000 Stdev 40800 46800 40500 46800 40200 47400 p (t-test) 1.3E4 5.9E6 3.3E6 Min 57600 57000 57600 57000 57600 57000 Max 299000 281000 299000 281000 299000 281000 n (Patient) 204 121 214 111 219 106 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO only only UO only AUC 0.68 0.69 0.64 0.66 0.66 SE 0.030 0.029 0.032 0.030 0.030 p Value 3.3E9 1.0E10 1.2E5 7.8E8 7.2E8 nCohort Non- 102 115 204 135 140 persistent nCohort Persistent 225 211 121 192 186 Cutoff Quartile 2 90400 90300 90600 90400 90300 Sensitivity 80% 80% 84% 82% 81% Specificity 36% 35% 30% 36% 34% Cutoff Quartile 3 109000 109000 109000 109000 109000 Sensitivity 59% 60% 63% 61% 61% Specificity 69% 69% 57% 65% 65% Cutoff Quartile 4 137000 137000 137000 137000 137000 Sensitivity 32% 33% 36% 31% 32% Specificity 89% 90% 81% 84% 84% OR Quartile 2 2.28 2.15 2.34 2.56 2.18 p Value 0.0019 0.0034 0.0036 3.1E4 0.0026 Lower limit of 1.35 1.29 1.32 1.54 1.31 95% CI Upper limit of 3.83 3.58 4.16 4.28 3.62 95% CI OR Quartile 3 3.10 3.32 2.27 2.92 2.94 p Value 7.4E6 1.0E6 4.9E4 4.4E6 3.5E6 Lower limit of 1.89 2.05 1.43 1.85 1.86 95% CI Upper limit of 5.10 5.37 3.60 4.62 4.64 95% CI OR Quartile 4 3.81 4.26 2.33 2.33 2.55 p Value 1.3E4 1.8E5 0.0011 0.0025 8.2E4 Lower limit of 1.92 2.20 1.40 1.35 1.47 95% CI Upper limit of 7.57 8.27 3.89 4.04 4.42 95% CI Persistence Period Duration (hr) 48 72 UO sCr or sCr UO only UO only only AUC 0.67 0.64 0.64 0.68 SE 0.032 0.030 0.030 0.033 p Value 8.5E8 1.9E6 3.4E6 1.0E7 nCohort Non- 214 149 154 219 persistent nCohort Persistent 111 178 172 106 Cutoff Quartile 2 90600 90400 90300 90600 Sensitivity 87% 83% 81% 87% Specificity 31% 34% 32% 31% Cutoff Quartile 3 109000 109000 109000 109000 Sensitivity 67% 62% 62% 68% Specificity 58% 64% 63% 58% Cutoff Quartile 4 137000 137000 137000 137000 Sensitivity 38% 31% 32% 39% Specificity 81% 82% 82% 81% OR Quartile 2 3.16 2.47 2.10 2.90 p Value 3.5E4 5.8E4 0.0044 9.6E4 Lower limit of 1.68 1.48 1.26 1.54 95% CI Upper limit of 5.93 4.13 3.51 5.45 95% CI OR Quartile 3 2.81 2.85 2.73 2.98 p Value 2.4E5 5.4E6 1.1E5 1.2E5 Lower limit of 1.74 1.81 1.74 1.83 95% CI Upper limit of 4.54 4.47 4.28 4.85 95% CI OR Quartile 4 2.65 2.02 2.21 2.74 p Value 2.1E4 0.0086 0.0030 1.4E4 Lower limit of 1.58 1.20 1.31 1.63 95% CI Upper limit of 4.43 3.41 3.74 4.60 95% CI

Example 14. Use of Metalloproteinase Inhibitor 4 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0160] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 4 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0161] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0162] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00097 TABLE 14.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11.1 29.5 11.8 29.0 11.1 28.9 Average 17.9 190 18.2 183 17.1 180 Stdev 21.6 850 21.6 834 22.3 826 p (t-test) 0.13 0.18 0.21 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 108 9030 108 9030 108 9030 n (Patient) 57 260 46 271 41 276 sCr only Median 13.0 29.0 13.3 28.8 13.3 28.8 Average 22.6 203 23.1 201 21.3 199 Stdev 27.4 884 27.6 880 21.5 873 p (t-test) 0.077 0.083 0.091 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 173 9030 173 9030 108 9030 n (Patient) 76 240 74 242 70 246 UO only Median 17.0 38.8 16.9 34.6 15.7 33.7 Average 97.5 261 98.2 236 98.8 220 Stdev 655 931 691 863 725 819 p (t-test) 0.069 0.12 0.16 Min 0.00110 0.00277 0.00110 0.00273 0.00110 0.00273 Max 9030 7570 9030 7570 9030 7570 n (Patient) 194 121 173 142 156 159 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.66 0.66 0.69 0.65 0.66 0.70 0.65 0.66 SE 0.034 0.034 0.032 0.038 0.034 0.031 0.038 0.035 0.030 p Value 1.3E9 3.4E6 4.9E7 9.4E7 1.9E5 5.3E7 1.2E7 1.8E5 7.3E8 nCohort Recovered 57 76 194 46 74 173 41 70 156 nCohort Non- 260 240 121 271 242 142 276 246 159 recovered Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 80% 78% 88% 78% 77% 86% 78% 77% 85% Specificity 46% 33% 33% 43% 32% 34% 46% 31% 35% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 55% 55% 64% 54% 54% 62% 55% 54% 62% Specificity 74% 64% 59% 74% 64% 60% 80% 64% 62% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 30% 31% 36% 29% 31% 33% 28% 31% 33% Specificity 96% 95% 81% 96% 95% 82% 95% 96% 83% OR Quartile 2 3.28 1.69 3.48 2.76 1.63 3.16 3.11 1.52 3.06 p Value 1.1E4 0.070 7.7E5 0.0022 0.093 7.2E5 0.0010 0.16 5.6E5 Lower limit of 1.79 0.958 1.88 1.44 0.921 1.79 1.58 0.847 1.78 95% CI Upper limit of 5.98 2.97 6.45 5.30 2.89 5.57 6.12 2.73 5.28 95% CI OR Quartile 3 3.48 2.18 2.58 3.36 2.05 2.40 4.98 2.12 2.71 p Value 1.3E4 0.0042 7.3E5 6.9E4 0.0085 1.6E4 9.8E5 0.0074 1.8E5 Lower limit of 1.84 1.28 1.62 1.67 1.20 1.52 2.22 1.22 1.72 95% CI Upper limit of 6.58 3.72 4.13 6.77 3.51 3.78 11.2 3.67 4.28 95% CI OR Quartile 4 11.8 8.18 2.42 8.89 7.86 2.18 7.68 9.98 2.32 p Value 7.6E4 7.8E5 8.5E4 0.0030 1.1E4 0.0033 0.0057 1.5E4 0.0019 Lower limit of 2.80 2.88 1.44 2.10 2.77 1.30 1.81 3.04 1.37 95% CI Upper limit of 49.5 23.2 4.07 37.6 22.3 3.66 32.6 32.7 3.95 95% CI

TABLE-US-00098 TABLE 14.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 11.2 33.4 12.3 29.7 11.2 29.7 Average 21.2 214 22.6 205 21.7 199 Stdev 26.7 908 27.7 887 28.6 873 p (t-test) 0.045 0.070 0.089 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 121 9030 121 9030 121 9030 n (Patient) 90 227 79 238 71 246 sCr only Median 12.5 33.7 12.7 33.4 12.7 33.6 Average 25.3 227 25.7 225 24.4 221 Stdev 32.9 940 33.1 936 30.2 926 p (t-test) 0.028 0.031 0.036 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 173 9030 173 9030 172 9030 n (Patient) 106 211 104 213 99 218 UO only Median 18.2 33.4 18.5 30.7 17.2 33.2 Average 111 262 117 229 109 226 Stdev 645 986 674 913 690 871 p (t-test) 0.10 0.21 0.18 Min 0.00110 0.00277 0.00110 0.00273 0.00110 0.00273 Max 9030 7570 9030 7570 9030 7570 n (Patient) 212 103 194 121 178 137 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.68 0.64 0.68 0.67 0.61 0.69 0.67 0.62 SE 0.030 0.030 0.034 0.032 0.031 0.033 0.032 0.031 0.032 p Value 2.8E12 7.0E9 7.9E5 2.9E8 5.4E8 0.0012 2.0E9 3.6E8 1.9E4 nCohort Recovered 90 106 212 79 104 194 71 99 178 nCohort Non- 227 211 103 238 213 121 246 218 137 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 83% 81% 89% 81% 81% 86% 81% 80% 85% Specificity 44% 37% 32% 42% 37% 32% 45% 36% 33% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 58% 57% 62% 56% 57% 59% 57% 57% 60% Specificity 70% 64% 56% 68% 63% 55% 73% 65% 57% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 33% 34% 33% 31% 33% 30% 30% 33% 31% Specificity 93% 92% 79% 92% 91% 78% 93% 92% 79% OR Quartile 2 3.86 2.49 3.95 2.99 2.42 2.87 3.47 2.33 2.90 p Value 9.7E7 6.5E4 9.2E5 9.5E5 9.9E4 5.1E4 1.6E5 0.0017 2.4E4 Lower limit of 2.25 1.47 1.98 1.73 1.43 1.58 1.97 1.37 1.64 95% CI Upper limit of 6.62 4.20 7.86 5.19 4.08 5.21 6.11 3.94 5.12 95% CI OR Quartile 3 3.24 2.41 2.06 2.78 2.28 1.75 3.61 2.41 2.00 p Value 1.0E5 3.5E4 0.0033 2.0E4 7.9E4 0.017 1.6E5 4.5E4 0.0027 Lower limit of 1.92 1.49 1.27 1.62 1.41 1.10 2.02 1.48 1.27 95% CI Upper limit of 5.47 3.89 3.33 4.77 3.70 2.76 6.47 3.94 3.15 95% CI OR Quartile 4 6.77 5.47 1.83 5.49 5.28 1.49 5.79 5.61 1.68 p Value 1.8E5 6.9E6 0.025 1.4E4 1.1E5 0.13 2.9E4 1.3E5 0.046 Lower limit of 2.83 2.61 1.08 2.29 2.52 0.887 2.24 2.58 1.01 95% CI Upper limit of 16.2 11.5 3.10 13.2 11.1 2.49 15.0 12.2 2.81 95% CI

TABLE-US-00099 TABLE 14.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.3 33.7 12.3 33.5 12.3 33.4 Average 24.0 235 24.5 228 24.1 219 Stdev 32.3 958 32.9 942 33.8 922 p (t-test) 0.019 0.026 0.038 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 223 9030 223 9030 223 9030 n (Patient) 114 203 107 210 97 220 sCr only Median 12.7 35.5 13.3 33.4 13.3 34.0 Average 27.3 248 27.8 244 26.9 239 Stdev 36.2 989 36.5 982 34.6 970 p (t-test) 0.013 0.015 0.018 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 223 9030 223 9030 223 9030 n (Patient) 127 190 124 193 119 198 UO only Median 18.1 33.4 17.7 33.4 16.9 33.7 Average 112 263 115 243 106 243 Stdev 642 996 658 952 669 910 p (t-test) 0.11 0.16 0.12 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 214 101 204 111 190 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.62 0.69 0.66 0.61 0.69 0.66 0.64 SE 0.029 0.030 0.035 0.030 0.030 0.034 0.030 0.030 0.032 p Value 4.9E12 4.5E9 4.7E4 3.2E10 1.1E7 9.4E4 2.2E10 9.3E8 1.1E5 nCohort Recovered 114 127 214 107 124 204 97 119 190 nCohort Non- 203 190 101 210 193 111 220 198 125 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 84% 82% 86% 82% 81% 85% 82% 81% 86% Specificity 40% 35% 30% 39% 35% 30% 40% 34% 32% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 60% 59% 62% 60% 58% 62% 60% 58% 65% Specificity 68% 63% 56% 68% 62% 56% 71% 63% 59% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 34% 35% 32% 33% 35% 30% 33% 34% 32% Specificity 91% 90% 78% 91% 90% 77% 92% 90% 79% OR Quartile 2 3.48 2.52 2.71 3.02 2.32 2.41 3.03 2.21 2.81 p Value 3.6E6 4.9E4 0.0021 3.8E5 0.0015 0.0038 4.4E5 0.0026 5.3E4 Lower limit of 2.05 1.50 1.44 1.79 1.38 1.33 1.78 1.32 1.57 95% CI Upper limit of 5.91 4.23 5.12 5.11 3.88 4.38 5.15 3.71 5.04 95% CI OR Quartile 3 3.13 2.44 2.08 3.16 2.27 2.12 3.63 2.36 2.70 p Value 3.4E6 1.5E4 0.0031 4.5E6 5.2E4 0.0018 9.5E7 3.1E4 3.1E5 Lower limit of 1.94 1.54 1.28 1.93 1.43 1.32 2.17 1.48 1.69 95% CI Upper limit of 5.08 3.88 3.37 5.16 3.60 3.41 6.07 3.77 4.31 95% CI OR Quartile 4 5.47 4.78 1.65 4.85 4.54 1.45 5.41 4.66 1.82 p Value 2.7E6 2.1E6 0.065 1.4E5 4.5E6 0.16 2.0E5 5.6E6 0.022 Lower limit of 2.69 2.50 0.970 2.38 2.38 0.861 2.49 2.40 1.09 95% CI Upper limit of 11.1 9.12 2.80 9.88 8.67 2.45 11.8 9.07 3.05 95% CI

TABLE-US-00100 TABLE 14.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.3 37.0 12.3 36.1 11.9 33.7 Average 26.8 256 27.5 245 27.6 233 Stdev 42.8 1010 44.0 984 45.6 958 p (t-test) 0.0088 0.014 0.023 Min 0.00110 0.00167 0.00167 0.00110 0.00167 0.00110 Max 337 9030 337 9030 337 9030 n (Patient) 134 183 125 192 114 203 sCr only Median 12.5 37.0 12.7 36.7 12.7 36.6 Average 28.8 263 29.1 260 28.2 257 Stdev 43.9 1020 44.1 1020 42.8 1010 p (t-test) 0.0073 0.0082 0.0090 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 337 9030 337 9030 337 9030 n (Patient) 140 177 138 179 135 182 UO only Median 18.1 38.8 17.3 36.3 17.0 35.8 Average 110 270 113 251 104 251 Stdev 640 1000 653 964 662 924 p (t-test) 0.089 0.13 0.10 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 216 99 207 108 194 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.69 0.64 0.70 0.68 0.63 0.70 0.69 0.65 SE 0.028 0.029 0.035 0.029 0.030 0.034 0.029 0.029 0.032 p Value 6.0E14 5.9E11 7.2E5 9.9E12 5.2E10 8.2E5 2.5E11 2.4E10 5.1E6 nCohort Recovered 134 140 216 125 138 207 114 135 194 nCohort Non- 183 177 99 192 179 108 203 182 121 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 85% 84% 86% 83% 83% 86% 83% 83% 86% Specificity 38% 36% 30% 38% 36% 31% 39% 36% 32% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 62% 60% 64% 61% 60% 64% 61% 60% 65% Specificity 66% 63% 56% 67% 62% 57% 69% 63% 59% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 37% 37% 34% 35% 36% 32% 34% 36% 33% Specificity 90% 89% 79% 90% 89% 79% 90% 90% 80% OR Quartile 2 3.40 2.84 2.61 3.01 2.73 2.77 3.02 2.69 2.87 p Value 6.6E6 1.1E4 0.0031 3.8E5 1.7E4 0.0013 3.6E5 2.1E4 5.1E4 Lower limit of 2.00 1.67 1.38 1.78 1.62 1.49 1.79 1.59 1.58 95% CI Upper limit of 5.79 4.80 4.94 5.09 4.62 5.16 5.10 4.53 5.21 95% CI OR Quartile 3 3.27 2.59 2.23 3.27 2.46 2.35 3.54 2.54 2.74 p Value 6.6E7 4.5E5 0.0013 9.4E7 1.1E4 4.9E4 3.7E7 6.7E5 2.8E5 Lower limit of 2.05 1.64 1.37 2.04 1.56 1.45 2.18 1.61 1.71 95% CI Upper limit of 5.21 4.08 3.64 5.24 3.88 3.79 5.77 4.01 4.39 95% CI OR Quartile 4 5.38 4.84 1.99 4.62 4.68 1.78 4.82 4.92 1.96 p Value 3.4E7 5.4E7 0.011 3.5E6 9.4E7 0.031 7.0E6 7.4E7 0.011 Lower limit of 2.82 2.61 1.17 2.42 2.52 1.05 2.43 2.62 1.17 95% CI Upper limit of 10.3 8.96 3.37 8.81 8.66 3.00 9.58 9.24 3.29 95% CI

TABLE-US-00101 TABLE 14.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.8 37.0 16.5 36.9 16.5 36.9 Average 101 244 102 239 102 239 Stdev 672 896 677 886 677 886 p (t-test) 0.11 0.12 0.12 Min 0.00110 0.00169 0.00110 0.00169 0.00110 0.00169 Max 9030 7570 9030 7570 9030 7570 n (Patient) 188 129 185 132 185 132 sCr only Median 15.1 38.6 15.4 37.8 15.1 38.6 Average 36.5 284 36.8 280 35.9 279 Stdev 67.1 1080 67.5 1070 66.9 1070 p (t-test) 0.0041 0.0050 0.0050 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 453 9030 453 9030 453 9030 n (Patient) 160 157 157 160 156 161 UO only Median 18.2 39.1 18.5 37.0 18.1 37.9 Average 104 275 105 268 105 262 Stdev 643 985 647 972 652 959 p (t-test) 0.065 0.077 0.086 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 211 104 208 107 205 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.68 0.64 0.65 0.67 0.63 0.65 0.68 0.64 SE 0.032 0.030 0.034 0.032 0.030 0.034 0.032 0.030 0.033 p Value 3.1E6 1.5E9 3.4E5 2.5E6 8.1E9 6.6E5 2.5E6 2.3E9 2.3E5 nCohort Recovered 188 160 211 185 157 208 185 156 205 nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 84% 84% 86% 85% 83% 86% 85% 83% 86% Specificity 31% 34% 30% 32% 33% 31% 32% 33% 31% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 63% 62% 63% 63% 62% 63% 63% 62% 64% Specificity 59% 62% 56% 59% 62% 56% 59% 62% 57% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 37% 38% 36% 37% 38% 35% 37% 38% 35% Specificity 83% 87% 80% 83% 87% 80% 83% 88% 80% OR Quartile 2 2.49 2.69 2.58 2.62 2.44 2.73 2.62 2.48 2.87 p Value 0.0016 3.2E4 0.0027 8.7E4 9.9E4 0.0015 8.7E4 7.9E4 8.4E4 Lower limit of 1.41 1.57 1.39 1.49 1.43 1.47 1.49 1.46 1.55 95% CI Upper limit of 4.40 4.61 4.81 4.62 4.15 5.07 4.62 4.22 5.34 95% CI OR Quartile 3 2.38 2.70 2.25 2.43 2.62 2.15 2.43 2.70 2.33 p Value 2.2E4 1.9E5 0.0010 1.5E4 3.0E5 0.0017 1.5E4 1.9E5 5.2E4 Lower limit of 1.50 1.71 1.39 1.54 1.67 1.34 1.54 1.71 1.44 95% CI Upper limit of 3.77 4.24 3.64 3.84 4.13 3.47 3.84 4.24 3.75 95% CI OR Quartile 4 2.89 3.98 2.22 2.93 4.11 2.09 2.93 4.40 2.11 p Value 6.7E5 1.4E6 0.0029 5.5E5 1.1E6 0.0057 5.5E5 4.6E7 0.0049 Lower limit of 1.71 2.27 1.31 1.74 2.33 1.24 1.74 2.47 1.25 95% CI Upper limit of 4.87 6.98 3.76 4.95 7.25 3.52 4.95 7.82 3.55 95% CI

TABLE-US-00102 TABLE 14.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3180 3320 3180 3320 3180 3300 Average 3270 3980 3200 3970 3220 3950 Stdev 1390 2560 1240 2540 1270 2530 p (t-test) 0.050 0.057 0.079 Min 1080 863 1080 863 1080 863 Max 7920 19700 5620 19700 5620 19700 n (Patient) 52 275 42 285 38 289 sCr only Median 3140 3320 3130 3330 3130 3320 Average 3340 4000 3240 4020 3280 4000 Stdev 1570 2590 1380 2610 1390 2600 p (t-test) 0.046 0.018 0.035 Min 1080 863 1080 863 1080 863 Max 9820 19700 7920 19700 7920 19700 n (Patient) 69 257 67 259 63 263 UO only Median 3010 3910 2980 3860 3030 3770 Average 3430 4530 3380 4430 3390 4320 Stdev 1930 2890 1940 2770 1990 2680 p (t-test) 4.5E5 8.0E5 4.8E4 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 197 128 176 149 159 166 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.56 0.62 0.56 0.57 0.62 0.56 0.56 0.61 SE 0.042 0.038 0.032 0.046 0.038 0.031 0.048 0.039 0.031 p Value 0.13 0.12 2.5E4 0.16 0.062 1.5E4 0.22 0.12 5.5E4 nCohort Recovered 52 69 197 42 67 176 38 63 159 nCohort Non- 275 257 128 285 259 149 289 263 166 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 76% 76% 83% 76% 76% 82% 76% 76% 82% Specificity 33% 30% 30% 33% 31% 31% 32% 30% 32% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 51% 51% 60% 51% 51% 59% 51% 51% 57% Specificity 52% 52% 56% 52% 54% 57% 53% 54% 57% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 27% 28% 32% 27% 28% 31% 26% 27% 30% Specificity 85% 84% 79% 86% 85% 80% 84% 84% 79% OR Quartile 2 1.57 1.41 2.06 1.60 1.48 2.00 1.44 1.37 2.14 p Value 0.17 0.26 0.010 0.19 0.19 0.0098 0.33 0.31 0.0039 Lower limit of 0.825 0.781 1.19 0.795 0.821 1.18 0.692 0.746 1.28 95% CI Upper limit of 2.98 2.53 3.57 3.20 2.67 3.38 3.01 2.52 3.59 95% CI OR Quartile 3 1.10 1.12 1.95 1.12 1.21 1.94 1.13 1.22 1.70 p Value 0.74 0.68 0.0038 0.73 0.49 0.0033 0.72 0.48 0.017 Lower limit of 0.610 0.656 1.24 0.587 0.704 1.25 0.576 0.702 1.10 95% CI Upper limit of 2.00 1.90 3.06 2.15 2.07 3.02 2.23 2.11 2.64 95% CI OR Quartile 4 2.02 2.01 1.79 2.18 2.19 1.74 1.90 2.00 1.60 p Value 0.084 0.050 0.024 0.090 0.034 0.032 0.17 0.062 0.070 Lower limit of 0.911 0.999 1.08 0.884 1.06 1.05 0.766 0.965 0.962 95% CI Upper limit of 4.50 4.05 2.97 5.38 4.53 2.88 4.73 4.14 2.66 95% CI

TABLE-US-00103 TABLE 14.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3040 3390 3070 3350 3040 3390 Average 3300 4070 3330 4030 3290 4020 Stdev 1510 2660 1560 2610 1600 2580 p (t-test) 0.011 0.026 0.026 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 9100 19700 n (Patient) 87 240 76 251 69 258 sCr only Median 3040 3390 3040 3440 2980 3430 Average 3380 4090 3310 4110 3330 4090 Stdev 1640 2680 1520 2700 1530 2680 p (t-test) 0.015 0.0059 0.011 Min 1080 863 1080 863 1080 863 Max 9820 19700 9100 19700 9100 19700 n (Patient) 101 226 99 228 94 233 UO only Median 3060 3890 3050 3720 3070 3720 Average 3520 4540 3510 4400 3490 4330 Stdev 2070 2880 2090 2760 2120 2670 p (t-test) 2.9E4 0.0011 0.0018 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 217 108 198 127 181 144 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.57 0.61 0.57 0.58 0.60 0.58 0.57 0.60 SE 0.035 0.034 0.034 0.036 0.034 0.033 0.037 0.034 0.032 p Value 0.026 0.037 9.7E4 0.055 0.019 0.0023 0.030 0.030 0.0019 nCohort Recovered 87 101 217 76 99 198 69 94 181 nCohort Non- 240 226 108 251 228 127 258 233 144 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 78% 78% 82% 78% 78% 80% 78% 78% 81% Specificity 33% 32% 29% 34% 32% 28% 35% 32% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 52% 53% 60% 52% 53% 58% 53% 53% 57% Specificity 56% 55% 55% 57% 57% 55% 59% 57% 55% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 29% 29% 33% 28% 29% 32% 28% 28% 31% Specificity 85% 83% 79% 84% 84% 79% 84% 83% 80% OR Quartile 2 1.76 1.63 1.87 1.81 1.70 1.61 1.84 1.63 1.84 p Value 0.039 0.067 0.033 0.037 0.048 0.082 0.038 0.071 0.023 Lower limit of 1.03 0.967 1.05 1.03 1.01 0.942 1.03 0.958 1.09 95% CI Upper limit of 3.03 2.76 3.33 3.17 2.87 2.75 3.27 2.78 3.12 95% CI OR Quartile 3 1.43 1.38 1.84 1.42 1.47 1.71 1.63 1.54 1.63 p Value 0.16 0.18 0.011 0.18 0.11 0.020 0.075 0.082 0.029 Lower limit of 0.870 0.864 1.15 0.848 0.916 1.09 0.952 0.947 1.05 95% CI Upper limit of 2.33 2.22 2.93 2.39 2.37 2.68 2.80 2.49 2.54 95% CI OR Quartile 4 2.30 1.99 1.86 2.06 2.11 1.83 2.00 1.93 1.77 p Value 0.012 0.023 0.018 0.036 0.016 0.020 0.052 0.035 0.027 Lower limit of 1.20 1.10 1.11 1.05 1.15 1.10 0.994 1.05 1.07 95% CI Upper limit of 4.41 3.62 3.11 4.05 3.88 3.03 4.03 3.54 2.93 95% CI

TABLE-US-00104 TABLE 14.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3040 3470 3100 3450 2990 3470 Average 3390 4120 3430 4080 3390 4060 Stdev 1820 2650 1870 2620 1940 2580 p (t-test) 0.0097 0.024 0.024 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 111 216 104 223 94 233 sCr only Median 2990 3490 2950 3500 2930 3490 Average 3380 4170 3340 4180 3350 4160 Stdev 1880 2670 1800 2680 1820 2660 p (t-test) 0.0046 0.0023 0.0037 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 124 203 121 206 116 211 UO only Median 3090 3710 3100 3700 3040 3770 Average 3540 4530 3550 4420 3480 4420 Stdev 2060 2910 2080 2830 2080 2740 p (t-test) 4.8E4 0.0017 5.5E4 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 219 106 208 117 193 132 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.59 0.60 0.57 0.60 0.59 0.58 0.60 0.61 SE 0.033 0.032 0.034 0.033 0.032 0.033 0.034 0.032 0.032 p Value 0.013 0.0032 0.0029 0.034 0.0020 0.0070 0.013 0.0028 8.2E4 nCohort Recovered 111 124 219 104 121 208 94 116 193 nCohort Non- 216 203 106 223 206 117 233 211 132 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 79% 80% 83% 78% 80% 81% 79% 80% 82% Specificity 32% 34% 29% 33% 34% 28% 34% 34% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 53% 54% 58% 52% 54% 56% 54% 55% 58% Specificity 56% 56% 53% 55% 57% 53% 59% 58% 55% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 29% 30% 31% 28% 30% 30% 27% 29% 31% Specificity 83% 83% 78% 82% 83% 77% 81% 83% 79% OR Quartile 2 1.77 2.09 1.97 1.77 2.06 1.71 1.89 1.98 1.89 p Value 0.029 0.0045 0.023 0.031 0.0053 0.057 0.018 0.0088 0.021 Lower limit of 1.06 1.26 1.10 1.05 1.24 0.983 1.11 1.19 1.10 95% CI Upper limit of 2.97 3.47 3.55 2.98 3.43 2.97 3.21 3.30 3.24 95% CI OR Quartile 3 1.44 1.53 1.55 1.34 1.58 1.48 1.63 1.64 1.65 p Value 0.12 0.063 0.064 0.22 0.047 0.091 0.047 0.034 0.027 Lower limit of 0.909 0.978 0.974 0.839 1.01 0.939 1.01 1.04 1.06 95% CI Upper limit of 2.28 2.40 2.48 2.14 2.49 2.34 2.65 2.59 2.58 95% CI OR Quartile 4 1.99 2.11 1.57 1.76 2.17 1.46 1.60 2.00 1.67 p Value 0.019 0.0087 0.090 0.054 0.0070 0.15 0.12 0.017 0.046 Lower limit of 1.12 1.21 0.933 0.990 1.24 0.876 0.887 1.13 1.01 95% CI Upper limit of 3.54 3.68 2.64 3.14 3.82 2.44 2.88 3.52 2.77 95% CI

TABLE-US-00105 TABLE 14.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3150 3430 3160 3350 3040 3470 Average 3450 4160 3500 4100 3430 4100 Stdev 1790 2750 1830 2710 1910 2640 p (t-test) 0.0098 0.028 0.018 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 134 193 125 202 113 214 sCr only Median 3130 3450 3130 3450 3110 3470 Average 3470 4170 3430 4190 3430 4170 Stdev 1860 2740 1790 2760 1800 2740 p (t-test) 0.0099 0.0054 0.0061 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 139 188 137 190 133 194 UO only Median 3080 3720 3090 3620 3020 3860 Average 3510 4600 3520 4480 3470 4470 Stdev 2030 2940 2050 2870 2070 2760 p (t-test) 1.3E4 5.7E4 2.2E4 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 220 105 211 114 198 127 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.57 0.61 0.55 0.57 0.60 0.58 0.58 0.62 SE 0.032 0.032 0.034 0.032 0.032 0.033 0.033 0.032 0.032 p Value 0.044 0.026 0.0012 0.10 0.021 0.0034 0.016 0.017 2.9E4 nCohort Recovered 134 139 220 125 137 211 113 133 198 nCohort Non- 193 188 105 202 190 114 214 194 127 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 78% 79% 84% 78% 79% 83% 79% 79% 83% Specificity 29% 31% 29% 30% 31% 29% 33% 31% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 52% 52% 57% 51% 52% 56% 54% 53% 58% Specificity 52% 53% 53% 51% 53% 53% 57% 53% 55% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 30% 30% 32% 28% 30% 31% 28% 29% 31% Specificity 81% 81% 78% 80% 82% 78% 80% 81% 79% OR Quartile 2 1.43 1.71 2.12 1.47 1.66 2.08 1.83 1.66 2.19 p Value 0.16 0.037 0.013 0.14 0.049 0.012 0.021 0.048 0.0057 Lower limit of 0.865 1.03 1.17 0.883 1.00 1.17 1.10 1.00 1.26 95% CI Upper limit of 2.37 2.83 3.85 2.44 2.74 3.70 3.05 2.75 3.83 95% CI OR Quartile 3 1.18 1.20 1.51 1.09 1.21 1.45 1.52 1.27 1.71 p Value 0.47 0.41 0.082 0.70 0.41 0.11 0.075 0.29 0.020 Lower limit of 0.757 0.776 0.948 0.699 0.776 0.916 0.959 0.816 1.09 95% CI Upper limit of 1.83 1.87 2.42 1.71 1.87 2.29 2.40 1.98 2.68 95% CI OR Quartile 4 1.83 1.84 1.72 1.57 1.92 1.55 1.49 1.80 1.71 p Value 0.027 0.023 0.041 0.097 0.016 0.096 0.15 0.031 0.038 Lower limit of 1.07 1.09 1.02 0.921 1.13 0.925 0.862 1.05 1.03 95% CI Upper limit of 3.12 3.13 2.88 2.68 3.27 2.58 2.57 3.06 2.83 95% CI

TABLE-US-00106 TABLE 14.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3090 3510 3080 3520 3070 3620 Average 3520 4330 3520 4320 3510 4320 Stdev 2090 2750 2110 2730 2110 2720 p (t-test) 0.0027 0.0028 0.0027 Min 1080 863 1080 863 1080 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 187 140 184 143 183 144 sCr only Median 3130 3450 3140 3430 3140 3430 Average 3520 4200 3520 4190 3530 4170 Stdev 1810 2860 1820 2840 1820 2830 p (t-test) 0.010 0.012 0.016 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 159 168 156 171 154 173 UO only Median 3040 3790 3040 3720 3010 3890 Average 3480 4600 3480 4590 3440 4620 Stdev 2030 2890 2040 2860 2030 2840 p (t-test) 6.4E5 6.5E5 1.9E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 215 110 212 113 209 116 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.56 0.62 0.59 0.56 0.62 0.59 0.55 0.63 SE 0.032 0.032 0.034 0.032 0.032 0.033 0.032 0.032 0.033 p Value 0.0081 0.071 3.9E4 0.0063 0.072 2.7E4 0.0052 0.094 4.6E5 nCohort Recovered 187 159 215 184 156 212 183 154 209 nCohort Non- 140 168 110 143 171 113 144 173 116 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 81% 79% 85% 82% 79% 85% 82% 79% 85% Specificity 30% 30% 30% 30% 29% 30% 31% 29% 31% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 55% 52% 57% 55% 52% 58% 56% 52% 59% Specificity 53% 52% 53% 54% 52% 54% 54% 52% 55% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 31% 29% 32% 31% 29% 32% 31% 29% 34% Specificity 79% 79% 78% 79% 79% 78% 79% 79% 79% OR Quartile 2 1.87 1.59 2.32 1.97 1.57 2.44 2.00 1.52 2.57 p Value 0.020 0.070 0.0055 0.012 0.080 0.0032 0.010 0.10 0.0018 Lower limit of 1.10 0.963 1.28 1.16 0.948 1.35 1.18 0.918 1.42 95% CI Upper limit of 3.18 2.64 4.20 3.34 2.59 4.42 3.39 2.51 4.65 95% CI OR Quartile 3 1.40 1.20 1.54 1.44 1.17 1.58 1.47 1.17 1.70 p Value 0.13 0.41 0.067 0.10 0.47 0.053 0.084 0.47 0.023 Lower limit of 0.905 0.778 0.970 0.927 0.759 0.994 0.950 0.759 1.07 95% CI Upper limit of 2.18 1.85 2.45 2.23 1.81 2.50 2.28 1.81 2.69 95% CI OR Quartile 4 1.68 1.57 1.67 1.71 1.60 1.69 1.68 1.55 1.96 p Value 0.043 0.081 0.052 0.037 0.070 0.046 0.044 0.092 0.010 Lower limit of 1.02 0.946 0.996 1.03 0.962 1.01 1.01 0.931 1.17 95% CI Upper limit of 2.78 2.61 2.79 2.83 2.67 2.82 2.78 2.58 3.26 95% CI

Example 15. Use of Metalloproteinase Inhibitor 4 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0163] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 4 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0164] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0165] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00107 TABLE 15.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.5 34.6 12.5 33.4 12.5 33.4 Average 27.4 227 26.4 224 26.5 221 Stdev 47.8 945 46.5 936 47.2 928 p (t-test) 0.029 0.032 0.038 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 108 209 104 213 100 217 sCr only Median 13.3 34.9 13.3 34.9 13.3 34.9 Average 29.0 246 29.0 244 29.0 241 Stdev 46.7 989 47.0 984 47.3 979 p (t-test) 0.014 0.016 0.017 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 126 190 124 192 122 194 UO only Median 18.5 39.3 18.1 39.3 18.1 36.7 Average 99.9 304 101 275 104 255 Stdev 623 1040 643 976 658 936 p (t-test) 0.033 0.059 0.094 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 222 93 208 107 198 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.65 0.69 0.67 0.66 0.69 0.67 0.64 SE 0.030 0.030 0.035 0.030 0.030 0.033 0.030 0.030 0.033 p Value 4.8E10 3.2E8 2.2E5 4.2E10 3.7E8 3.5E6 6.4E10 2.9E8 3.6E5 nCohort Recovered 108 126 222 104 124 208 100 122 198 nCohort Non- 209 190 93 213 192 107 217 194 117 recovered Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 86% 82% 81% 86% 82% 81% 84% Specificity 39% 33% 30% 39% 34% 31% 40% 34% 30% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 58% 58% 65% 58% 58% 64% 58% 58% 61% Specificity 66% 63% 56% 66% 63% 57% 67% 63% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 33% 35% 39% 33% 35% 37% 33% 35% 36% Specificity 91% 90% 81% 91% 90% 81% 91% 90% 81% OR Quartile 2 2.96 2.07 2.60 3.00 2.15 2.73 3.04 2.23 2.24 p Value 5.2E5 0.0058 0.0041 4.5E5 0.0038 0.0015 3.8E5 0.0024 0.0061 Lower limit of 1.75 1.23 1.36 1.77 1.28 1.47 1.79 1.33 1.26 95% CI Upper limit of 5.00 3.46 5.00 5.08 3.60 5.07 5.17 3.74 3.99 95% CI OR Quartile 3 2.69 2.36 2.30 2.75 2.37 2.29 2.81 2.39 1.97 p Value 6.0E5 2.7E4 0.0011 5.2E5 2.6E4 7.3E4 4.5E5 2.5E4 0.0043 Lower limit of 1.66 1.49 1.39 1.68 1.49 1.41 1.71 1.50 1.24 95% CI Upper limit of 4.36 3.75 3.80 4.48 3.77 3.69 4.62 3.80 3.14 95% CI OR Quartile 4 4.94 5.17 2.63 5.28 5.00 2.59 4.92 4.84 2.44 p Value 1.1E5 1.3E6 3.9E4 1.1E5 2.1E6 3.8E4 2.5E5 3.4E6 7.9E4 Lower limit of 2.42 2.66 1.54 2.52 2.57 1.53 2.34 2.49 1.45 95% CI Upper limit of 10.1 10.1 4.48 11.1 9.73 4.37 10.3 9.41 4.10 95% CI

TABLE-US-00108 TABLE 15.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 13.3 36.5 13.3 33.4 13.3 33.4 Average 29.4 257 29.6 254 28.6 249 Stdev 47.4 1010 47.7 1010 46.7 994 p (t-test) 0.0093 0.010 0.012 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 136 181 134 183 129 188 sCr only Median 15.4 36.9 15.9 36.7 15.9 36.7 Average 30.5 274 30.7 272 30.6 269 Stdev 47.1 1050 47.2 1050 47.4 1040 p (t-test) 0.0050 0.0054 0.0060 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 149 168 148 169 146 171 UO only Median 18.2 39.3 18.2 38.8 18.1 33.4 Average 107 297 108 282 111 254 Stdev 625 1060 633 1030 653 964 p (t-test) 0.050 0.067 0.12 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 226 89 220 95 207 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.67 0.65 0.68 0.67 0.64 0.68 0.67 0.63 SE 0.030 0.030 0.036 0.030 0.030 0.035 0.030 0.030 0.034 p Value 1.0E9 1.6E8 4.7E5 1.5E9 3.0E8 7.1E5 7.1E10 2.7E8 1.7E4 nCohort Recovered 136 149 226 134 148 220 129 146 207 nCohort Non- 181 168 89 183 169 95 188 171 108 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 83% 82% 88% 84% 82% 87% 84% 82% 86% Specificity 36% 32% 30% 37% 32% 30% 37% 33% 31% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 60% 60% 65% 60% 59% 63% 60% 59% 61% Specificity 62% 60% 56% 63% 60% 55% 64% 60% 56% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 36% 38% 36% 36% 38% 35% 36% 37% 33% Specificity 90% 89% 79% 90% 89% 79% 90% 89% 79% OR Quartile 2 2.83 2.10 3.05 2.94 2.14 3.03 3.00 2.21 2.77 p Value 1.0E4 0.0051 0.0016 5.9E5 0.0042 0.0012 4.1E5 0.0028 0.0013 Lower limit of 1.68 1.25 1.53 1.74 1.27 1.55 1.77 1.31 1.49 95% CI Upper limit of 4.79 3.53 6.10 4.98 3.59 5.92 5.07 3.72 5.16 95% CI OR Quartile 3 2.47 2.24 2.36 2.47 2.19 2.13 2.57 2.19 1.96 p Value 1.1E4 4.4E4 9.6E4 1.1E4 6.5E4 0.0027 6.2E5 6.5E4 0.0053 Lower limit of 1.56 1.43 1.42 1.57 1.39 1.30 1.62 1.40 1.22 95% CI Upper limit of 3.89 3.52 3.92 3.91 3.43 3.50 4.08 3.43 3.16 95% CI OR Quartile 4 5.00 5.12 2.14 4.84 5.03 2.01 4.94 4.86 1.91 p Value 5.6E7 1.2E7 0.0057 9.6E7 1.7E7 0.010 1.3E6 3.0E7 0.015 Lower limit of 2.66 2.79 1.25 2.57 2.75 1.18 2.59 2.65 1.13 95% CI Upper limit of 9.39 9.37 3.67 9.08 9.21 3.43 9.43 8.90 3.22 95% CI

TABLE-US-00109 TABLE 15.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 13.0 38.8 13.0 37.0 13.0 37.0 Average 31.8 280 32.0 277 31.4 271 Stdev 53.3 1060 53.6 1060 52.9 1050 p (t-test) 0.0041 0.0047 0.0056 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 154 163 152 165 148 169 sCr only Median 14.3 38.2 14.5 37.0 14.7 37.0 Average 32.2 290 32.4 289 32.5 287 Stdev 52.3 1090 52.4 1080 52.6 1080 p (t-test) 0.0028 0.0030 0.0032 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 161 156 160 157 159 158 UO only Median 18.1 38.8 18.2 37.8 18.1 33.4 Average 109 286 110 283 112 259 Stdev 628 1050 629 1040 645 986 p (t-test) 0.066 0.071 0.11 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 224 91 223 92 212 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.63 0.69 0.68 0.62 0.69 0.68 0.62 SE 0.029 0.030 0.036 0.029 0.030 0.036 0.029 0.030 0.034 p Value 3.0E11 7.2E10 3.1E4 9.6E11 1.5E9 5.7E4 1.0E10 2.7E9 6.4E4 nCohort Recovered 154 161 224 152 160 223 148 159 212 nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 85% 83% 87% 85% 83% 86% 85% 84% 84% Specificity 35% 33% 30% 36% 33% 30% 36% 33% 30% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 63% 62% 64% 62% 62% 63% 62% 61% 62% Specificity 64% 61% 55% 63% 61% 55% 64% 61% 56% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 37% 38% 33% 37% 38% 33% 37% 38% 32% Specificity 88% 88% 78% 88% 88% 78% 88% 87% 78% OR Quartile 2 2.98 2.45 2.81 3.09 2.50 2.55 3.07 2.54 2.30 p Value 7.2E5 9.9E4 0.0026 4.3E5 7.9E4 0.0049 4.2E5 6.3E4 0.0074 Lower limit of 1.74 1.44 1.44 1.80 1.46 1.33 1.79 1.49 1.25 95% CI Upper limit of 5.11 4.19 5.50 5.29 4.26 4.91 5.25 4.33 4.23 95% CI OR Quartile 3 3.00 2.63 2.18 2.85 2.56 2.10 2.86 2.49 2.06 p Value 2.4E6 3.0E5 0.0024 6.8E6 4.8E5 0.0036 6.7E6 7.7E5 0.0033 Lower limit of 1.90 1.67 1.32 1.81 1.63 1.27 1.81 1.58 1.27 95% CI Upper limit of 4.75 4.13 3.60 4.49 4.02 3.46 4.51 3.91 3.33 95% CI OR Quartile 4 4.25 4.41 1.76 4.11 4.33 1.72 4.18 4.26 1.70 p Value 8.4E7 3.2E7 0.041 1.5E6 4.3E7 0.049 1.5E6 5.9E7 0.048 Lower limit of 2.39 2.50 1.02 2.31 2.45 1.00 2.33 2.41 1.00 95% CI Upper limit of 7.56 7.78 3.01 7.30 7.64 2.95 7.50 7.51 2.88 95% CI

TABLE-US-00110 TABLE 15.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 15.1 38.8 15.4 37.0 15.4 36.9 Average 36.0 298 36.4 293 35.9 287 Stdev 62.4 1110 62.9 1100 62.7 1090 p (t-test) 0.0024 0.0030 0.0037 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 453 9030 453 9030 453 9030 n (Patient) 168 149 165 152 161 156 sCr only Median 15.9 37.0 16.3 37.0 16.3 37.0 Average 36.4 305 36.6 303 36.7 301 Stdev 61.8 1130 61.9 1120 62.1 1120 p (t-test) 0.0019 0.0021 0.0023 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 453 9030 453 9030 453 9030 n (Patient) 172 145 171 146 170 147 UO only Median 18.2 39.1 18.1 38.8 18.1 36.7 Average 108 286 109 283 111 265 Stdev 630 1040 631 1040 642 995 p (t-test) 0.065 0.069 0.10 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 223 92 222 93 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.67 0.64 0.67 0.67 0.64 0.67 0.66 0.63 SE 0.030 0.031 0.035 0.030 0.031 0.035 0.030 0.031 0.035 p Value 2.6E9 3.2E8 1.1E4 6.9E9 5.9E8 1.2E4 8.2E9 1.0E7 1.9E4 nCohort 168 172 223 165 171 222 161 170 214 Recovered nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 84% 83% 86% 84% 83% 86% 84% 83% 85% Specificity 33% 31% 30% 33% 32% 30% 34% 32% 30% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 63% 62% 64% 62% 62% 65% 62% 61% 63% Specificity 61% 60% 56% 61% 60% 56% 61% 59% 56% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 38% 38% 35% 37% 38% 34% 37% 37% 34% Specificity 86% 85% 79% 85% 85% 79% 86% 85% 79% OR Quartile 2 2.54 2.20 2.55 2.67 2.23 2.60 2.64 2.27 2.45 p Value 7.8E4 0.0041 0.0049 4.0E4 0.0034 0.0041 4.0E4 0.0028 0.0048 Lower limit of 1.47 1.28 1.33 1.55 1.30 1.36 1.54 1.33 1.31 95% CI Upper limit of 4.36 3.76 4.91 4.59 3.83 5.00 4.53 3.89 4.55 95% CI OR Quartile 3 2.71 2.44 2.24 2.63 2.38 2.30 2.63 2.31 2.21 p Value 1.8E5 1.1E4 0.0016 3.0E5 1.8E4 0.0011 3.0E5 2.8E4 0.0014 Lower limit of 1.72 1.55 1.36 1.67 1.51 1.39 1.67 1.47 1.36 95% CI Upper limit of 4.27 3.84 3.70 4.14 3.73 3.80 4.13 3.63 3.59 95% CI OR Quartile 4 3.61 3.59 2.00 3.43 3.53 1.95 3.45 3.47 1.91 p Value 3.8E6 3.5E6 0.011 9.1E6 4.8E6 0.014 9.5E6 6.4E6 0.017 Lower limit of 2.10 2.09 1.17 1.99 2.06 1.14 2.00 2.02 1.12 95% CI Upper limit of 6.23 6.17 3.41 5.90 6.06 3.34 5.98 5.95 3.23 95% CI

TABLE-US-00111 TABLE 15.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 18.1 36.9 18.1 36.3 18.1 35.9 Average 98.8 267 99.6 263 100 261 Stdev 646 951 650 943 651 939 p (t-test) 0.063 0.070 0.074 Min 0.00110 0.00169 0.00110 0.00169 0.00110 0.00169 Max 9030 7570 9030 7570 9030 7570 n (Patient) 203 114 201 116 200 117 sCr only Median 17.0 36.9 17.0 36.9 17.0 36.9 Average 41.1 325 41.1 325 41.1 325 Stdev 69.2 1180 69.2 1180 69.2 1180 p (t-test) 0.0012 0.0012 0.0012 Min 0.00110 0.00169 0.00110 0.00169 0.00110 0.00169 Max 453 9030 453 9030 453 9030 n (Patient) 185 132 185 132 185 132 UO only Median 18.8 37.9 18.5 37.0 19.1 36.7 Average 103 287 103 284 104 279 Stdev 634 1010 635 1010 638 999 p (t-test) 0.051 0.054 0.061 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 217 98 216 99 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.65 0.63 0.63 0.65 0.63 0.62 0.65 0.63 SE 0.033 0.032 0.035 0.033 0.032 0.035 0.033 0.032 0.035 p Value 1.1E4 2.2E6 1.5E4 1.4E4 2.2E6 1.5E4 1.9E4 2.2E6 2.8E4 nCohort 203 185 217 201 185 216 200 185 214 Recovered nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 8.33 8.33 8.36 8.33 8.33 8.36 8.33 8.33 8.36 Sensitivity 82% 83% 85% 83% 83% 85% 83% 83% 85% Specificity 29% 30% 29% 29% 30% 30% 30% 30% 30% Cutoff Quartile 3 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 24.1 Sensitivity 63% 62% 63% 63% 62% 64% 62% 62% 62% Specificity 57% 58% 56% 57% 58% 56% 57% 58% 56% Cutoff Quartile 4 60.9 60.9 61.8 60.9 60.9 61.8 60.9 60.9 61.8 Sensitivity 36% 38% 35% 35% 38% 34% 35% 38% 34% Specificity 81% 84% 79% 81% 84% 79% 80% 84% 79% OR Quartile 2 1.93 2.06 2.31 1.99 2.06 2.36 2.03 2.06 2.45 p Value 0.024 0.0099 0.0082 0.017 0.0099 0.0069 0.015 0.0099 0.0048 Lower limit of 1.09 1.19 1.24 1.13 1.19 1.27 1.15 1.19 1.31 95% CI Upper limit of 3.40 3.56 4.31 3.52 3.56 4.39 3.59 3.56 4.55 95% CI OR Quartile 3 2.29 2.30 2.17 2.27 2.30 2.23 2.20 2.30 2.08 p Value 5.9E4 3.6E4 0.0019 6.1E4 3.6E4 0.0013 9.5E4 3.6E4 0.0031 Lower limit of 1.43 1.46 1.33 1.42 1.46 1.37 1.38 1.46 1.28 95% CI Upper limit of 3.66 3.63 3.54 3.63 3.63 3.64 3.51 3.63 3.37 95% CI OR Quartile 4 2.36 3.15 2.03 2.27 3.15 1.99 2.23 3.15 1.91 p Value 0.0011 1.9E5 0.0088 0.0019 1.9E5 0.011 0.0024 1.9E5 0.017 Lower limit of 1.41 1.86 1.20 1.35 1.86 1.17 1.33 1.86 1.12 95% CI Upper limit of 3.96 5.33 3.45 3.81 5.33 3.37 3.73 5.33 3.23 95% CI

TABLE-US-00112 TABLE 15.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2870 3520 2850 3520 2870 3510 Average 3160 4200 3150 4200 3170 4170 Stdev 1580 2680 1550 2670 1570 2660 p (t-test) 2.7E4 2.6E4 6.2E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 9100 19700 n (Patient) 105 222 102 225 98 229 sCr only Median 2950 3510 2920 3510 2870 3510 Average 3290 4200 3260 4210 3200 4230 Stdev 1660 2730 1640 2720 1540 2740 p (t-test) 0.0011 5.7E4 1.9E4 Min 1080 863 1080 863 1080 863 Max 9820 19700 9820 19700 9100 19700 n (Patient) 121 205 119 207 117 209 UO only Median 3020 3940 3000 3940 3030 3910 Average 3470 4770 3410 4710 3410 4610 Stdev 1940 3070 1910 2980 1910 2920 p (t-test) 5.8E6 3.0E6 1.1E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 226 99 213 112 202 123 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.61 0.64 0.63 0.62 0.64 0.63 0.62 0.63 SE 0.032 0.032 0.034 0.032 0.031 0.033 0.032 0.031 0.032 p Value 2.8E5 7.4E4 5.9E5 2.3E5 2.4E4 1.3E5 9.2E5 8.3E5 5.6E5 nCohort 105 121 226 102 119 213 98 117 202 Recovered nCohort Non- 222 205 99 225 207 112 229 209 123 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 82% 81% 85% 81% 81% 86% 81% 81% 84% Specificity 39% 36% 29% 39% 36% 31% 39% 37% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 55% 55% 65% 56% 55% 64% 55% 56% 61% Specificity 61% 58% 56% 62% 59% 57% 61% 60% 56% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 30% 31% 35% 30% 31% 35% 30% 31% 34% Specificity 86% 84% 79% 86% 85% 80% 86% 85% 80% OR Quartile 2 2.83 2.35 2.31 2.81 2.44 2.64 2.66 2.53 2.23 p Value 8.4E5 0.0010 0.0081 9.8E5 6.4E4 0.0017 2.4E4 3.8E4 0.0055 Lower limit of 1.68 1.41 1.24 1.67 1.46 1.44 1.58 1.52 1.27 95% CI Upper limit of 4.75 3.91 4.29 4.73 4.06 4.82 4.49 4.23 3.92 95% CI OR Quartile 3 1.94 1.65 2.35 2.02 1.75 2.41 1.93 1.86 2.02 p Value 0.0061 0.030 6.3E4 0.0040 0.016 2.6E4 0.0075 0.0082 0.0025 Lower limit of 1.21 1.05 1.44 1.25 1.11 1.50 1.19 1.17 1.28 95% CI Upper limit of 3.11 2.60 3.82 3.26 2.76 3.87 3.13 2.94 3.20 95% CI OR Quartile 4 2.59 2.38 2.08 2.72 2.51 2.11 2.53 2.66 2.10 p Value 0.0025 0.0030 0.0059 0.0019 0.0019 0.0043 0.0040 0.0012 0.0042 Lower limit of 1.40 1.34 1.24 1.45 1.40 1.26 1.35 1.47 1.26 95% CI Upper limit of 4.81 4.22 3.51 5.12 4.49 3.53 4.77 4.80 3.49 95% CI

TABLE-US-00113 TABLE 15.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2930 3560 2920 3630 2980 3520 Average 3230 4310 3210 4320 3250 4270 Stdev 1540 2810 1520 2800 1530 2790 p (t-test) 6.5E5 3.8E5 1.7E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 9100 19700 n (Patient) 134 193 133 194 128 199 sCr only Median 2980 3520 2950 3540 2920 3540 Average 3310 4320 3290 4330 3240 4360 Stdev 1610 2850 1590 2850 1510 2860 p (t-test) 1.5E4 8.7E5 2.7E5 Min 1080 863 1080 863 1080 863 Max 9820 19700 9820 19700 9100 19700 n (Patient) 146 181 145 182 143 184 UO only Median 3060 3890 3040 3930 3050 3920 Average 3530 4670 3500 4670 3460 4600 Stdev 2060 2970 2060 2910 2040 2840 p (t-test) 9.7E5 5.0E5 3.9E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 231 94 225 100 210 115 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.62 0.61 0.62 0.63 0.62 0.63 0.61 0.62 0.63 SE 0.031 0.031 0.035 0.031 0.031 0.034 0.031 0.031 0.033 p Value 6.4E5 2.9E4 4.3E4 2.8E5 1.4E4 1.1E4 2.5E4 5.3E5 8.3E5 nCohort 134 146 231 133 145 225 128 143 210 Recovered nCohort Non- 193 181 94 194 182 100 199 184 115 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 82% 82% 86% 82% 82% 87% 81% 82% 84% Specificity 35% 34% 29% 35% 34% 30% 34% 34% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 56% 56% 62% 56% 56% 62% 55% 57% 60% Specificity 58% 57% 55% 59% 57% 55% 58% 58% 55% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 32% 32% 33% 32% 32% 34% 31% 33% 35% Specificity 84% 84% 78% 85% 84% 79% 84% 85% 80% OR Quartile 2 2.44 2.27 2.60 2.48 2.30 2.90 2.22 2.39 2.31 p Value 6.1E4 0.0017 0.0040 4.8E4 0.0013 0.0013 0.0021 8.6E4 0.0049 Lower limit of 1.46 1.36 1.36 1.49 1.38 1.52 1.34 1.43 1.29 95% CI Upper limit of 4.06 3.77 4.98 4.14 3.84 5.54 3.69 3.98 4.14 95% CI OR Quartile 3 1.77 1.66 1.93 1.82 1.71 2.00 1.69 1.80 1.85 p Value 0.012 0.023 0.0084 0.0087 0.017 0.0047 0.021 0.0092 0.0089 Lower limit of 1.13 1.07 1.18 1.16 1.10 1.24 1.08 1.16 1.17 95% CI Upper limit of 2.76 2.58 3.16 2.84 2.65 3.24 2.65 2.80 2.94 95% CI OR Quartile 4 2.49 2.40 1.74 2.65 2.54 1.90 2.44 2.66 2.13 p Value 0.0013 0.0014 0.041 6.8E4 7.5E4 0.016 0.0019 4.7E4 0.0037 Lower limit of 1.43 1.40 1.02 1.51 1.48 1.13 1.39 1.54 1.28 95% CI Upper limit of 4.34 4.10 2.95 4.66 4.38 3.20 4.29 4.61 3.56 95% CI

TABLE-US-00114 TABLE 15.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3100 3490 3080 3510 3120 3470 Average 3460 4230 3430 4250 3470 4200 Stdev 1830 2810 1810 2800 1820 2790 p (t-test) 0.0042 0.0021 0.0060 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 154 173 152 175 148 179 sCr only Median 3110 3480 3100 3490 3090 3500 Average 3500 4230 3480 4240 3440 4280 Stdev 1870 2830 1860 2820 1790 2850 p (t-test) 0.0060 0.0042 0.0017 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 161 166 160 167 159 168 UO only Median 3080 3720 3050 3720 3070 3720 Average 3540 4640 3520 4670 3490 4580 Stdev 2050 2980 2040 2970 2040 2890 p (t-test) 1.7E4 6.3E5 1.1E4 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 230 95 228 97 215 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.57 0.61 0.59 0.58 0.62 0.57 0.58 0.62 SE 0.031 0.032 0.035 0.031 0.031 0.035 0.032 0.031 0.034 p Value 0.015 0.020 0.0012 0.0062 0.013 3.8E4 0.022 0.0075 4.7E4 nCohort 154 161 230 152 160 228 148 159 215 Recovered nCohort Non- 173 166 95 175 167 97 179 168 110 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 81% 85% 81% 81% 86% 80% 81% 85% Specificity 31% 31% 29% 32% 31% 29% 31% 31% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 53% 53% 59% 54% 53% 60% 53% 54% 58% Specificity 53% 53% 53% 54% 53% 54% 53% 53% 54% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 29% 30% 32% 30% 30% 33% 29% 30% 33% Specificity 79% 80% 77% 80% 80% 78% 80% 81% 79% OR Quartile 2 1.85 1.89 2.38 1.91 1.92 2.47 1.79 1.95 2.32 p Value 0.017 0.015 0.0075 0.012 0.012 0.0052 0.024 0.010 0.0055 Lower limit of 1.12 1.13 1.26 1.15 1.15 1.31 1.08 1.17 1.28 95% CI Upper limit of 3.07 3.14 4.49 3.18 3.19 4.65 2.97 3.25 4.20 95% CI OR Quartile 3 1.29 1.26 1.65 1.36 1.29 1.74 1.23 1.33 1.63 p Value 0.25 0.29 0.042 0.17 0.25 0.024 0.35 0.20 0.039 Lower limit of 0.837 0.817 1.02 0.879 0.837 1.08 0.797 0.858 1.02 95% CI Upper limit of 2.00 1.95 2.68 2.10 2.00 2.82 1.91 2.05 2.59 95% CI OR Quartile 4 1.55 1.62 1.58 1.72 1.71 1.75 1.61 1.80 1.79 p Value 0.092 0.061 0.092 0.039 0.039 0.037 0.069 0.024 0.027 Lower limit of 0.931 0.978 0.928 1.03 1.03 1.03 0.963 1.08 1.07 95% CI Upper limit of 2.58 2.70 2.69 2.88 2.85 2.97 2.69 3.00 2.99 95% CI

TABLE-US-00115 TABLE 15.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3080 3510 3040 3520 3090 3500 Average 3460 4290 3430 4310 3460 4250 Stdev 1790 2890 1780 2870 1790 2850 p (t-test) 0.0020 9.9E4 0.0030 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 166 161 163 164 159 168 sCr only Median 3110 3500 3100 3510 3090 3510 Average 3510 4250 3490 4270 3460 4300 Stdev 1850 2880 1840 2880 1780 2900 p (t-test) 0.0056 0.0038 0.0015 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 169 158 168 159 167 160 UO only Median 3050 3860 3040 3790 3070 3720 Average 3500 4690 3500 4680 3500 4590 Stdev 2020 2980 2030 2960 2040 2910 p (t-test) 3.3E5 3.6E5 1.1E4 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 226 99 225 100 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.57 0.63 0.59 0.57 0.63 0.58 0.58 0.62 SE 0.032 0.032 0.035 0.031 0.032 0.034 0.032 0.032 0.034 p Value 0.013 0.031 3.0E4 0.0046 0.021 2.7E4 0.017 0.012 6.2E4 nCohort 166 169 226 163 168 225 159 167 217 Recovered nCohort Non- 161 158 99 164 159 100 168 160 108 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 80% 86% 80% 80% 86% 80% 80% 85% Specificity 30% 30% 30% 31% 30% 30% 30% 30% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 54% 53% 59% 55% 53% 59% 54% 54% 57% Specificity 54% 53% 54% 55% 53% 54% 53% 53% 53% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 29% 29% 33% 30% 30% 33% 29% 30% 32% Specificity 79% 79% 78% 80% 79% 78% 79% 80% 78% OR Quartile 2 1.74 1.65 2.56 1.83 1.68 2.60 1.70 1.71 2.46 p Value 0.034 0.053 0.0036 0.021 0.046 0.0030 0.039 0.039 0.0036 Lower limit of 1.04 0.994 1.36 1.10 1.01 1.38 1.03 1.03 1.34 95% CI Upper limit of 2.89 2.75 4.82 3.04 2.80 4.91 2.83 2.85 4.50 95% CI OR Quartile 3 1.36 1.26 1.63 1.46 1.29 1.67 1.33 1.33 1.55 p Value 0.17 0.29 0.045 0.087 0.25 0.034 0.20 0.20 0.066 Lower limit of 0.880 0.818 1.01 0.946 0.838 1.04 0.858 0.859 0.972 95% CI Upper limit of 2.10 1.95 2.63 2.26 2.00 2.70 2.05 2.05 2.47 95% CI OR Quartile 4 1.54 1.52 1.81 1.68 1.59 1.77 1.57 1.68 1.73 p Value 0.092 0.10 0.027 0.046 0.070 0.033 0.081 0.045 0.037 Lower limit of 0.932 0.917 1.07 1.01 0.963 1.05 0.946 1.01 1.03 95% CI Upper limit of 2.56 2.51 3.05 2.79 2.64 2.99 2.61 2.78 2.91 95% CI

TABLE-US-00116 TABLE 15.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3100 3510 3080 3520 3090 3510 Average 3560 4390 3550 4390 3550 4380 Stdev 2090 2830 2100 2810 2100 2800 p (t-test) 0.0026 0.0020 0.0025 Min 1080 863 1080 863 1080 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 204 123 202 125 201 126 sCr only Median 3080 3510 3080 3510 3080 3510 Average 3480 4370 3480 4370 3480 4370 Stdev 1770 3010 1770 3010 1770 3010 p (t-test) 8.8E4 8.8E4 8.8E4 Min 1080 863 1080 863 1080 863 Max 14500 19700 14500 19700 14500 19700 n (Patient) 184 143 184 143 184 143 UO only Median 3040 3860 3040 3790 3040 3790 Average 3470 4670 3470 4660 3470 4650 Stdev 2030 2910 2030 2900 2030 2880 p (t-test) 2.3E5 2.5E5 2.3E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 220 105 219 106 217 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.58 0.63 0.59 0.58 0.63 0.59 0.58 0.63 SE 0.033 0.032 0.034 0.033 0.032 0.034 0.033 0.032 0.034 p Value 0.011 0.013 1.2E4 0.0064 0.013 1.1E4 0.0079 0.013 8.0E5 nCohort 204 184 220 202 184 219 201 184 217 Recovered nCohort Non- 123 143 105 125 143 106 126 143 108 recovered Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 83% 82% 87% 83% 82% 87% 83% 82% 87% Specificity 30% 30% 30% 30% 30% 31% 30% 30% 31% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 55% 55% 58% 56% 55% 58% 56% 55% 58% Specificity 53% 53% 54% 53% 53% 54% 53% 53% 54% Cutoff Quartile 4 4720 4720 4720 4720 4720 4720 4720 4720 4720 Sensitivity 29% 30% 32% 30% 30% 32% 29% 30% 32% Specificity 77% 79% 78% 78% 79% 78% 78% 79% 78% OR Quartile 2 2.07 1.97 2.85 2.14 1.97 2.90 2.18 1.97 3.00 p Value 0.010 0.012 0.0012 0.0073 0.012 9.6E4 0.0061 0.012 6.5E4 Lower limit of 1.19 1.16 1.51 1.23 1.16 1.54 1.25 1.16 1.60 95% CI Upper limit of 3.62 3.34 5.35 3.74 3.34 5.45 3.80 3.34 5.64 95% CI OR Quartile 3 1.39 1.37 1.60 1.46 1.37 1.65 1.42 1.37 1.64 p Value 0.15 0.16 0.049 0.097 0.16 0.037 0.12 0.16 0.038 Lower limit of 0.887 0.882 1.00 0.934 0.882 1.03 0.910 0.882 1.03 95% CI Upper limit of 2.18 2.12 2.57 2.29 2.12 2.63 2.23 2.12 2.61 95% CI OR Quartile 4 1.42 1.60 1.72 1.47 1.60 1.68 1.44 1.60 1.73 p Value 0.18 0.067 0.041 0.14 0.067 0.049 0.16 0.067 0.037 Lower limit of 0.855 0.967 1.02 0.883 0.967 1.00 0.868 0.967 1.03 95% CI Upper limit of 2.36 2.64 2.88 2.44 2.64 2.83 2.39 2.64 2.91 95% CI

Example 16. Use of Metalloproteinase Inhibitor 4 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0166] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 4 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0167] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0168] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00117 TABLE 16.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.3 51.9 16.5 61.5 17.0 56.6 Average 37.9 382 37.4 440 78.7 394 Stdev 62.5 1270 60.8 1370 589 1120 p (t-test) 1.3E4 1.6E5 0.0014 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 205 112 221 96 236 81 sCr only Median 16.9 48.7 16.9 56.6 18.2 53.0 Average 38.8 392 38.9 449 80.3 389 Stdev 62.9 1290 61.8 1390 590 1130 p (t-test) 1.0E4 1.4E5 0.0019 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 208 108 223 93 235 81 UO only Median 20.5 54.3 20.7 55.6 20.8 57.9 Average 99.1 580 98.5 624 98.3 640 Stdev 568 1540 565 1590 564 1610 p (t-test) 2.2E4 9.2E5 6.7E5 Min 0.00110 1.76 0.00110 1.76 0.00110 1.76 Max 9030 7570 9030 7570 9030 7570 n (Patient) 275 40 278 37 279 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.69 0.69 0.74 0.72 0.69 0.73 0.70 0.70 SE 0.031 0.032 0.049 0.032 0.033 0.050 0.035 0.036 0.051 p Value 2.1E11 1.8E9 8.2E5 6.9E14 4.2E11 1.3E4 2.0E11 3.0E8 1.2E4 nCohort Non- 205 208 275 221 223 278 236 235 279 persistent nCohort 112 108 40 96 93 37 81 81 36 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 86% 84% 88% 89% 87% 86% 89% 86% 86% Specificity 31% 30% 27% 31% 30% 27% 30% 29% 27% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 71% 69% 80% 74% 72% 78% 77% 73% 78% Specificity 61% 60% 54% 60% 59% 54% 59% 58% 53% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 46% 45% 45% 50% 48% 46% 48% 46% 47% Specificity 86% 86% 78% 86% 85% 78% 83% 82% 78% OR Quartile 2 2.66 2.27 2.58 3.43 2.90 2.32 3.37 2.59 2.24 p Value 0.0016 0.0070 0.057 4.6E4 0.0019 0.092 0.0014 0.0073 0.11 Lower limit of 1.45 1.25 0.973 1.72 1.48 0.872 1.60 1.29 0.839 95% CI Upper limit of 4.88 4.13 6.83 6.85 5.67 6.18 7.12 5.19 5.97 95% CI OR Quartile 3 3.74 3.21 4.73 4.29 3.74 4.19 4.68 3.68 4.01 p Value 1.6E7 3.3E6 1.7E4 6.9E8 8.9E7 6.0E4 1.5E7 3.9E6 9.0E4 Lower limit of 2.28 1.97 2.10 2.53 2.21 1.85 2.63 2.12 1.77 95% CI Upper limit of 6.13 5.25 10.6 7.29 6.32 9.48 8.32 6.41 9.11 95% CI OR Quartile 4 5.07 4.93 2.87 5.91 5.21 2.96 4.42 3.86 3.13 p Value 4.0E9 7.8E9 0.0025 2.1E10 3.2E9 0.0026 1.3E7 1.5E6 0.0017 Lower limit of 2.95 2.87 1.45 3.41 3.02 1.46 2.55 2.23 1.54 95% CI Upper limit of 8.72 8.47 5.69 10.2 9.00 6.00 7.66 6.70 6.39 95% CI

TABLE-US-00118 TABLE 16.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.3 43.9 16.3 56.6 16.5 56.1 Average 35.1 336 34.1 385 78.4 340 Stdev 57.4 1180 55.3 1260 611 1030 p (t-test) 5.9E4 9.1E5 0.0052 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 186 131 204 113 219 98 sCr only Median 16.9 42.2 16.7 51.9 17.0 46.3 Average 37.9 348 36.9 389 81.6 332 Stdev 60.8 1210 59.2 1280 612 1030 p (t-test) 4.7E4 1.0E4 0.0075 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 192 124 206 110 218 98 UO only Median 20.0 43.9 20.4 50.8 20.5 51.9 Average 101 416 100 443 100 451 Stdev 588 1280 584 1330 583 1340 p (t-test) 0.0048 0.0027 0.0023 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 256 59 260 55 261 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.67 0.66 0.73 0.71 0.66 0.73 0.69 0.66 SE 0.030 0.032 0.042 0.031 0.032 0.043 0.032 0.034 0.043 p Value 6.6E11 3.6E8 1.0E4 2.6E14 8.9E11 1.4E4 1.3E12 2.5E8 1.4E4 nCohort Non- 186 192 256 204 206 260 219 218 261 persistent nCohort 131 124 59 113 110 55 98 98 54 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 85% 83% 86% 87% 85% 85% 88% 86% 85% Specificity 32% 30% 28% 31% 31% 27% 31% 30% 27% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 66% 65% 71% 72% 69% 71% 73% 68% 70% Specificity 61% 59% 55% 62% 60% 54% 60% 58% 54% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 43% 42% 41% 48% 45% 42% 47% 43% 43% Specificity 87% 86% 79% 87% 86% 78% 84% 83% 79% OR Quartile 2 2.58 2.12 2.45 2.99 2.59 2.21 3.16 2.55 2.15 p Value 0.0011 0.0086 0.027 5.3E4 0.0021 0.052 7.5E4 0.0039 0.061 Lower limit of 1.46 1.21 1.11 1.61 1.41 0.994 1.62 1.35 0.967 95% CI Upper limit of 4.55 3.72 5.41 5.54 4.75 4.90 6.17 4.81 4.78 95% CI OR Quartile 3 3.13 2.66 2.98 4.09 3.38 2.89 4.20 3.02 2.79 p Value 1.7E6 4.1E5 5.0E4 2.8E8 1.2E6 9.9E4 7.8E8 1.7E5 0.0015 Lower limit of 1.96 1.67 1.61 2.49 2.07 1.54 2.49 1.82 1.48 95% CI Upper limit of 5.00 4.24 5.51 6.72 5.52 5.43 7.09 4.99 5.25 95% CI OR Quartile 4 5.04 4.41 2.51 6.27 5.09 2.62 4.81 3.67 2.72 p Value 8.7E9 7.5E8 0.0026 7.7E11 4.4E9 0.0021 1.1E8 1.8E6 0.0015 Lower limit of 2.90 2.57 1.38 3.61 2.95 1.42 2.81 2.15 1.47 95% CI Upper limit of 8.74 7.58 4.56 10.9 8.76 4.83 8.26 6.26 5.02 95% CI

TABLE-US-00119 TABLE 16.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 15.8 42.0 16.0 53.0 16.3 51.9 Average 33.1 315 32.1 350 79.7 305 Stdev 52.8 1140 51.2 1200 631 967 p (t-test) 0.0012 3.0E4 0.013 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 175 142 190 127 205 112 sCr only Median 16.4 42.0 16.3 46.5 17.0 45.0 Average 34.5 329 34.8 360 81.7 309 Stdev 53.5 1170 54.9 1230 626 985 p (t-test) 7.6E4 2.5E4 0.013 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 9030 7570 n (Patient) 182 134 195 121 208 108 UO only Median 19.1 40.3 19.6 47.4 19.6 47.4 Average 103 365 101 391 101 391 Stdev 600 1190 594 1240 594 1240 p (t-test) 0.013 0.0075 0.0075 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 246 69 251 64 251 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.65 0.72 0.70 0.66 0.71 0.68 0.66 SE 0.030 0.031 0.039 0.030 0.031 0.040 0.031 0.033 0.040 p Value 9.5E11 9.9E9 1.3E4 4.7E14 4.9E11 1.0E4 1.8E11 1.9E8 1.0E4 nCohort Non- 175 182 246 190 195 251 205 208 251 persistent nCohort 142 134 69 127 121 64 112 108 64 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 85% 83% 86% 87% 85% 84% 87% 85% 84% Specificity 33% 31% 28% 33% 31% 27% 31% 30% 27% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 65% 64% 70% 69% 68% 70% 70% 67% 70% Specificity 62% 60% 55% 63% 61% 55% 60% 59% 55% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 41% 41% 39% 45% 44% 41% 44% 42% 41% Specificity 87% 87% 79% 88% 87% 79% 85% 84% 79% OR Quartile 2 2.63 2.14 2.30 3.13 2.60 2.05 2.94 2.50 2.05 p Value 6.0E4 0.0064 0.024 1.6E4 0.0013 0.054 6.5E4 0.0031 0.054 Lower limit of 1.51 1.24 1.11 1.73 1.45 0.987 1.58 1.36 0.987 95% CI Upper limit of 4.58 3.71 4.75 5.68 4.68 4.25 5.45 4.59 4.25 95% CI OR Quartile 3 3.13 2.74 2.83 3.78 3.29 2.89 3.51 2.84 2.89 p Value 1.2E6 1.9E5 3.6E4 4.9E8 1.0E6 4.3E4 5.2E7 2.6E5 4.3E4 Lower limit of 1.98 1.73 1.60 2.34 2.04 1.60 2.15 1.75 1.60 95% CI Upper limit of 4.97 4.34 5.00 6.10 5.31 5.22 5.74 4.61 5.22 95% CI OR Quartile 4 4.80 4.58 2.40 5.91 5.07 2.56 4.37 3.66 2.56 p Value 3.6E8 5.9E8 0.0027 4.6E10 6.2E9 0.0016 6.4E8 1.7E6 0.0016 Lower limit of 2.75 2.64 1.35 3.38 2.93 1.43 2.56 2.15 1.43 95% CI Upper limit of 8.39 7.95 4.25 10.3 8.76 4.58 7.45 6.21 4.58 95% CI

TABLE-US-00120 TABLE 16.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 15.8 42.0 16.3 51.9 16.3 48.7 Average 32.9 311 32.2 347 36.2 373 Stdev 53.0 1130 51.3 1190 59.1 1250 p (t-test) 0.0013 3.4E4 1.6E4 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 173 144 189 128 201 116 sCr only Median 16.7 41.1 16.3 46.3 17.0 45.0 Average 34.8 324 33.8 354 37.6 381 Stdev 53.8 1160 52.5 1210 59.9 1270 p (t-test) 9.2E4 3.0E4 1.4E4 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 180 136 192 124 204 112 UO only Median 18.2 42.1 18.8 47.4 18.8 47.4 Average 104 337 102 363 102 363 Stdev 608 1140 601 1180 601 1180 p (t-test) 0.022 0.013 0.013 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 239 76 245 70 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.66 0.72 0.70 0.66 0.71 0.69 0.66 SE 0.030 0.031 0.038 0.030 0.031 0.039 0.031 0.032 0.039 p Value 8.7E11 3.9E8 2.5E5 1.6E13 6.9E11 3.7E5 3.8E11 6.9E9 3.7E5 nCohort Non- 173 180 239 189 192 245 201 204 245 persistent nCohort 144 136 76 128 124 70 116 112 70 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 84% 82% 86% 86% 85% 84% 86% 85% 84% Specificity 32% 31% 28% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 65% 63% 70% 69% 67% 70% 68% 66% 70% Specificity 62% 60% 56% 62% 61% 56% 60% 59% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 41% 40% 39% 45% 44% 40% 43% 42% 40% Specificity 88% 87% 79% 88% 87% 79% 85% 84% 79% OR Quartile 2 2.52 2.05 2.35 2.91 2.51 2.06 2.85 2.44 2.06 p Value 9.5E4 0.0094 0.016 3.4E4 0.0017 0.043 7.0E4 0.0034 0.043 Lower limit of 1.46 1.19 1.17 1.62 1.41 1.02 1.56 1.34 1.02 95% CI Upper limit of 4.36 3.53 4.72 5.22 4.47 4.16 5.23 4.43 4.16 95% CI OR Quartile 3 3.12 2.58 2.94 3.66 3.16 2.91 3.23 2.78 2.91 p Value 1.3E6 5.1E5 1.3E4 9.2E8 1.9E6 2.4E4 1.9E6 3.0E5 2.4E4 Lower limit of 1.97 1.63 1.69 2.27 1.97 1.65 1.99 1.72 1.65 95% CI Upper limit of 4.95 4.08 5.11 5.88 5.07 5.15 5.23 4.50 5.15 95% CI OR Quartile 4 5.02 4.41 2.53 5.79 5.15 2.54 4.32 3.89 2.54 p Value 2.1E8 1.2E7 0.0011 6.9E10 5.2E9 0.0013 8.1E8 5.7E7 0.0013 Lower limit of 2.86 2.55 1.45 3.32 2.97 1.44 2.53 2.28 1.44 95% CI Upper limit of 8.83 7.65 4.41 10.1 8.93 4.48 7.37 6.62 4.48 95% CI

TABLE-US-00121 TABLE 16.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 15.8 41.1 15.8 50.8 16.3 46.3 Average 32.4 304 31.4 336 36.1 362 Stdev 52.7 1110 50.9 1170 59.5 1230 p (t-test) 0.0017 4.8E4 2.5E4 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 169 148 184 133 197 120 sCr only Median 16.4 40.2 16.3 45.0 16.7 43.2 Average 34.4 317 33.4 345 37.3 370 Stdev 53.5 1140 52.2 1190 59.8 1250 p (t-test) 0.0012 4.1E4 2.0E4 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 176 140 188 128 200 116 UO only Median 18.1 46.1 18.2 48.4 18.2 48.4 Average 97.3 342 96.6 354 96.6 354 Stdev 611 1110 607 1130 607 1130 p (t-test) 0.014 0.011 0.011 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 234 81 237 78 237 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.68 0.72 0.70 0.68 0.71 0.68 0.68 SE 0.030 0.031 0.036 0.029 0.031 0.037 0.031 0.032 0.037 p Value 8.1E11 3.4E8 1.2E6 2.5E14 6.5E11 1.6E6 3.6E11 7.2E9 1.6E6 nCohort Non- 169 176 234 184 188 237 197 200 237 persistent nCohort 148 140 81 133 128 78 120 116 78 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 84% 82% 86% 86% 84% 86% 86% 84% 86% Specificity 33% 31% 29% 33% 31% 29% 31% 30% 29% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 65% 63% 70% 69% 66% 71% 68% 66% 71% Specificity 63% 60% 57% 64% 61% 57% 61% 59% 57% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 41% 40% 41% 44% 43% 41% 42% 41% 41% Specificity 88% 87% 80% 89% 87% 80% 85% 84% 80% OR Quartile 2 2.49 2.04 2.61 2.90 2.47 2.45 2.78 2.39 2.45 p Value 9.7E4 0.0096 0.0069 2.8E4 0.0018 0.012 7.4E4 0.0036 0.012 Lower limit of 1.45 1.19 1.30 1.63 1.40 1.22 1.54 1.33 1.22 95% CI Upper limit of 4.29 3.49 5.23 5.16 4.36 4.92 5.04 4.29 4.92 95% CI OR Quartile 3 3.11 2.56 3.13 3.92 3.11 3.11 3.36 2.73 3.11 p Value 1.3E6 5.4E5 3.8E5 1.7E8 2.1E6 5.3E5 7.1E7 3.4E5 5.3E5 Lower limit of 1.96 1.62 1.82 2.44 1.95 1.79 2.08 1.70 1.79 95% CI Upper limit of 4.92 4.05 5.38 6.30 4.98 5.39 5.43 4.40 5.39 95% CI OR Quartile 4 5.08 4.43 2.81 6.19 5.15 2.81 4.28 3.85 2.81 p Value 2.4E8 1.3E7 2.2E4 3.4E10 6.4E9 2.5E4 1.0E7 6.9E7 2.5E4 Lower limit of 2.87 2.55 1.62 3.50 2.96 1.62 2.51 2.26 1.62 95% CI Upper limit of 8.99 7.71 4.86 10.9 8.95 4.89 7.31 6.55 4.89 95% CI

TABLE-US-00122 TABLE 16.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3120 3720 3140 3810 3150 3810 Average 3490 4520 3560 4520 3630 4500 Stdev 1640 3270 1820 3280 2090 3090 p (t-test) 2.0E4 8.7E4 0.0039 Min 1080 863 1080 863 1080 863 Max 9820 19700 14500 19700 19700 18800 n (Patient) 206 121 222 105 238 89 sCr only Median 3100 3620 3090 3860 3120 3670 Average 3470 4540 3530 4580 3620 4490 Stdev 1630 3310 1810 3300 2080 3080 p (t-test) 1.1E4 2.7E4 0.0035 Min 1080 863 1080 863 1080 863 Max 9820 19700 14500 19700 19700 18800 n (Patient) 208 118 223 103 236 90 UO only Median 3140 4580 3150 4610 3140 4750 Average 3580 5670 3580 5740 3570 5940 Stdev 2020 3670 2010 3740 2010 3720 p (t-test) 5.0E8 3.4E8 2.5E9 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 281 44 283 42 285 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.58 0.69 0.57 0.59 0.69 0.57 0.57 0.72 SE 0.033 0.033 0.047 0.034 0.035 0.048 0.036 0.036 0.048 p Value 0.022 0.018 5.4E5 0.036 0.013 8.5E5 0.048 0.039 5.3E6 nCohort Non- 206 208 281 222 223 283 238 236 285 persistent nCohort 121 118 44 105 103 42 89 90 40 Persistent Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 79% 79% 91% 80% 80% 90% 80% 79% 95% Specificity 28% 27% 27% 27% 27% 27% 27% 27% 28% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 56% 56% 68% 56% 57% 67% 57% 57% 70% Specificity 53% 53% 53% 53% 53% 52% 53% 53% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 33% 34% 45% 33% 35% 48% 33% 33% 50% Specificity 80% 80% 78% 79% 79% 78% 78% 78% 78% OR Quartile 2 1.47 1.40 3.77 1.52 1.47 3.55 1.45 1.36 7.29 p Value 0.16 0.21 0.014 0.15 0.18 0.019 0.22 0.30 0.0071 Lower limit of 0.860 0.821 1.31 0.864 0.838 1.23 0.803 0.760 1.72 95% CI Upper limit of 2.51 2.40 10.9 2.66 2.58 10.3 2.62 2.44 30.9 95% CI OR Quartile 3 1.47 1.45 2.38 1.43 1.53 2.19 1.48 1.45 2.59 p Value 0.094 0.11 0.012 0.13 0.075 0.024 0.11 0.14 0.0090 Lower limit of 0.936 0.922 1.21 0.896 0.958 1.11 0.909 0.888 1.27 95% CI Upper limit of 2.31 2.29 4.69 2.28 2.46 4.34 2.43 2.36 5.30 95% CI OR Quartile 4 1.93 2.03 2.94 1.86 2.07 3.24 1.69 1.77 3.60 p Value 0.011 0.0066 0.0013 0.019 0.0061 5.6E4 0.057 0.037 2.3E4 Lower limit of 1.16 1.22 1.53 1.11 1.23 1.66 0.985 1.04 1.82 95% CI Upper limit of 3.21 3.37 5.68 3.13 3.47 6.32 2.89 3.02 7.10 95% CI

TABLE-US-00123 TABLE 16.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3110 3720 3120 3810 3140 3770 Average 3420 4470 3510 4470 3600 4420 Stdev 1590 3130 1800 3120 2090 2930 p (t-test) 9.5E5 4.3E4 0.0035 Min 1080 863 1080 863 1080 863 Max 9820 19700 14500 19700 19700 18800 n (Patient) 187 140 204 123 219 108 sCr only Median 3100 3620 3090 3810 3130 3520 Average 3420 4490 3490 4480 3600 4380 Stdev 1580 3180 1790 3140 2090 2930 p (t-test) 8.1E5 3.4E4 0.0059 Min 1080 863 1080 863 1080 863 Max 9820 19700 14500 19700 19700 18800 n (Patient) 192 134 205 121 217 109 UO only Median 3140 3990 3140 4150 3130 4350 Average 3570 5020 3570 5090 3560 5210 Stdev 2040 3300 2030 3360 2030 3360 p (t-test) 1.2E5 5.8E6 1.2E6 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 260 65 263 62 265 60 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.59 0.59 0.64 0.58 0.59 0.64 0.58 0.57 0.66 SE 0.032 0.032 0.040 0.033 0.033 0.041 0.034 0.034 0.041 p Value 0.0062 0.0078 7.5E4 0.010 0.0084 6.1E4 0.025 0.039 1.0E4 nCohort Non- 187 192 260 204 205 263 219 217 265 persistent nCohort 140 134 65 123 121 62 108 109 60 Persistent Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 80% 88% 81% 81% 89% 81% 81% 92% Specificity 29% 29% 28% 29% 29% 28% 28% 28% 29% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 56% 55% 62% 56% 56% 61% 56% 55% 63% Specificity 54% 54% 53% 53% 54% 52% 53% 53% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 32% 32% 35% 33% 32% 37% 31% 30% 38% Specificity 80% 80% 77% 79% 79% 78% 78% 77% 78% OR Quartile 2 1.62 1.59 2.78 1.77 1.72 3.08 1.74 1.64 4.42 p Value 0.068 0.083 0.011 0.040 0.051 0.0081 0.056 0.084 0.0022 Lower limit of 0.964 0.941 1.27 1.03 0.998 1.34 0.985 0.935 1.70 95% CI Upper limit of 2.73 2.69 6.12 3.05 2.97 7.06 3.07 2.87 11.5 95% CI OR Quartile 3 1.48 1.43 1.78 1.47 1.49 1.75 1.46 1.36 1.93 p Value 0.082 0.12 0.042 0.096 0.086 0.053 0.11 0.20 0.025 Lower limit of 0.951 0.916 1.02 0.935 0.945 0.993 0.919 0.854 1.09 95% CI Upper limit of 2.29 2.22 3.11 2.30 2.33 3.08 2.32 2.15 3.45 95% CI OR Quartile 4 1.92 1.85 1.87 1.86 1.79 2.04 1.64 1.49 2.17 p Value 0.011 0.017 0.037 0.017 0.025 0.018 0.062 0.13 0.011 Lower limit of 1.16 1.12 1.04 1.12 1.08 1.13 0.976 0.887 1.20 95% CI Upper limit of 3.18 3.07 3.35 3.09 2.98 3.68 2.75 2.50 3.94 95% CI

TABLE-US-00124 TABLE 16.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3100 3510 3100 3520 3140 3620 Average 3400 4420 3460 4440 3550 4400 Stdev 1530 3080 1740 3060 2060 2870 p (t-test) 1.2E4 2.8E4 0.0021 Min 1080 863 1080 863 1080 863 Max 9100 19700 14500 19700 19700 18800 n (Patient) 176 151 190 137 205 122 sCr only Median 3100 3500 3100 3510 3130 3510 Average 3420 4420 3490 4410 3590 4330 Stdev 1590 3100 1780 3070 2100 2860 p (t-test) 2.2E4 6.9E4 0.0078 Min 1080 863 1080 863 1080 863 Max 9820 19700 14500 19700 19700 18800 n (Patient) 182 144 194 132 207 119 UO only Median 3100 3960 3110 3960 3110 3990 Average 3510 5010 3540 5000 3530 5050 Stdev 2000 3190 2030 3200 2030 3200 p (t-test) 1.6E6 3.9E6 1.9E6 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 249 76 253 72 254 71 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.58 0.65 0.59 0.58 0.65 0.58 0.57 0.65 SE 0.032 0.032 0.038 0.032 0.032 0.039 0.033 0.033 0.039 p Value 0.0079 0.012 8.4E5 0.0071 0.013 1.6E4 0.014 0.042 6.7E5 nCohort Non- 176 182 249 190 194 253 205 207 254 persistent nCohort 151 144 76 137 132 72 122 119 71 Persistent Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 80% 88% 82% 81% 89% 82% 81% 90% Specificity 30% 29% 29% 30% 29% 29% 29% 29% 29% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 54% 53% 61% 54% 54% 60% 55% 54% 61% Specificity 53% 53% 53% 53% 53% 53% 53% 52% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 31% 31% 36% 32% 32% 36% 31% 30% 37% Specificity 80% 80% 78% 80% 79% 78% 79% 78% 78% OR Quartile 2 1.69 1.63 3.03 1.92 1.78 3.24 1.88 1.66 3.76 p Value 0.045 0.065 0.0037 0.016 0.034 0.0032 0.025 0.068 0.0017 Lower limit of 1.01 0.971 1.43 1.13 1.04 1.48 1.08 0.964 1.65 95% CI Upper limit of 2.83 2.73 6.40 3.27 3.04 7.10 3.26 2.87 8.58 95% CI OR Quartile 3 1.30 1.28 1.73 1.31 1.29 1.64 1.36 1.27 1.71 p Value 0.24 0.27 0.040 0.24 0.26 0.067 0.18 0.30 0.049 Lower limit of 0.839 0.828 1.03 0.840 0.828 0.966 0.865 0.808 1.00 95% CI Upper limit of 2.00 1.99 2.92 2.03 2.01 2.80 2.13 1.99 2.93 95% CI OR Quartile 4 1.82 1.78 1.94 1.89 1.80 1.99 1.66 1.52 2.04 p Value 0.020 0.025 0.019 0.013 0.023 0.017 0.052 0.11 0.013 Lower limit of 1.10 1.08 1.11 1.14 1.08 1.13 0.996 0.911 1.16 95% CI Upper limit of 3.02 2.95 3.39 3.14 2.98 3.50 2.75 2.53 3.60 95% CI

TABLE-US-00125 TABLE 16.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3090 3510 3100 3520 3120 3520 Average 3390 4400 3460 4420 3490 4470 Stdev 1540 3060 1740 3040 1740 3140 p (t-test) 1.5E4 3.9E4 3.6E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 14500 19700 14500 19700 n (Patient) 173 154 188 139 200 127 sCr only Median 3090 3510 3080 3620 3100 3620 Average 3390 4430 3450 4430 3480 4480 Stdev 1520 3110 1740 3060 1730 3170 p (t-test) 9.8E5 2.9E4 2.7E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 14500 19700 14500 19700 n (Patient) 179 147 190 136 202 124 UO only Median 3080 3990 3100 3960 3100 3990 Average 3480 4930 3510 4930 3510 4970 Stdev 2000 3080 2020 3110 2020 3110 p (t-test) 1.4E6 4.0E6 2.0E6 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 240 85 245 80 246 79 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.58 0.65 0.58 0.59 0.64 0.58 0.58 0.65 SE 0.032 0.032 0.036 0.032 0.032 0.037 0.033 0.033 0.037 p Value 0.0072 0.0081 3.0E5 0.0087 0.0072 9.2E5 0.017 0.015 3.8E5 nCohort Non- 173 179 240 188 190 245 200 202 246 persistent nCohort 154 147 85 139 136 80 127 124 79 Persistent Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 80% 88% 81% 81% 89% 81% 81% 90% Specificity 29% 29% 30% 30% 29% 29% 29% 29% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 54% 54% 61% 54% 54% 60% 54% 55% 61% Specificity 53% 53% 54% 53% 53% 53% 52% 53% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 31% 31% 35% 32% 32% 36% 31% 31% 37% Specificity 80% 80% 78% 80% 79% 78% 78% 78% 78% OR Quartile 2 1.66 1.60 3.15 1.84 1.77 3.28 1.75 1.68 3.74 p Value 0.053 0.075 0.0017 0.023 0.035 0.0018 0.041 0.060 9.1E4 Lower limit of 0.994 0.954 1.54 1.09 1.04 1.56 1.02 0.978 1.72 95% CI Upper limit of 2.77 2.67 6.45 3.13 3.00 6.92 3.01 2.88 8.17 95% CI OR Quartile 3 1.33 1.31 1.83 1.30 1.35 1.70 1.31 1.37 1.76 p Value 0.20 0.22 0.019 0.24 0.18 0.044 0.23 0.17 0.031 Lower limit of 0.859 0.848 1.11 0.840 0.871 1.02 0.842 0.873 1.05 95% CI Upper limit of 2.05 2.03 3.03 2.02 2.11 2.83 2.05 2.14 2.96 95% CI OR Quartile 4 1.73 1.81 1.97 1.83 1.79 2.06 1.62 1.59 2.11 p Value 0.033 0.021 0.014 0.019 0.024 0.0097 0.062 0.075 0.0076 Lower limit of 1.04 1.09 1.15 1.10 1.08 1.19 0.976 0.955 1.22 95% CI Upper limit of 2.87 3.00 3.39 3.03 2.97 3.56 2.68 2.64 3.66 95% CI

TABLE-US-00126 TABLE 16.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3040 3520 3040 3770 3080 3720 Average 3370 4400 3430 4430 3480 4460 Stdev 1540 3020 1750 2990 1750 3100 p (t-test) 1.1E4 2.1E4 3.0E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 14500 19700 14500 19700 n (Patient) 169 158 183 144 196 131 sCr only Median 3040 3520 3040 3770 3050 3770 Average 3360 4450 3420 4450 3450 4500 Stdev 1510 3080 1740 3030 1730 3120 p (t-test) 4.2E5 1.4E4 1.3E4 Min 1080 863 1080 863 1080 863 Max 9100 19700 14500 19700 14500 19700 n (Patient) 175 151 186 140 198 128 UO only Median 3040 4030 3040 4180 3040 4300 Average 3460 4920 3450 4970 3440 5000 Stdev 1990 3030 1990 3050 1980 3040 p (t-test) 6.1E7 2.9E7 1.4E7 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 235 90 237 88 238 87 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.59 0.60 0.66 0.60 0.60 0.66 0.59 0.59 0.67 SE 0.031 0.032 0.035 0.032 0.032 0.035 0.032 0.033 0.035 p Value 0.0032 0.0022 7.1E6 0.0024 0.0019 3.7E6 0.0084 0.0044 1.3E6 nCohort Non- 169 175 235 183 186 237 196 198 238 persistent nCohort 158 151 90 144 140 88 131 128 87 Persistent Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 80% 80% 89% 82% 81% 90% 82% 81% 91% Specificity 30% 30% 30% 31% 30% 30% 30% 29% 31% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 54% 55% 62% 55% 56% 62% 55% 56% 63% Specificity 54% 54% 54% 54% 54% 54% 53% 54% 55% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 30% 32% 36% 31% 32% 36% 30% 31% 37% Specificity 80% 81% 79% 80% 80% 79% 78% 79% 79% OR Quartile 2 1.77 1.71 3.46 2.00 1.89 3.83 1.87 1.80 4.37 p Value 0.029 0.042 6.5E4 0.010 0.018 4.0E4 0.022 0.033 2.0E4 Lower limit of 1.06 1.02 1.70 1.18 1.11 1.82 1.09 1.05 2.01 95% CI Upper limit of 2.95 2.85 7.07 3.39 3.20 8.05 3.21 3.08 9.51 95% CI OR Quartile 3 1.39 1.45 1.97 1.40 1.49 1.99 1.38 1.51 2.07 p Value 0.14 0.096 0.0075 0.13 0.074 0.0071 0.16 0.070 0.0048 Lower limit of 0.902 0.936 1.20 0.904 0.962 1.21 0.885 0.967 1.25 95% CI Upper limit of 2.15 2.24 3.24 2.17 2.32 3.29 2.15 2.36 3.43 95% CI OR Quartile 4 1.73 1.93 2.04 1.79 1.91 2.14 1.51 1.69 2.19 p Value 0.033 0.011 0.0087 0.023 0.012 0.0054 0.11 0.042 0.0042 Lower limit of 1.04 1.16 1.20 1.08 1.15 1.25 0.911 1.02 1.28 95% CI Upper limit of 2.87 3.21 3.48 2.97 3.16 3.65 2.50 2.80 3.74 95% CI

Example 17. Use of Metalloproteinase Inhibitor 4 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0169] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Metalloproteinase inhibitor 4 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0170] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0171] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00127 TABLE 17.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.7 36.2 15.6 37.0 15.4 42.2 Average 26.9 239 34.3 284 35.2 320 Stdev 45.9 969 57.0 1080 59.2 1150 p (t-test) 0.018 0.0039 0.0010 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 119 198 158 159 179 138 sCr only Median 13.3 35.4 16.0 37.0 16.0 42.2 Average 29.3 250 31.2 294 33.1 336 Stdev 46.8 999 46.8 1090 51.4 1180 p (t-test) 0.012 0.0024 5.6E4 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 130 186 162 154 184 132 UO only Median 18.2 41.0 19.1 53.0 19.3 57.9 Average 96.3 368 99.9 422 99.5 467 Stdev 598 1160 588 1280 581 1360 p (t-test) 0.0081 0.0038 0.0017 Min 0.00110 1.76 0.00110 1.76 0.00110 1.76 Max 9030 7570 9030 7570 9030 7570 n (Patient) 241 74 256 59 263 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.68 0.67 0.67 0.69 0.69 0.69 0.70 SE 0.029 0.030 0.038 0.030 0.030 0.041 0.030 0.031 0.043 p Value 9.3E11 2.2E8 2.6E6 2.2E8 2.5E8 3.9E6 1.1E10 2.2E10 2.0E6 nCohort Non- 119 130 241 158 162 256 179 184 263 persistent nCohort 198 186 74 159 154 59 138 132 52 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 88% 82% 81% 88% 86% 85% 88% Specificity 36% 33% 29% 32% 31% 28% 33% 32% 28% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 60% 59% 69% 60% 60% 73% 64% 64% 77% Specificity 66% 63% 56% 60% 60% 55% 61% 60% 55% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 35% 35% 42% 38% 40% 44% 41% 42% 46% Specificity 92% 90% 80% 88% 89% 79% 87% 87% 79% OR Quartile 2 2.55 2.06 2.96 2.23 1.92 2.91 2.90 2.64 2.95 p Value 4.3E4 0.0060 0.0046 0.0029 0.014 0.012 2.3E4 7.9E4 0.018 Lower limit of 1.51 1.23 1.40 1.32 1.14 1.26 1.65 1.50 1.21 95% CI Upper limit of 4.28 3.45 6.26 3.78 3.25 6.70 5.12 4.66 7.19 95% CI OR Quartile 3 2.81 2.47 2.78 2.30 2.28 3.30 2.83 2.75 4.10 p Value 1.9E5 1.2E4 3.0E4 2.9E4 3.5E4 1.8E4 9.5E6 1.8E5 6.1E5 Lower limit of 1.75 1.56 1.60 1.47 1.45 1.76 1.79 1.73 2.06 95% CI Upper limit of 4.50 3.92 4.83 3.60 3.57 6.15 4.48 4.37 8.16 95% CI OR Quartile 4 5.96 4.95 2.90 4.55 5.25 3.02 4.41 4.76 3.24 p Value 8.3E7 1.3E6 1.9E4 2.5E7 3.1E8 2.8E4 1.1E7 2.9E8 2.1E4 Lower limit of 2.93 2.59 1.66 2.56 2.92 1.66 2.55 2.74 1.74 95% CI Upper limit of 12.1 9.45 5.07 8.10 9.44 5.48 7.63 8.26 6.03 95% CI

TABLE-US-00128 TABLE 17.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.5 34.8 14.7 37.0 13.3 41.1 Average 27.2 231 30.5 271 31.7 298 Stdev 47.1 953 48.1 1040 52.4 1100 p (t-test) 0.024 0.0056 0.0021 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 112 205 147 170 165 152 sCr only Median 13.3 34.9 16.3 36.9 15.4 40.1 Average 29.5 246 31.6 281 32.9 305 Stdev 47.4 989 47.8 1070 52.3 1120 p (t-test) 0.015 0.0041 0.0017 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 126 190 154 162 169 147 UO only Median 18.1 39.3 18.2 40.3 18.2 47.4 Average 99.3 306 103 338 102 363 Stdev 622 1040 609 1130 601 1180 p (t-test) 0.031 0.020 0.013 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 222 93 238 77 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.66 0.66 0.68 0.66 0.66 0.70 0.68 0.67 SE 0.030 0.030 0.035 0.030 0.030 0.037 0.029 0.030 0.039 p Value 2.2E10 5.2E8 4.9E6 1.6E9 9.6E8 1.4E5 3.0E12 1.4E9 1.1E5 nCohort Non- 112 126 222 147 154 238 165 169 245 persistent nCohort 205 190 93 170 162 77 152 147 70 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 87% 83% 81% 87% 86% 84% 87% Specificity 38% 33% 30% 34% 32% 29% 35% 33% 29% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 59% 58% 67% 61% 59% 69% 64% 62% 71% Specificity 66% 63% 57% 62% 60% 56% 62% 60% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 34% 35% 38% 38% 38% 39% 39% 39% 40% Specificity 91% 90% 80% 89% 88% 79% 88% 87% 79% OR Quartile 2 2.72 2.07 2.92 2.51 2.05 2.74 3.38 2.67 2.71 p Value 1.7E4 0.0058 0.0017 6.1E4 0.0069 0.0062 2.1E5 4.4E4 0.0094 Lower limit of 1.62 1.23 1.49 1.48 1.22 1.33 1.93 1.54 1.28 95% CI Upper limit of 4.59 3.46 5.71 4.24 3.46 5.63 5.92 4.62 5.76 95% CI OR Quartile 3 2.81 2.36 2.63 2.50 2.16 2.80 2.93 2.47 3.17 p Value 2.5E5 2.7E4 1.9E4 7.5E5 7.9E4 2.2E4 4.0E6 9.1E5 8.8E5 Lower limit of 1.74 1.49 1.58 1.59 1.38 1.62 1.86 1.57 1.78 95% CI Upper limit of 4.53 3.75 4.36 3.93 3.38 4.83 4.63 3.89 5.65 95% CI OR Quartile 4 5.29 4.63 2.44 4.94 4.56 2.46 4.73 4.23 2.54 p Value 4.4E6 3.5E6 0.0010 2.2E7 3.7E7 0.0015 9.0E8 3.9E7 0.0013 Lower limit of 2.60 2.42 1.43 2.70 2.54 1.41 2.68 2.42 1.44 95% CI Upper limit of 10.8 8.84 4.16 9.05 8.19 4.29 8.36 7.39 4.48 95% CI

TABLE-US-00129 TABLE 17.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.3 34.7 13.3 36.7 13.3 37.0 Average 27.2 230 30.6 266 32.4 285 Stdev 47.3 951 48.6 1030 53.4 1080 p (t-test) 0.025 0.0066 0.0034 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 111 206 144 173 158 159 sCr only Median 13.3 34.7 16.3 36.5 15.4 37.0 Average 29.7 243 31.8 276 33.6 293 Stdev 47.7 984 48.2 1060 53.1 1100 p (t-test) 0.016 0.0049 0.0027 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 124 192 151 165 163 153 UO only Median 18.1 37.0 18.2 39.1 18.5 39.3 Average 102 279 106 295 106 312 Stdev 637 995 626 1050 617 1090 p (t-test) 0.057 0.051 0.037 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 212 103 225 90 232 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.66 0.64 0.68 0.66 0.64 0.69 0.67 0.64 SE 0.030 0.030 0.034 0.030 0.030 0.036 0.030 0.030 0.037 p Value 1.8E10 8.1E8 5.9E5 1.0E9 1.4E7 1.5E4 1.2E10 2.2E8 1.6E4 nCohort Non- 111 124 212 144 151 225 158 163 232 persistent nCohort 206 192 103 173 165 90 159 153 83 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 85% 83% 82% 86% 85% 84% 86% Specificity 38% 34% 30% 35% 32% 29% 35% 33% 29% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 59% 58% 63% 61% 59% 64% 63% 61% 66% Specificity 67% 63% 56% 63% 60% 56% 63% 60% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 34% 34% 35% 37% 37% 36% 38% 37% 36% Specificity 91% 90% 80% 89% 88% 79% 87% 87% 79% OR Quartile 2 2.78 2.15 2.54 2.64 2.16 2.46 3.00 2.54 2.40 p Value 1.3E4 0.0038 0.0033 3.0E4 0.0038 0.0070 7.4E5 7.1E4 0.011 Lower limit of 1.65 1.28 1.36 1.56 1.28 1.28 1.74 1.48 1.22 95% CI Upper limit of 4.69 3.60 4.72 4.47 3.64 4.73 5.17 4.35 4.72 95% CI OR Quartile 3 2.90 2.37 2.19 2.72 2.22 2.27 2.84 2.34 2.46 p Value 1.5E5 2.6E4 0.0015 1.8E5 5.2E4 0.0015 6.9E6 2.3E4 7.5E4 Lower limit of 1.79 1.49 1.35 1.72 1.41 1.37 1.80 1.49 1.46 95% CI Upper limit of 4.71 3.77 3.55 4.29 3.48 3.76 4.48 3.67 4.15 95% CI OR Quartile 4 5.20 4.47 2.11 4.70 4.33 2.09 4.18 3.81 2.11 p Value 5.5E6 5.7E6 0.0053 5.3E7 9.0E7 0.0073 8.0E7 2.5E6 0.0074 Lower limit of 2.55 2.34 1.25 2.57 2.41 1.22 2.37 2.18 1.22 95% CI Upper limit of 10.6 8.54 3.57 8.60 7.78 3.58 7.38 6.64 3.66 95% CI

TABLE-US-00130 TABLE 17.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.5 34.6 13.3 36.6 13.3 37.0 Average 27.4 229 30.8 265 32.5 282 Stdev 47.5 949 48.7 1030 53.7 1070 p (t-test) 0.027 0.0071 0.0039 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 110 207 143 174 156 161 sCr only Median 13.3 34.7 16.3 34.9 15.9 36.9 Average 29.7 243 32.0 275 33.7 292 Stdev 47.7 984 48.4 1060 53.3 1090 p (t-test) 0.016 0.0052 0.0029 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 124 192 150 166 162 154 UO only Median 18.2 36.7 18.2 37.0 18.2 38.8 Average 104 270 108 281 108 294 Stdev 643 977 633 1030 625 1060 p (t-test) 0.071 0.068 0.055 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 208 107 220 95 226 89 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.66 0.63 0.68 0.66 0.63 0.69 0.67 0.63 SE 0.030 0.030 0.034 0.030 0.030 0.035 0.030 0.030 0.036 p Value 6.1E10 8.1E8 1.5E4 2.3E9 2.7E7 1.9E4 1.9E10 4.7E8 1.7E4 nCohort Non- 110 124 208 143 150 220 156 162 226 persistent nCohort 207 192 107 174 166 95 161 154 89 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 84% 83% 81% 85% 84% 83% 85% Specificity 37% 34% 30% 34% 32% 30% 35% 33% 29% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 59% 58% 62% 61% 59% 63% 63% 60% 65% Specificity 66% 63% 56% 63% 60% 55% 63% 60% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 34% 34% 35% 37% 37% 35% 37% 37% 35% Specificity 91% 90% 80% 89% 88% 79% 87% 86% 79% OR Quartile 2 2.64 2.15 2.25 2.50 2.05 2.43 2.88 2.39 2.41 p Value 2.7E4 0.0038 0.0079 5.9E4 0.0068 0.0064 1.2E4 0.0014 0.0084 Lower limit of 1.57 1.28 1.24 1.48 1.22 1.28 1.68 1.40 1.25 95% CI Upper limit of 4.46 3.60 4.09 4.22 3.45 4.59 4.94 4.08 4.64 95% CI OR Quartile 3 2.83 2.37 2.03 2.65 2.16 2.13 2.84 2.28 2.36 p Value 2.4E5 2.6E4 0.0036 2.9E5 7.8E4 0.0027 6.9E6 3.5E4 9.6E4 Lower limit of 1.75 1.49 1.26 1.68 1.38 1.30 1.80 1.45 1.42 95% CI Upper limit of 4.59 3.77 3.27 4.18 3.39 3.50 4.49 3.57 3.92 95% CI OR Quartile 4 5.11 4.47 2.09 4.62 4.26 2.01 4.04 3.74 1.98 p Value 6.9E6 5.7E6 0.0057 7.0E7 1.2E6 0.010 1.4E6 3.3E6 0.013 Lower limit of 2.51 2.34 1.24 2.52 2.37 1.18 2.29 2.14 1.15 95% CI Upper limit of 10.4 8.54 3.52 8.45 7.65 3.43 7.13 6.52 3.40 95% CI

TABLE-US-00131 TABLE 17.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.5 34.6 14.0 35.9 13.3 36.7 Average 26.9 226 30.6 259 32.6 273 Stdev 47.5 940 49.0 1020 54.2 1050 p (t-test) 0.030 0.0090 0.0055 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 106 211 138 179 150 167 sCr only Median 13.3 34.8 15.9 36.2 15.1 36.9 Average 29.1 240 31.5 269 33.3 286 Stdev 47.7 977 48.5 1040 53.5 1080 p (t-test) 0.018 0.0063 0.0036 Min 0.00110 0.00167 0.00110 0.00167 0.00110 0.00167 Max 409 9030 409 9030 409 9030 n (Patient) 121 195 146 170 158 158 UO only Median 17.7 37.0 18.1 37.0 18.2 37.9 Average 97.1 273 103 279 103 287 Stdev 648 955 641 990 634 1010 p (t-test) 0.053 0.058 0.050 Min 0.00110 0.00277 0.00110 0.00277 0.00110 0.00277 Max 9030 7570 9030 7570 9030 7570 n (Patient) 202 113 212 103 217 98 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.67 0.65 0.67 0.66 0.64 0.68 0.67 0.64 SE 0.030 0.030 0.033 0.030 0.030 0.034 0.030 0.030 0.035 p Value 5.2E10 2.6E8 1.1E5 5.1E9 8.2E8 2.9E5 7.4E10 1.4E8 3.8E5 nCohort Non- 106 121 202 138 146 212 150 158 217 persistent nCohort 211 195 113 179 170 103 167 158 98 Persistent Cutoff Quartile 2 8.33 8.31 8.36 8.33 8.31 8.36 8.33 8.31 8.36 Sensitivity 82% 81% 85% 83% 82% 86% 84% 84% 87% Specificity 38% 35% 31% 35% 33% 31% 35% 34% 30% Cutoff Quartile 3 24.1 23.6 24.1 24.1 23.6 24.1 24.1 23.6 24.1 Sensitivity 59% 58% 63% 60% 59% 63% 62% 61% 64% Specificity 67% 64% 57% 63% 61% 56% 63% 61% 56% Cutoff Quartile 4 60.9 60.8 61.8 60.9 60.8 61.8 60.9 60.8 61.8 Sensitivity 34% 34% 35% 36% 36% 35% 37% 37% 35% Specificity 92% 90% 81% 89% 88% 80% 87% 87% 79% OR Quartile 2 2.67 2.27 2.50 2.55 2.20 2.81 2.96 2.56 2.86 p Value 2.4E4 0.0019 0.0026 4.5E4 0.0030 0.0014 7.1E5 5.6E4 0.0016 Lower limit of 1.58 1.35 1.38 1.51 1.31 1.49 1.73 1.50 1.49 95% CI Upper limit of 4.52 3.81 4.54 4.29 3.70 5.30 5.06 4.37 5.48 95% CI OR Quartile 3 2.89 2.46 2.23 2.59 2.29 2.19 2.70 2.40 2.31 p Value 2.1E5 1.6E4 8.5E4 4.4E5 3.4E4 0.0015 1.8E5 1.5E4 8.6E4 Lower limit of 1.77 1.54 1.39 1.64 1.45 1.35 1.71 1.53 1.41 95% CI Upper limit of 4.71 3.93 3.58 4.10 3.59 3.55 4.26 3.77 3.78 95% CI OR Quartile 4 5.47 4.75 2.29 4.68 4.36 2.11 3.97 3.78 2.03 p Value 6.9E6 4.4E6 0.0018 9.4E7 1.2E6 0.0053 2.6E6 3.4E6 0.0088 Lower limit of 2.61 2.44 1.36 2.52 2.40 1.25 2.23 2.16 1.20 95% CI Upper limit of 11.5 9.25 3.85 8.66 7.89 3.57 7.05 6.64 3.45 95% CI

TABLE-US-00132 TABLE 17.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2870 3560 3000 3640 3110 3520 Average 3210 4220 3360 4330 3520 4290 Stdev 1650 2690 1670 2880 1860 2920 p (t-test) 2.8E4 2.5E4 0.0044 Min 1080 863 1080 863 1080 863 Max 9820 19700 9820 19700 14500 19700 n (Patient) 114 213 155 172 179 148 sCr only Median 2930 3510 2950 3560 3070 3670 Average 3290 4210 3310 4370 3460 4360 Stdev 1640 2750 1580 2920 1810 2960 p (t-test) 7.5E4 6.7E5 8.3E4 Min 1080 863 1080 863 1080 863 Max 9820 19700 9820 19700 14500 19700 n (Patient) 124 202 157 169 182 144 UO only Median 3040 4350 3100 4340 3100 4390 Average 3520 4910 3570 5040 3570 5240 Stdev 2050 3060 2050 3280 2050 3390 p (t-test) 6.0E6 1.0E5 1.8E6 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 245 80 261 64 269 56 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.61 0.65 0.61 0.61 0.64 0.57 0.59 0.66 SE 0.031 0.031 0.037 0.031 0.031 0.040 0.032 0.032 0.042 p Value 3.1E5 6.1E4 2.8E5 5.8E4 2.9E4 3.6E4 0.027 0.0057 1.3E4 nCohort Non- 114 124 245 155 157 261 179 182 269 persistent nCohort Persistent 213 202 80 172 169 64 148 144 56 Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 81% 81% 85% 81% 82% 86% 80% 80% 88% Specificity 37% 35% 28% 32% 32% 28% 29% 29% 28% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 56% 55% 66% 56% 56% 64% 55% 56% 66% Specificity 61% 58% 55% 57% 57% 53% 54% 54% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 31% 31% 39% 32% 33% 36% 30% 33% 38% Specificity 86% 85% 79% 83% 83% 77% 79% 81% 77% OR Quartile 2 2.52 2.22 2.22 2.08 2.14 2.33 1.61 1.63 2.66 p Value 4.1E4 0.0021 0.020 0.0049 0.0036 0.028 0.069 0.065 0.022 Lower limit of 1.51 1.33 1.13 1.25 1.28 1.09 0.963 0.971 1.15 95% CI Upper limit of 4.21 3.69 4.36 3.47 3.58 4.95 2.69 2.73 6.13 95% CI OR Quartile 3 2.05 1.69 2.41 1.70 1.68 2.03 1.40 1.49 2.21 p Value 0.0024 0.023 0.0011 0.018 0.020 0.014 0.13 0.075 0.0099 Lower limit of 1.29 1.08 1.42 1.10 1.08 1.15 0.903 0.961 1.21 95% CI Upper limit of 3.27 2.65 4.08 2.63 2.60 3.58 2.16 2.31 4.04 95% CI OR Quartile 4 2.75 2.50 2.41 2.23 2.50 1.92 1.68 2.04 2.05 p Value 0.0010 0.0017 0.0016 0.0027 7.0E4 0.029 0.044 0.0060 0.022 Lower limit of 1.50 1.41 1.39 1.32 1.47 1.07 1.01 1.23 1.11 95% CI Upper limit of 5.03 4.44 4.15 3.76 4.24 3.46 2.77 3.38 3.77 95% CI

TABLE-US-00133 TABLE 17.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2820 3560 2910 3720 3080 3520 Average 3120 4240 3230 4370 3450 4300 Stdev 1530 2690 1500 2860 1780 2880 p (t-test) 6.7E5 1.8E5 0.0015 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 108 219 144 183 164 163 sCr only Median 2900 3510 2950 3520 3100 3500 Average 3260 4210 3290 4340 3490 4240 Stdev 1640 2730 1590 2870 1860 2860 p (t-test) 5.8E4 9.0E5 0.0052 Min 1080 863 1080 863 1080 863 Max 9820 19700 9820 19700 14500 19700 n (Patient) 120 206 149 177 166 160 UO only Median 3030 3960 3070 3930 3080 3930 Average 3460 4760 3520 4830 3530 4930 Stdev 2020 2930 2030 3090 2020 3150 p (t-test) 5.6E6 1.5E5 5.9E6 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 225 100 241 84 248 77 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.61 0.65 0.63 0.61 0.63 0.58 0.57 0.64 SE 0.031 0.031 0.034 0.031 0.031 0.037 0.031 0.032 0.038 p Value 2.9E6 2.6E4 1.6E5 2.8E5 2.2E4 2.6E4 0.011 0.022 1.5E4 nCohort Non- 108 120 225 144 149 241 164 166 248 persistent nCohort Persistent 219 206 100 183 177 84 163 160 77 Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 82% 81% 86% 82% 82% 87% 80% 80% 88% Specificity 39% 36% 30% 34% 34% 29% 30% 30% 29% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 57% 55% 64% 57% 56% 62% 55% 54% 62% Specificity 63% 59% 56% 58% 57% 54% 54% 54% 54% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 31% 31% 36% 33% 32% 33% 31% 30% 34% Specificity 87% 85% 80% 85% 83% 78% 80% 80% 77% OR Quartile 2 2.85 2.39 2.60 2.34 2.29 2.72 1.68 1.72 3.09 p Value 7.2E5 8.2E4 0.0030 0.0011 0.0015 0.0047 0.046 0.036 0.0031 Lower limit of 1.70 1.44 1.38 1.41 1.37 1.36 1.01 1.04 1.46 95% CI Upper limit of 4.78 3.98 4.91 3.91 3.82 5.43 2.79 2.87 6.53 95% CI OR Quartile 3 2.22 1.80 2.26 1.84 1.69 1.90 1.43 1.34 1.91 p Value 9.6E4 0.012 9.9E4 0.0067 0.020 0.013 0.11 0.18 0.015 Lower limit of 1.38 1.14 1.39 1.18 1.09 1.15 0.924 0.869 1.13 95% CI Upper limit of 3.56 2.83 3.68 2.87 2.62 3.16 2.21 2.08 3.23 95% CI OR Quartile 4 3.02 2.55 2.19 2.71 2.36 1.73 1.83 1.66 1.75 p Value 5.8E4 0.0016 0.0032 3.8E4 0.0016 0.049 0.021 0.049 0.050 Lower limit of 1.61 1.43 1.30 1.56 1.38 1.00 1.10 1.00 1.00 95% CI Upper limit of 5.68 4.57 3.69 4.68 4.01 2.99 3.04 2.76 3.05 95% CI

TABLE-US-00134 TABLE 17.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2800 3540 2910 3560 3100 3490 Average 3120 4240 3230 4360 3440 4270 Stdev 1540 2680 1510 2850 1800 2840 p (t-test) 7.6E5 2.7E5 0.0021 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 107 220 142 185 158 169 sCr only Median 2870 3510 2930 3520 3100 3480 Average 3210 4230 3260 4350 3440 4270 Stdev 1540 2740 1510 2880 1790 2860 p (t-test) 2.1E4 4.0E5 0.0021 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 118 208 146 180 160 166 UO only Median 3010 3920 3100 3720 3100 3790 Average 3440 4700 3520 4690 3530 4770 Stdev 2020 2870 2020 3020 2020 3070 p (t-test) 6.4E6 6.1E5 3.1E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 216 109 230 95 237 88 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.62 0.65 0.63 0.62 0.62 0.58 0.58 0.62 SE 0.031 0.031 0.033 0.031 0.031 0.035 0.031 0.032 0.036 p Value 3.1E6 1.1E4 1.1E5 4.0E5 1.3E4 8.9E4 0.010 0.012 6.2E4 nCohort Non- 107 118 216 142 146 230 158 160 237 persistent nCohort Persistent 220 208 109 185 180 95 169 166 88 Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 82% 81% 86% 82% 82% 85% 80% 81% 86% Specificity 39% 36% 31% 35% 34% 29% 31% 31% 29% Cutoff 3280 3280 3280 3280 3280 3280 3280 3280 3280 Quartile 3 Sensitivity 56% 55% 61% 56% 56% 58% 53% 53% 58% Specificity 63% 59% 56% 58% 57% 53% 53% 53% 53% Cutoff 4720 4710 4720 4720 4710 4720 4720 4710 4720 Quartile 4 Sensitivity 31% 31% 36% 32% 32% 33% 30% 30% 33% Specificity 87% 86% 80% 85% 84% 78% 80% 80% 78% OR Quartile 2 2.91 2.48 2.76 2.43 2.41 2.38 1.85 1.90 2.60 p Value 5.3E5 4.9E4 0.0013 6.8E4 7.8E4 0.0075 0.017 0.013 0.0052 Lower limit of 1.73 1.49 1.49 1.46 1.44 1.26 1.11 1.14 1.33 95% CI Upper limit of 4.88 4.14 5.11 4.05 4.02 4.49 3.08 3.17 5.08 95% CI OR Quartile 3 2.16 1.80 1.99 1.75 1.65 1.55 1.29 1.28 1.54 p Value 0.0014 0.012 0.0040 0.013 0.026 0.074 0.25 0.27 0.088 Lower limit of 1.35 1.14 1.25 1.13 1.06 0.959 0.837 0.828 0.939 95% CI Upper limit of 3.47 2.85 3.19 2.73 2.56 2.52 2.00 1.98 2.52 95% CI OR Quartile 4 2.97 2.70 2.24 2.62 2.42 1.70 1.77 1.72 1.71 p Value 7.1E4 1.0E3 0.0021 5.9E4 0.0013 0.050 0.029 0.036 0.052 Lower limit of 1.58 1.49 1.34 1.51 1.41 1.00 1.06 1.04 0.995 95% CI Upper limit of 5.58 4.88 3.75 4.53 4.14 2.89 2.95 2.87 2.93 95% CI

TABLE-US-00135 TABLE 17.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2820 3520 2910 3560 3090 3500 Average 3130 4230 3240 4340 3440 4250 Stdev 1540 2680 1520 2840 1810 2820 p (t-test) 1.1E4 3.6E5 0.0024 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 106 221 140 187 155 172 sCr only Median 2870 3510 2930 3520 3100 3480 Average 3210 4230 3260 4340 3450 4250 Stdev 1540 2740 1520 2870 1800 2850 p (t-test) 2.1E4 5.4E5 0.0027 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 118 208 144 182 158 168 UO only Median 3010 3880 3070 3790 3070 3890 Average 3450 4610 3490 4670 3490 4740 Stdev 2040 2840 2020 2960 2020 2990 p (t-test) 2.8E5 3.5E5 1.7E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 211 114 223 102 229 96 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.63 0.62 0.62 0.62 0.58 0.58 0.63 SE 0.031 0.031 0.033 0.031 0.031 0.034 0.031 0.032 0.035 p Value 6.5E6 1.1E4 5.7E5 5.1E5 1.7E4 3.4E4 0.0094 0.014 1.7E4 nCohort Non- 106 118 211 140 144 223 155 158 229 persistent nCohort Persistent 221 208 114 187 182 102 172 168 96 Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 81% 81% 85% 82% 82% 85% 80% 80% 86% Specificity 39% 36% 30% 34% 34% 30% 31% 31% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 56% 55% 60% 56% 55% 58% 53% 53% 58% Specificity 62% 59% 55% 58% 57% 53% 54% 53% 53% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 31% 31% 34% 32% 32% 33% 30% 30% 33% Specificity 87% 86% 80% 84% 83% 78% 80% 80% 78% OR Quartile 2 2.77 2.48 2.48 2.35 2.33 2.44 1.82 1.84 2.70 p Value 1.1E4 4.9E4 0.0026 0.0010 0.0012 0.0048 0.020 0.019 0.0028 Lower limit of 1.65 1.49 1.37 1.41 1.40 1.31 1.10 1.11 1.41 95% CI Upper limit of 4.65 4.14 4.50 3.91 3.88 4.53 3.02 3.06 5.16 95% CI OR Quartile 3 2.11 1.80 1.81 1.76 1.65 1.57 1.33 1.28 1.60 p Value 0.0020 0.012 0.012 0.012 0.026 0.062 0.20 0.27 0.057 Lower limit of 1.31 1.14 1.14 1.13 1.06 0.978 0.858 0.828 0.986 95% CI Upper limit of 3.39 2.85 2.87 2.74 2.56 2.52 2.05 1.98 2.58 95% CI OR Quartile 4 2.92 2.70 2.03 2.53 2.34 1.82 1.69 1.67 1.79 p Value 8.7E4 1.0E3 0.0066 9.0E4 0.0020 0.024 0.045 0.049 0.031 Lower limit of 1.55 1.49 1.22 1.46 1.37 1.08 1.01 1.00 1.06 95% CI Upper limit of 5.49 4.88 3.39 4.39 4.00 3.07 2.81 2.78 3.03 95% CI

TABLE-US-00136 TABLE 17.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2850 3510 2920 3520 3090 3480 Average 3150 4200 3240 4310 3440 4230 Stdev 1570 2670 1540 2810 1830 2790 p (t-test) 2.7E4 8.1E5 0.0034 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 102 225 135 192 149 178 sCr only Median 2920 3500 2980 3510 3120 3450 Average 3230 4210 3270 4310 3460 4220 Stdev 1550 2730 1530 2850 1810 2830 p (t-test) 4.6E4 1.1E4 0.0048 Min 1080 863 1080 863 1080 863 Max 9100 19700 9100 19700 14500 19700 n (Patient) 115 211 140 186 154 172 UO only Median 3010 3910 3050 3860 3040 3890 Average 3430 4580 3470 4620 3470 4670 Stdev 2030 2810 2010 2900 2020 2910 p (t-test) 2.7E5 3.4E5 2.0E5 Min 893 863 893 863 893 863 Max 19700 18800 19700 18800 19700 18800 n (Patient) 204 121 214 111 219 106 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.61 0.63 0.62 0.61 0.62 0.58 0.57 0.63 SE 0.032 0.032 0.032 0.031 0.031 0.033 0.031 0.032 0.034 p Value 2.8E5 3.8E4 4.3E5 1.0E4 3.8E4 2.2E4 0.010 0.024 1.0E4 nCohort Non- 102 115 204 135 140 214 149 154 219 persistent nCohort Persistent 225 211 121 192 186 111 178 172 106 Cutoff Quartile 2 2320 2320 2330 2320 2320 2330 2320 2320 2330 Sensitivity 81% 81% 84% 82% 81% 85% 80% 80% 86% Specificity 38% 36% 30% 35% 34% 30% 32% 31% 30% Cutoff Quartile 3 3280 3280 3280 3280 3280 3280 3280 3280 3280 Sensitivity 55% 55% 60% 55% 55% 58% 53% 52% 58% Specificity 61% 58% 55% 57% 56% 54% 53% 53% 54% Cutoff Quartile 4 4720 4710 4720 4720 4710 4720 4720 4710 4720 Sensitivity 30% 31% 34% 31% 31% 33% 29% 29% 33% Specificity 86% 85% 80% 84% 83% 79% 80% 79% 79% OR Quartile 2 2.62 2.30 2.34 2.40 2.18 2.36 1.88 1.72 2.62 p Value 2.8E4 0.0014 0.0036 7.8E4 0.0026 0.0046 0.014 0.036 0.0023 Lower limit of 1.56 1.38 1.32 1.44 1.31 1.30 1.14 1.04 1.41 95% CI Upper limit of 4.41 3.83 4.16 3.99 3.62 4.27 3.12 2.85 4.85 95% CI OR Quartile 3 1.90 1.67 1.82 1.64 1.57 1.58 1.26 1.22 1.65 p Value 0.0081 0.028 0.0097 0.030 0.044 0.052 0.29 0.37 0.037 Lower limit of 1.18 1.06 1.16 1.05 1.01 0.996 0.817 0.788 1.03 95% CI Upper limit of 3.06 2.65 2.88 2.55 2.45 2.51 1.95 1.88 2.63 95% CI OR Quartile 4 2.72 2.57 2.04 2.33 2.19 1.88 1.64 1.56 1.80 p Value 0.0019 0.0018 0.0061 0.0025 0.0043 0.016 0.060 0.086 0.025 Lower limit of 1.45 1.42 1.22 1.35 1.28 1.12 0.979 0.938 1.08 95% CI Upper limit of 5.12 4.64 3.39 4.04 3.75 3.14 2.74 2.60 3.03 95% CI

Example 18. Use of CC Motif Chemokine 15 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0172] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 15 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0173] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0174] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00137 TABLE 18.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.0 289 10.3 274 0.0534 237 Average 144 2060 118 1990 120 1950 Stdev 265 6000 245 5890 260 5840 p (t-test) 0.017 0.032 0.046 Min 0.0116 0.0116 0.0187 0.0116 0.0187 0.0116 Max 1160 53500 1160 53500 1160 53500 n (Patient) 57 259 46 270 41 275 sCr only Median 7.54 338 7.54 338 7.54 316 Average 169 2210 173 2190 180 2160 Stdev 314 6230 317 6200 325 6160 p (t-test) 0.0046 0.0054 0.0076 Min 0.0116 0.0116 0.0116 0.0116 0.0187 0.0116 Max 1300 53500 1300 53500 1300 53500 n (Patient) 76 239 74 241 70 245 UO only Median 118 248 104 275 103 237 Average 1880 1470 1750 1690 1460 1980 Stdev 6590 3060 6510 3970 5360 5640 p (t-test) 0.53 0.92 0.41 Min 0.0116 0.0116 0.0187 0.0116 0.0187 0.0116 Max 53500 19200 53500 30000 52500 53500 n (Patient) 193 121 172 142 155 159 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.72 0.55 0.71 0.71 0.56 0.72 0.70 0.57 SE 0.035 0.031 0.034 0.036 0.031 0.033 0.037 0.032 0.032 p Value 1.4E8 2.1E12 0.12 6.7E9 1.9E11 0.076 1.4E9 3.8E10 0.043 nCohort Recovered 57 76 193 46 74 172 41 70 155 nCohort Non- 259 239 121 270 241 142 275 245 159 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 79% 82% 79% 79% 81% 78% 79% 81% 79% Specificity 35% 39% 25% 37% 39% 24% 41% 39% 26% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 56% 59% 55% 56% 58% 56% 55% 57% 55% Specificity 77% 76% 53% 83% 76% 55% 80% 74% 55% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 30% 31% 29% 29% 31% 28% 28% 31% 28% Specificity 96% 95% 77% 96% 95% 77% 95% 94% 78% OR Quartile 2 2.05 2.89 1.27 2.19 2.81 1.16 2.71 2.65 1.33 p Value 0.023 2.3E4 0.39 0.021 3.7E4 0.59 0.0044 9.5E4 0.29 Lower limit of 1.10 1.64 0.735 1.13 1.59 0.682 1.36 1.49 0.785 95% CI Upper limit of 3.82 5.08 2.20 4.26 4.95 1.96 5.38 4.71 2.25 95% CI OR Quartile 3 4.30 4.56 1.42 5.94 4.31 1.59 4.95 3.85 1.54 p Value 1.7E5 4.3E7 0.13 1.3E5 1.2E6 0.042 1.0E4 8.2E6 0.055 Lower limit of 2.21 2.53 0.899 2.67 2.39 1.02 2.21 2.13 0.990 95% CI Upper limit of 8.38 8.20 2.24 13.2 7.78 2.49 11.1 6.97 2.41 95% CI OR Quartile 4 11.6 8.23 1.38 8.78 7.91 1.34 7.58 7.28 1.40 p Value 8.1E4 7.5E5 0.22 0.0031 1.0E4 0.26 0.0060 2.0E4 0.19 Lower limit of 2.77 2.90 0.822 2.08 2.78 0.802 1.79 2.56 0.841 95% CI Upper limit of 48.9 23.4 2.31 37.1 22.5 2.23 32.2 20.7 2.35 95% CI

TABLE-US-00138 TABLE 18.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.1 373 18.3 355 9.44 346 Average 185 2330 176 2230 161 2170 Stdev 476 6380 492 6250 472 6150 p (t-test) 0.0016 0.0038 0.0065 Min 0.0116 0.0116 0.0187 0.0116 0.0187 0.0116 Max 3630 53500 3630 53500 3630 53500 n (Patient) 90 226 79 237 71 245 sCr only Median 18.3 403 18.3 394 18.3 373 Average 204 2480 208 2460 196 2410 Stdev 473 6590 477 6570 455 6500 p (t-test) 4.5E4 5.7E4 8.1E4 Min 0.0116 0.0116 0.0116 0.0116 0.0187 0.0116 Max 3630 53500 3630 53500 3630 53500 n (Patient) 106 210 104 212 99 217 UO only Median 115 338 115 248 115 222 Average 1880 1410 2010 1260 1750 1690 Stdev 6360 3070 6630 2860 5640 5330 p (t-test) 0.48 0.24 0.93 Min 0.0116 0.0116 0.0151 0.0116 0.0151 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 211 103 193 121 177 137 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or SCr UO sCr or SCr UO UO only only UO only only UO only only AUC 0.72 0.73 0.55 0.73 0.73 0.53 0.73 0.73 0.54 SE 0.029 0.028 0.035 0.030 0.028 0.034 0.030 0.029 0.033 p Value 3.0E14 0 0.18 3.1E14 6.7E16 0.33 8.2E15 3.1E15 0.23 nCohort Recovered 90 106 211 79 104 193 71 99 177 nCohort Non- 226 210 103 237 212 121 245 217 137 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 81% 84% 79% 81% 83% 78% 82% 83% 79% Specificity 36% 38% 24% 38% 38% 24% 41% 37% 25% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 61% 63% 57% 60% 62% 56% 58% 61% 55% Specificity 78% 75% 54% 80% 75% 54% 79% 75% 54% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 33% 35% 28% 32% 34% 26% 31% 34% 26% Specificity 96% 94% 76% 95% 94% 75% 96% 95% 76% OR Quartile 2 2.42 3.14 1.17 2.69 3.03 1.09 3.07 2.90 1.23 p Value 0.0015 3.1E5 0.58 5.5E4 5.2E5 0.76 1.3E4 1.1E4 0.44 Lower limit of 1.40 1.83 0.666 1.53 1.77 0.634 1.73 1.69 0.723 95% CI Upper limit of 4.17 5.37 2.07 4.70 5.19 1.87 5.44 4.98 2.10 95% CI OR Quartile 3 5.49 5.21 1.55 5.89 4.95 1.50 5.23 4.69 1.40 p Value 3.3E9 6.5E10 0.072 1.0E8 2.1E9 0.083 2.0E7 1.1E8 0.14 Lower limit of 3.12 3.08 0.962 3.21 2.93 0.949 2.80 2.76 0.896 95% CI Upper limit of 9.65 8.79 2.49 10.8 8.36 2.37 9.77 7.96 2.19 95% CI OR Quartile 4 10.7 8.88 1.26 8.68 8.58 1.04 10.2 9.73 1.11 p Value 8.1E6 9.0E7 0.39 4.8E5 1.3E6 0.88 1.3E4 2.2E6 0.69 Lower limit of 3.77 3.72 0.740 3.06 3.59 0.617 3.11 3.79 0.665 95% CI Upper limit of 30.2 21.2 2.15 24.6 20.5 1.75 33.4 25.0 1.85 95% CI

TABLE-US-00139 TABLE 18.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 39.4 403 39.5 355 13.4 347 Average 365 2480 383 2400 386 2310 Stdev 1110 6700 1140 6600 1180 6460 p (t-test) 9.4E4 0.0019 0.0040 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 7940 53500 7940 53500 7940 53500 n (Patient) 114 202 107 209 97 219 sCr only Median 36.6 423 39.4 403 36.6 366 Average 365 2620 373 2580 370 2530 Stdev 1060 6900 1070 6850 1080 6770 p (t-test) 3.0E4 4.3E4 6.4E4 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 7940 53500 7940 53500 7940 53500 n (Patient) 127 189 124 192 119 197 UO only Median 118 338 118 237 115 222 Average 1870 1420 1950 1310 1740 1700 Stdev 6330 3100 6480 2970 5520 5490 p (t-test) 0.50 0.33 0.95 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 213 101 203 111 189 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.72 0.56 0.70 0.71 0.54 0.71 0.71 0.55 SE 0.029 0.028 0.035 0.030 0.029 0.034 0.030 0.029 0.033 p Value 8.5E13 2.1E14 0.10 1.4E11 1.1E12 0.19 4.2E12 1.2E12 0.15 nCohort Recovered 114 127 213 107 124 203 97 119 189 nCohort Non- 202 189 101 209 192 111 219 197 125 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 83% 85% 80% 83% 84% 80% 83% 84% 81% Specificity 34% 35% 25% 36% 35% 25% 38% 35% 26% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 62% 64% 57% 61% 63% 56% 60% 62% 55% Specificity 72% 71% 54% 72% 70% 53% 72% 70% 53% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 35% 36% 29% 33% 35% 26% 32% 35% 26% Specificity 92% 91% 77% 92% 91% 75% 92% 92% 76% OR Quartile 2 2.48 3.03 1.34 2.65 2.76 1.36 3.03 2.81 1.47 p Value 8.0E4 5.3E5 0.32 3.6E4 1.9E4 0.29 5.8E5 1.5E4 0.17 Lower limit of 1.46 1.77 0.751 1.55 1.62 0.772 1.77 1.65 0.849 95% CI Upper limit of 4.22 5.18 2.40 4.52 4.70 2.39 5.21 4.80 2.56 95% CI OR Quartile 3 4.25 4.33 1.55 4.06 4.01 1.44 3.86 3.75 1.41 p Value 1.2E8 3.1E9 0.071 5.6E8 1.8E8 0.13 3.5E7 9.5E8 0.13 Lower limit of 2.58 2.67 0.963 2.45 2.47 0.903 2.30 2.31 0.898 95% CI Upper limit of 6.99 7.03 2.50 6.72 6.50 2.29 6.49 6.09 2.23 95% CI OR Quartile 4 6.19 5.93 1.31 5.48 5.63 1.08 5.34 5.88 1.12 p Value 1.4E6 3.7E7 0.32 6.7E6 7.9E7 0.77 2.4E5 1.0E6 0.68 Lower limit of 2.95 2.98 0.769 2.61 2.84 0.637 2.45 2.89 0.664 95% CI Upper limit of 13.0 11.8 2.24 11.5 11.2 1.84 11.6 12.0 1.87 95% CI

TABLE-US-00140 TABLE 18.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 40.2 420 48.0 355 39.4 351 Average 430 2660 455 2540 464 2420 Stdev 1260 7000 1300 6860 1350 6690 p (t-test) 3.1E4 8.7E4 0.0022 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 8690 53500 8690 53500 8690 53500 n (Patient) 134 182 125 191 114 202 sCr only Median 40.2 436 44.1 420 40.2 406 Average 425 2740 431 2710 426 2680 Stdev 1240 7110 1250 7070 1250 7020 p (t-test) 1.7E4 2.2E4 2.7E4 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 8690 53500 8690 53500 8690 53500 n (Patient) 140 176 138 178 135 181 UO only Median 118 248 123 223 118 222 Average 1860 1430 1930 1320 1720 1730 Stdev 6300 3130 6430 3010 5470 5580 p (t-test) 0.52 0.35 0.98 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 215 99 206 108 193 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.71 0.55 0.69 0.70 0.54 0.69 0.70 0.54 SE 0.029 0.029 0.035 0.030 0.029 0.034 0.030 0.029 0.034 p Value 2.3E12 2.8E13 0.13 2.5E10 6.1E12 0.25 2.2E10 7.9E12 0.19 nCohort Recovered 134 140 215 125 138 206 114 135 193 nCohort Non- 182 176 99 191 178 108 202 181 121 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 85% 81% 83% 84% 81% 84% 83% 81% Specificity 33% 34% 25% 34% 33% 25% 36% 33% 26% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 64% 65% 58% 62% 64% 56% 61% 64% 55% Specificity 69% 69% 53% 69% 68% 53% 69% 68% 53% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 37% 38% 28% 35% 37% 26% 34% 37% 26% Specificity 91% 91% 76% 90% 91% 75% 90% 91% 76% OR Quartile 2 2.48 2.79 1.41 2.51 2.49 1.40 2.88 2.43 1.49 p Value 8.4E4 1.9E4 0.25 6.7E4 8.3E4 0.25 1.1E4 0.0010 0.16 Lower limit of 1.45 1.63 0.785 1.48 1.46 0.790 1.69 1.43 0.854 95% CI Upper limit of 4.22 4.78 2.54 4.28 4.24 2.48 4.91 4.14 2.60 95% CI OR Quartile 3 4.08 4.01 1.56 3.64 3.81 1.40 3.51 3.73 1.42 p Value 7.1E9 8.1E9 0.069 1.2E7 2.7E8 0.15 4.5E7 4.6E8 0.13 Lower limit of 2.54 2.50 0.965 2.26 2.38 0.880 2.16 2.33 0.899 95% CI Upper limit of 6.57 6.43 2.52 5.88 6.10 2.24 5.73 5.98 2.24 95% CI OR Quartile 4 5.92 5.86 1.27 5.09 5.67 1.06 4.75 6.02 1.12 p Value 1.6E7 8.5E8 0.39 1.6E6 1.5E7 0.82 8.7E6 1.2E7 0.68 Lower limit of 3.05 3.07 0.740 2.62 2.97 0.624 2.39 3.10 0.663 95% CI Upper limit of 11.5 11.2 2.17 9.90 10.8 1.81 9.44 11.7 1.88 95% CI

TABLE-US-00141 TABLE 18.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 72.4 406 72.6 351 72.6 351 Average 1650 1810 1680 1770 1680 1770 Stdev 6260 4140 6300 4100 6300 4100 p (t-test) 0.80 0.88 0.88 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 34200 53500 34200 53500 34200 n (Patient) 187 129 184 132 184 132 sCr only Median 53.2 531 54.2 492 55.3 488 Average 638 2810 648 2760 652 2740 Stdev 2630 7160 2660 7110 2670 7090 p (t-test) 3.9E4 5.8E4 6.6E4 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 30000 53500 30000 53500 30000 53500 n (Patient) 159 157 156 160 155 161 UO only Median 116 300 118 248 116 242 Average 1840 1490 1860 1450 1880 1430 Stdev 6370 3110 6410 3070 6450 3030 p (t-test) 0.60 0.53 0.49 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 210 104 207 107 204 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.70 0.57 0.63 0.69 0.56 0.63 0.69 0.57 SE 0.032 0.029 0.035 0.032 0.029 0.035 0.032 0.030 0.034 p Value 3.1E5 3.6E12 0.038 7.9E5 4.5E11 0.068 7.9E5 1.3E10 0.054 nCohort Recovered 187 159 210 184 156 207 184 155 204 nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 85% 85% 82% 85% 84% 81% 85% 84% 82% Specificity 29% 32% 26% 29% 31% 26% 29% 31% 26% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 64% 66% 60% 64% 66% 58% 64% 65% 58% Specificity 60% 66% 55% 60% 66% 54% 60% 66% 54% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 34% 39% 31% 33% 38% 30% 33% 38% 30% Specificity 81% 89% 78% 81% 88% 77% 81% 88% 77% OR Quartile 2 2.41 2.75 1.55 2.33 2.47 1.50 2.33 2.33 1.58 p Value 0.0029 3.4E4 0.14 0.0038 0.0011 0.17 0.0038 0.0022 0.12 Lower limit of 1.35 1.58 0.862 1.31 1.43 0.840 1.31 1.36 0.887 95% CI Upper limit of 4.31 4.79 2.78 4.12 4.26 2.67 4.12 4.00 2.81 95% CI OR Quartile 3 2.69 3.82 1.79 2.60 3.71 1.62 2.60 3.61 1.66 p Value 2.8E5 1.8E8 0.017 4.8E5 3.3E8 0.044 4.8E5 5.9E8 0.034 Lower limit of 1.69 2.39 1.11 1.64 2.33 1.01 1.64 2.27 1.04 95% CI Upper limit of 4.29 6.08 2.88 4.13 5.91 2.60 4.13 5.74 2.65 95% CI OR Quartile 4 2.25 4.98 1.54 2.13 4.72 1.45 2.13 4.64 1.47 p Value 0.0021 8.1E8 0.11 0.0041 2.0E7 0.16 0.0041 2.8E7 0.15 Lower limit of 1.34 2.77 0.909 1.27 2.63 0.858 1.27 2.59 0.872 95% CI Upper limit of 3.77 8.95 2.61 3.57 8.49 2.46 3.57 8.34 2.48 95% CI

TABLE-US-00142 TABLE 18.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 2350 4630 2350 4520 2350 4520 Average 2780 5040 2970 4940 2740 4940 Stdev 2070 3020 2160 3030 1870 3030 p (t-test) 4.6E4 0.0047 0.0024 Min 62.8 413 62.8 276 62.8 276 Max 8250 21200 8250 21200 8050 21200 n (Patient) 25 126 21 130 19 132 sCr only Median 3060 4590 3080 4560 3240 4520 Average 3540 4950 3570 4930 3720 4870 Stdev 2350 3090 2390 3080 2410 3090 p (t-test) 0.023 0.031 0.076 Min 842 62.8 842 62.8 842 62.8 Max 10700 21200 10700 21200 10700 21200 n (Patient) 29 121 28 122 26 124 UO only Median 4050 4670 3990 4570 3790 4710 Average 4550 4910 4490 4940 4200 5210 Stdev 2870 3190 2730 3300 2440 3430 p (t-test) 0.47 0.37 0.040 Min 62.8 513 62.8 276 62.8 276 Max 13800 21200 13800 21200 11800 21200 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.76 0.66 0.54 0.73 0.65 0.54 0.75 0.63 0.59 SE 0.045 0.052 0.048 0.052 0.053 0.048 0.051 0.056 0.047 p Value 7.1E9 0.0020 0.41 1.3E5 0.0037 0.41 7.7E7 0.022 0.064 nCohort Recovered 25 29 91 21 28 84 19 26 77 nCohort Non- 126 121 59 130 122 66 132 124 73 recovered Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 81% 79% 80% 79% 78% 77% 79% 77% 79% Specificity 56% 41% 29% 52% 39% 27% 53% 35% 30% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 56% 54% 56% 56% 55% 56% 55% 58% Specificity 88% 76% 53% 86% 75% 54% 89% 73% 57% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 29% 29% 20% 28% 29% 23% 28% 28% 26% Specificity 92% 90% 71% 90% 89% 73% 95% 88% 75% OR Quartile 2 5.41 2.58 1.57 4.20 2.28 1.28 4.13 1.73 1.65 p Value 2.6E4 0.030 0.26 0.0033 0.064 0.52 0.0051 0.23 0.19 Lower limit of 2.19 1.09 0.718 1.61 0.953 0.606 1.53 0.699 0.779 95% CI Upper limit of 13.4 6.08 3.42 10.9 5.44 2.71 11.1 4.30 3.48 95% CI OR Quartile 3 10.1 4.03 1.32 7.68 3.78 1.38 10.8 3.30 1.81 p Value 3.1E4 0.0031 0.40 0.0017 0.0050 0.32 0.0019 0.013 0.073 Lower limit of 2.87 1.60 0.686 2.16 1.49 0.725 2.41 1.29 0.946 95% CI Upper limit of 35.5 10.2 2.55 27.4 9.55 2.64 48.8 8.40 3.45 95% CI OR Quartile 4 4.60 3.53 0.638 3.64 3.35 0.780 7.01 3.01 1.07 p Value 0.046 0.050 0.26 0.093 0.060 0.52 0.063 0.087 0.85 Lower limit of 1.03 1.00 0.293 0.806 0.951 0.369 0.903 0.851 0.514 95% CI Upper limit of 20.5 12.4 1.39 16.4 11.8 1.65 54.4 10.7 2.24 95% CI

TABLE-US-00143 TABLE 18.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3060 4710 3080 4670 3080 4590 Average 3490 5090 3580 5010 3480 4990 Stdev 2270 3120 2360 3100 2330 3080 p (t-test) 0.0035 0.012 0.011 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 40 111 36 115 32 119 sCr only Median 3500 4700 3620 4680 3800 4530 Average 3860 5000 3890 4980 4030 4900 Stdev 2390 3160 2410 3160 2440 3150 p (t-test) 0.034 0.043 0.12 Min 842 62.8 842 62.8 842 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 44 107 43 108 40 111 UO only Median 4090 4690 4060 4670 3920 4710 Average 4590 4890 4520 4970 4260 5250 Stdev 2740 3460 2660 3480 2400 3570 p (t-test) 0.56 0.38 0.045 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 11800 21200 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.62 0.52 0.66 0.62 0.53 0.67 0.59 0.58 SE 0.046 0.048 0.050 0.049 0.049 0.049 0.050 0.051 0.047 p Value 1.3E4 0.010 0.66 0.0014 0.016 0.54 8.8E4 0.079 0.10 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non- 111 107 50 115 108 57 119 111 65 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 78% 77% 74% 77% 76% 74% 77% 75% 77% Specificity 35% 30% 25% 33% 28% 25% 34% 25% 27% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 59% 58% 56% 57% 57% 56% 57% 56% 58% Specificity 75% 68% 53% 72% 67% 54% 75% 65% 56% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 31% 31% 24% 30% 31% 25% 29% 30% 28% Specificity 90% 89% 74% 89% 88% 74% 91% 88% 76% OR Quartile 2 1.95 1.38 0.949 1.71 1.22 0.920 1.78 0.988 1.24 p Value 0.098 0.43 0.89 0.20 0.62 0.83 0.18 0.98 0.58 Lower limit of 0.885 0.626 0.436 0.754 0.549 0.433 0.766 0.429 0.584 95% CI Upper limit of 4.31 3.02 2.06 3.88 2.71 1.96 4.16 2.28 2.62 95% CI OR Quartile 3 4.40 2.95 1.44 3.50 2.79 1.49 4.00 2.35 1.83 p Value 3.4E4 0.0042 0.30 0.0027 0.0068 0.24 0.0020 0.026 0.071 Lower limit of 1.96 1.41 0.725 1.55 1.33 0.767 1.66 1.11 0.950 95% CI Upper limit of 9.89 6.20 2.84 7.93 5.87 2.89 9.63 4.97 3.51 95% CI OR Quartile 4 3.97 3.48 0.899 3.36 3.34 0.936 4.03 2.96 1.24 p Value 0.015 0.016 0.79 0.033 0.020 0.86 0.029 0.037 0.56 Lower limit of 1.31 1.26 0.409 1.10 1.21 0.437 1.15 1.07 0.594 95% CI Upper limit of 12.0 9.62 1.98 10.2 9.26 2.00 14.1 8.23 2.61 95% CI

TABLE-US-00144 TABLE 18.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3500 4670 3500 4530 3500 4530 Average 3980 5010 3930 4990 3900 4940 Stdev 2670 3100 2540 3130 2570 3100 p (t-test) 0.047 0.046 0.059 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 50 101 46 105 40 111 sCr only Median 3860 4530 3930 4500 3940 4480 Average 4130 4960 4230 4900 4350 4820 Stdev 2520 3210 2520 3210 2530 3200 p (t-test) 0.10 0.19 0.38 Min 703 62.8 842 62.8 842 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 54 97 52 99 49 102 UO only Median 3930 4790 3930 4790 3770 4790 Average 4450 5150 4410 5160 4270 5250 Stdev 2680 3490 2640 3480 2590 3400 p (t-test) 0.17 0.14 0.048 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 13800 21200 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.62 0.58 0.56 0.61 0.56 0.57 0.61 0.54 0.59 SE 0.047 0.048 0.050 0.048 0.048 0.049 0.050 0.050 0.047 p Value 0.013 0.078 0.19 0.020 0.19 0.16 0.023 0.45 0.045 nCohort Recovered 50 54 98 46 52 94 40 49 86 nCohort Non- 101 97 52 105 99 56 111 102 64 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 78% 76% 75% 77% 75% 75% 77% 74% 78% Specificity 32% 28% 26% 30% 25% 26% 30% 22% 28% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 58% 57% 62% 57% 56% 61% 57% 54% 61% Specificity 66% 61% 56% 65% 60% 56% 68% 57% 58% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 29% 30% 27% 29% 29% 27% 28% 28% 28% Specificity 82% 83% 76% 83% 83% 76% 82% 82% 77% OR Quartile 2 1.69 1.24 1.03 1.48 0.987 1.03 1.40 0.804 1.38 p Value 0.18 0.58 0.95 0.32 0.97 0.94 0.41 0.59 0.40 Lower limit of 0.791 0.580 0.473 0.680 0.455 0.480 0.626 0.360 0.648 95% CI Upper limit of 3.61 2.64 2.23 3.21 2.14 2.20 3.14 1.79 2.95 95% CI OR Quartile 3 2.73 2.06 2.05 2.50 1.85 2.00 2.73 1.56 2.17 p Value 0.0054 0.037 0.041 0.013 0.078 0.044 0.0098 0.20 0.022 Lower limit of 1.35 1.04 1.03 1.22 0.934 1.02 1.27 0.785 1.12 95% CI Upper limit of 5.53 4.06 4.07 5.13 3.65 3.92 5.83 3.10 4.19 95% CI OR Quartile 4 1.83 2.13 1.14 1.90 1.98 1.13 1.83 1.77 1.29 p Value 0.16 0.076 0.74 0.15 0.11 0.75 0.20 0.19 0.50 Lower limit of 0.792 0.923 0.528 0.794 0.856 0.530 0.732 0.761 0.616 95% CI Upper limit of 4.25 4.93 2.44 4.54 4.58 2.40 4.56 4.10 2.71 95% CI

TABLE-US-00145 TABLE 18.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3650 4700 3620 4600 3540 4630 Average 4130 5000 4100 4970 3970 4980 Stdev 2690 3140 2620 3150 2610 3120 p (t-test) 0.084 0.087 0.053 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 58 93 53 98 47 104 sCr only Median 3860 4530 3920 4520 3930 4490 Average 4250 4940 4310 4890 4390 4830 Stdev 2600 3220 2580 3230 2590 3220 p (t-test) 0.17 0.25 0.38 Min 703 62.8 842 62.8 842 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 60 91 59 92 57 94 UO only Median 3930 4820 3920 4790 3770 4790 Average 4430 5150 4400 5150 4270 5250 Stdev 2710 3420 2660 3420 2590 3400 p (t-test) 0.16 0.14 0.048 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 13800 21200 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.60 0.57 0.57 0.59 0.56 0.57 0.61 0.54 0.60 SE 0.047 0.047 0.049 0.047 0.048 0.048 0.048 0.048 0.047 p Value 0.034 0.14 0.13 0.048 0.22 0.14 0.017 0.39 0.044 nCohort Recovered 58 60 96 53 59 92 47 57 86 nCohort Non- 93 91 54 98 92 58 104 94 64 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 78% 77% 76% 78% 76% 76% 78% 76% 78% Specificity 31% 28% 26% 30% 27% 26% 32% 26% 28% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 59% 57% 61% 58% 57% 60% 59% 55% 61% Specificity 64% 60% 56% 64% 59% 57% 68% 58% 58% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 28% 29% 26% 28% 28% 26% 28% 28% 28% Specificity 79% 80% 75% 79% 80% 75% 81% 79% 77% OR Quartile 2 1.64 1.32 1.11 1.49 1.18 1.11 1.65 1.10 1.38 p Value 0.19 0.47 0.79 0.30 0.66 0.79 0.20 0.80 0.40 Lower limit of 0.780 0.626 0.513 0.703 0.561 0.519 0.765 0.519 0.648 95% CI Upper limit of 3.46 2.77 2.40 3.18 2.50 2.37 3.56 2.34 2.95 95% CI OR Quartile 3 2.55 2.00 2.02 2.49 1.90 1.98 3.03 1.70 2.17 p Value 0.0067 0.040 0.043 0.0096 0.059 0.045 0.0028 0.12 0.022 Lower limit of 1.30 1.03 1.02 1.25 0.977 1.01 1.46 0.876 1.12 95% CI Upper limit of 5.02 3.88 3.99 4.96 3.68 3.86 6.26 3.31 4.19 95% CI OR Quartile 4 1.49 1.60 1.05 1.45 1.54 1.05 1.63 1.43 1.29 p Value 0.32 0.24 0.90 0.36 0.28 0.91 0.25 0.37 0.50 Lower limit of 0.682 0.734 0.489 0.654 0.708 0.492 0.702 0.657 0.616 95% CI Upper limit of 3.25 3.49 2.25 3.23 3.36 2.22 3.80 3.13 2.71 95% CI

TABLE-US-00146 TABLE 18.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 4170 4480 4150 4470 4150 4470 Average 4620 4720 4620 4720 4620 4720 Stdev 2740 3290 2760 3260 2760 3260 p (t-test) 0.83 0.84 0.84 Min 703 62.8 703 62.8 703 62.8 Max 13800 21200 13800 21200 13800 21200 n (Patient) 81 70 80 71 80 71 sCr only Median 3920 4520 3920 4520 3920 4520 Average 4320 4940 4360 4890 4360 4890 Stdev 2570 3290 2570 3280 2570 3280 p (t-test) 0.21 0.28 0.28 Min 703 62.8 842 62.8 842 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 67 84 65 86 65 86 UO only Median 3940 4710 3940 4670 3940 4670 Average 4530 4970 4570 4890 4560 4900 Stdev 2690 3460 2690 3440 2720 3390 p (t-test) 0.39 0.52 0.49 Min 413 62.8 413 62.8 413 62.8 Max 13800 21200 13800 21200 13800 21200 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.50 0.56 0.54 0.51 0.55 0.53 0.51 0.55 0.53 SE 0.047 0.047 0.049 0.047 0.047 0.049 0.047 0.047 0.049 p Value 0.92 0.23 0.44 0.91 0.31 0.59 0.91 0.31 0.52 nCohort Recovered 81 67 95 80 65 93 80 65 91 nCohort Non- 70 84 55 71 86 57 71 86 59 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 73% 77% 75% 73% 77% 74% 73% 77% 75% Specificity 23% 28% 25% 24% 28% 25% 24% 28% 25% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 53% 57% 56% 54% 57% 56% 54% 57% 56% Specificity 52% 58% 54% 52% 58% 54% 52% 58% 54% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 24% 26% 24% 24% 26% 23% 24% 26% 24% Specificity 74% 76% 74% 74% 75% 73% 74% 75% 74% OR Quartile 2 0.823 1.35 0.990 0.852 1.26 0.920 0.852 1.26 0.992 p Value 0.60 0.42 0.98 0.67 0.53 0.83 0.67 0.53 0.98 Lower limit of 0.394 0.648 0.462 0.408 0.604 0.433 0.408 0.604 0.467 95% CI Upper limit of 1.72 2.83 2.12 1.78 2.65 1.96 1.78 2.65 2.11 95% CI OR Quartile 3 1.21 1.86 1.50 1.27 1.86 1.49 1.27 1.86 1.48 p Value 0.56 0.062 0.24 0.46 0.061 0.24 0.46 0.061 0.24 Lower limit of 0.636 0.970 0.767 0.671 0.971 0.767 0.671 0.971 0.766 95% CI Upper limit of 2.29 3.56 2.92 2.41 3.58 2.89 2.41 3.58 2.86 95% CI OR Quartile 4 0.916 1.13 0.867 0.884 1.05 0.804 0.884 1.05 0.869 p Value 0.82 0.75 0.72 0.74 0.89 0.58 0.74 0.89 0.72 Lower limit of 0.438 0.538 0.401 0.423 0.500 0.372 0.423 0.500 0.406 95% CI Upper limit of 1.92 2.38 1.87 1.85 2.21 1.74 1.85 2.21 1.86 95% CI

Example 19. Use of CC Motif Chemokine 15 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0175] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 15 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0176] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0177] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00147 TABLE 19.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.1 401 36.6 366 37.9 363 Average 820 2170 852 2130 869 2110 Stdev 4380 5930 4460 5880 4530 5840 p (t-test) 0.038 0.051 0.062 Min 0.0116 0.0116 0.0187 0.0116 0.0187 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 107 209 103 213 100 216 sCr only Median 22.1 414 22.1 403 24.3 401 Average 754 2360 765 2330 771 2320 Stdev 4060 6190 4090 6160 4110 6150 p (t-test) 0.011 0.013 0.015 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 125 190 123 192 122 193 UO only Median 110 347 115 341 118 261 Average 1780 1580 1880 1420 1670 1810 Stdev 6210 3290 6400 3100 5420 5670 p (t-test) 0.77 0.49 0.83 Min 0.0116 0.0116 0.0187 0.0116 0.0187 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 221 93 207 107 197 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.72 0.57 0.70 0.72 0.55 0.70 0.72 0.55 SE 0.029 0.028 0.036 0.030 0.028 0.035 0.030 0.028 0.034 p Value 1.2E14 1.1E15 0.038 5.3E12 2.7E15 0.13 1.5E11 1.5E14 0.17 nCohort Recovered 107 125 221 103 123 207 100 122 197 nCohort Non- 209 190 93 213 192 107 216 193 117 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 83% 85% 81% 82% 85% 79% 82% 84% 78% Specificity 36% 36% 25% 35% 37% 24% 35% 36% 24% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 63% 65% 60% 62% 65% 58% 61% 64% 56% Specificity 75% 72% 54% 74% 72% 54% 74% 72% 54% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 34% 36% 30% 33% 36% 27% 33% 36% 28% Specificity 93% 92% 77% 92% 92% 76% 92% 92% 77% OR Quartile 2 2.85 3.12 1.38 2.47 3.24 1.16 2.44 3.06 1.10 p Value 1.3E4 3.4E5 0.29 9.2E4 1.9E5 0.60 0.0011 4.3E5 0.74 Lower limit of 1.67 1.82 0.759 1.45 1.89 0.664 1.43 1.79 0.636 95% CI Upper limit of 4.87 5.35 2.51 4.23 5.56 2.04 4.18 5.24 1.89 95% CI OR Quartile 3 4.98 4.72 1.80 4.50 4.77 1.62 4.47 4.65 1.51 p Value 1.3E9 5.8E10 0.020 1.3E8 5.4E10 0.044 2.1E8 1.0E9 0.081 Lower limit of 2.96 2.89 1.10 2.68 2.91 1.01 2.65 2.84 0.951 95% CI Upper limit of 8.36 7.71 2.94 7.55 7.82 2.60 7.55 7.62 2.39 95% CI OR Quartile 4 6.37 6.56 1.44 5.94 6.34 1.17 5.63 6.23 1.29 p Value 2.9E6 2.1E7 0.19 6.8E6 3.5E7 0.57 1.3E5 4.5E7 0.34 Lower limit of 2.93 3.22 0.835 2.73 3.11 0.686 2.59 3.06 0.766 95% CI Upper limit of 13.8 13.3 2.47 12.9 12.9 1.99 12.2 12.7 2.17 95% CI

TABLE-US-00148 TABLE 19.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 48.0 434 49.4 434 53.2 423 Average 874 2340 888 2320 908 2270 Stdev 4000 6310 4030 6280 4090 6220 p (t-test) 0.018 0.022 0.029 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 135 181 133 183 129 187 sCr only Median 48.7 436 49.4 434 51.3 434 Average 836 2490 841 2480 847 2460 Stdev 3820 6530 3840 6510 3850 6490 p (t-test) 0.0072 0.0080 0.0089 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 148 168 147 169 146 170 UO only Median 106 354 110 347 113 300 Average 1780 1580 1820 1500 1650 1850 Stdev 6170 3270 6250 3180 5320 5850 p (t-test) 0.78 0.63 0.76 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 225 89 219 95 206 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.58 0.69 0.70 0.57 0.68 0.69 0.55 SE 0.029 0.029 0.036 0.029 0.029 0.036 0.030 0.029 0.034 p Value 1.4E11 3.5E12 0.021 1.3E10 8.5E12 0.051 1.1E9 3.3E11 0.12 nCohort Recovered 135 148 225 133 147 219 129 146 206 nCohort Non- 181 168 89 183 169 95 187 170 108 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 86% 81% 84% 86% 80% 83% 85% 79% Specificity 33% 34% 25% 33% 34% 25% 33% 34% 24% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 64% 65% 62% 63% 64% 60% 63% 64% 57% Specificity 69% 67% 55% 68% 67% 54% 68% 66% 54% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 35% 37% 30% 35% 37% 28% 34% 36% 28% Specificity 89% 89% 77% 89% 88% 76% 88% 88% 76% OR Quartile 2 2.62 3.06 1.40 2.52 3.11 1.31 2.34 2.93 1.18 p Value 4.1E4 6.7E5 0.28 6.7E4 5.2E5 0.37 0.0017 1.1E4 0.55 Lower limit of 1.54 1.77 0.763 1.48 1.80 0.726 1.38 1.70 0.677 95% CI Upper limit of 4.47 5.31 2.58 4.29 5.40 2.36 3.97 5.06 2.07 95% CI OR Quartile 3 3.95 3.73 1.95 3.75 3.63 1.78 3.59 3.54 1.57 p Value 1.4E8 3.1E8 0.0090 4.4E8 5.6E8 0.020 1.3E7 1.0E7 0.058 Lower limit of 2.46 2.34 1.18 2.34 2.28 1.09 2.23 2.22 0.985 95% CI Upper limit of 6.35 5.95 3.22 6.02 5.79 2.91 5.77 5.63 2.52 95% CI OR Quartile 4 4.38 4.51 1.45 4.23 4.43 1.28 3.95 4.36 1.23 p Value 2.8E6 6.9E7 0.18 4.6E6 9.2E7 0.38 1.3E5 1.2E6 0.44 Lower limit of 2.36 2.49 0.838 2.28 2.45 0.740 2.13 2.40 0.726 95% CI Upper limit of 8.11 8.17 2.51 7.84 8.03 2.20 7.33 7.89 2.09 95% CI

TABLE-US-00149 TABLE 19.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 49.4 537 49.4 497 53.2 437 Average 877 2500 888 2470 912 2420 Stdev 3820 6600 3850 6560 3900 6490 p (t-test) 0.0082 0.010 0.015 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 153 163 151 165 147 169 sCr only Median 53.2 517 53.2 497 54.2 492 Average 864 2590 870 2570 875 2560 Stdev 3740 6730 3750 6710 3760 6690 p (t-test) 0.0050 0.0056 0.0062 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 160 156 159 157 158 158 UO only Median 115 354 113 351 115 261 Average 1790 1550 1800 1530 1640 1900 Stdev 6200 3230 6210 3220 5260 5980 p (t-test) 0.72 0.69 0.69 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 223 91 222 92 211 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.58 0.70 0.69 0.58 0.68 0.69 0.56 SE 0.029 0.029 0.036 0.029 0.029 0.036 0.030 0.030 0.035 p Value 9.2E12 2.0E11 0.031 2.3E11 4.7E11 0.032 9.8E10 1.7E10 0.081 nCohort Recovered 153 160 223 151 159 222 147 158 211 nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 85% 80% 84% 85% 80% 83% 85% 80% Specificity 31% 32% 25% 32% 32% 25% 31% 32% 25% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 66% 66% 62% 65% 66% 61% 64% 65% 57% Specificity 67% 66% 55% 67% 65% 55% 66% 65% 54% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 37% 38% 31% 37% 38% 30% 36% 37% 28% Specificity 88% 88% 77% 88% 87% 77% 88% 87% 76% OR Quartile 2 2.41 2.71 1.33 2.49 2.75 1.35 2.29 2.58 1.28 p Value 0.0014 4.3E4 0.35 9.4E4 3.4E4 0.32 0.0023 6.9E4 0.40 Lower limit of 1.40 1.56 0.729 1.45 1.58 0.744 1.34 1.49 0.720 95% CI Upper limit of 4.14 4.71 2.42 4.28 4.79 2.46 3.92 4.47 2.26 95% CI OR Quartile 3 4.05 3.71 1.93 3.83 3.61 1.86 3.43 3.51 1.55 p Value 5.0E9 3.3E8 0.0095 1.7E8 6.0E8 0.014 1.8E7 1.1E7 0.072 Lower limit of 2.53 2.33 1.17 2.40 2.27 1.14 2.16 2.21 0.962 95% CI Upper limit of 6.46 5.91 3.18 6.10 5.74 3.06 5.46 5.57 2.49 95% CI OR Quartile 4 4.49 4.26 1.50 4.33 4.18 1.47 4.05 4.11 1.26 p Value 5.0E7 6.1E7 0.14 9.0E7 8.3E7 0.17 2.8E6 1.1E6 0.39 Lower limit of 2.50 2.41 0.870 2.41 2.37 0.852 2.26 2.33 0.740 95% CI Upper limit of 8.05 7.52 2.58 7.78 7.39 2.53 7.26 7.26 2.15 95% CI

TABLE-US-00150 TABLE 19.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 53.2 555 54.2 544 57.7 492 Average 856 2680 871 2630 893 2560 Stdev 3670 6870 3700 6810 3740 6740 p (t-test) 0.0030 0.0043 0.0067 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 167 149 164 152 160 156 sCr only Median 55.3 555 55.7 553 56.1 550 Average 847 2740 852 2720 857 2700 Stdev 3620 6950 3630 6930 3640 6910 p (t-test) 0.0021 0.0024 0.0027 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 171 145 170 146 169 147 UO only Median 116 340 118 338 118 248 Average 1810 1510 1820 1500 1630 1920 Stdev 6210 3220 6220 3210 5240 6040 p (t-test) 0.66 0.64 0.67 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 52500 53500 n (Patient) 222 92 221 93 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.57 0.69 0.70 0.57 0.68 0.69 0.56 SE 0.030 0.030 0.036 0.030 0.030 0.036 0.030 0.030 0.035 p Value 1.9E11 9.6E12 0.043 1.6E10 2.4E11 0.062 5.7E9 9.1E11 0.11 nCohort Recovered 167 171 222 164 170 221 160 169 213 nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 85% 86% 82% 84% 86% 81% 83% 85% 80% Specificity 31% 31% 25% 30% 31% 25% 30% 31% 25% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 68% 68% 61% 66% 67% 60% 65% 67% 57% Specificity 66% 65% 55% 65% 65% 54% 64% 64% 54% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 38% 39% 29% 38% 38% 29% 37% 38% 28% Specificity 87% 87% 77% 87% 86% 76% 86% 86% 76% OR Quartile 2 2.41 2.65 1.49 2.34 2.70 1.38 2.14 2.53 1.34 p Value 0.0018 7.1E4 0.20 0.0024 5.8E4 0.29 0.0057 0.0012 0.32 Lower limit of 1.39 1.51 0.811 1.35 1.53 0.759 1.25 1.44 0.751 95% CI Upper limit of 4.19 4.67 2.73 4.05 4.74 2.51 3.68 4.41 2.40 95% CI OR Quartile 3 4.06 3.86 1.86 3.72 3.74 1.80 3.32 3.63 1.55 p Value 4.9E9 1.6E8 0.014 3.2E8 3.1E8 0.020 3.4E7 5.6E8 0.071 Lower limit of 2.54 2.41 1.14 2.33 2.35 1.10 2.09 2.28 0.963 95% CI Upper limit of 6.49 6.16 3.06 5.92 5.97 2.94 5.26 5.79 2.50 95% CI OR Quartile 4 4.08 4.05 1.36 3.87 3.98 1.33 3.61 3.91 1.22 p Value 7.4E7 6.9E7 0.27 1.8E6 9.4E7 0.31 5.9E6 1.3E6 0.47 Lower limit of 2.34 2.33 0.787 2.22 2.29 0.771 2.07 2.25 0.712 95% CI Upper limit of 7.13 7.03 2.34 6.76 6.90 2.29 6.29 6.78 2.09 95% CI

TABLE-US-00151 TABLE 19.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 81.2 447 81.2 380 81.4 354 Average 1830 1510 1850 1480 1860 1470 Stdev 6490 2980 6520 2960 6530 2950 p (t-test) 0.61 0.56 0.54 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 202 114 200 116 199 117 sCr only Median 65.1 553 65.1 553 65.1 553 Average 943 2790 943 2790 943 2790 Stdev 3600 7230 3600 7230 3600 7230 p (t-test) 0.0029 0.0029 0.0029 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 184 132 184 132 184 132 UO only Median 108 344 110 341 110 338 Average 1790 1570 1800 1550 1820 1520 Stdev 6280 3180 6300 3170 6320 3140 p (t-test) 0.73 0.70 0.65 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 216 98 215 99 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.61 0.67 0.59 0.61 0.67 0.58 0.61 0.67 0.58 SE 0.033 0.031 0.035 0.033 0.031 0.035 0.033 0.031 0.035 p Value 6.4E4 2.4E8 0.016 0.0012 2.4E8 0.024 0.0016 2.4E8 0.031 nCohort Recovered 202 184 216 200 184 215 199 184 213 nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 84% 82% 84% 84% 81% 84% 84% 81% Specificity 28% 29% 25% 28% 29% 25% 28% 29% 25% Cutoff Quartile 3 155 155 155 155 155 155 155 155 155 Sensitivity 65% 67% 62% 64% 67% 62% 63% 67% 60% Specificity 58% 62% 56% 58% 62% 55% 58% 62% 55% Cutoff Quartile 4 909 909 902 909 909 902 909 909 902 Sensitivity 33% 39% 32% 33% 39% 31% 32% 39% 31% Specificity 80% 85% 78% 80% 85% 78% 79% 85% 77% OR Quartile 2 2.05 2.14 1.52 1.94 2.14 1.41 1.97 2.14 1.47 p Value 0.017 0.0084 0.17 0.026 0.0084 0.25 0.022 0.0084 0.20 Lower limit of 1.13 1.22 0.837 1.08 1.22 0.785 1.10 1.22 0.815 95% CI Upper limit of 3.69 3.76 2.76 3.46 3.76 2.54 3.52 3.76 2.64 95% CI OR Quartile 3 2.60 3.26 2.06 2.43 3.26 1.99 2.36 3.26 1.86 p Value 8.3E5 7.8E7 0.0037 2.2E4 7.8E7 0.0055 3.5E4 7.8E7 0.012 Lower limit of 1.62 2.04 1.26 1.52 2.04 1.22 1.47 2.04 1.15 95% CI Upper limit of 4.18 5.20 3.36 3.90 5.20 3.24 3.77 5.20 3.01 95% CI OR Quartile 4 1.96 3.51 1.62 1.89 3.51 1.59 1.85 3.51 1.52 p Value 0.011 4.0E6 0.076 0.016 4.0E6 0.089 0.019 4.0E6 0.12 Lower limit of 1.17 2.06 0.950 1.13 2.06 0.931 1.10 2.06 0.895 95% CI Upper limit of 3.30 5.98 2.76 3.17 5.98 2.70 3.11 5.98 2.59 95% CI

TABLE-US-00152 TABLE 19.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3380 4600 3530 4530 3530 4530 Average 3630 5170 3680 5130 3690 5090 Stdev 2270 3180 2260 3190 2260 3190 p (t-test) 0.0028 0.0052 0.0075 Min 62.8 413 62.8 413 62.8 413 Max 10700 21200 10700 21200 10700 21200 n (Patient) 49 102 48 103 46 105 sCr only Median 3700 4680 3700 4680 3730 4670 Average 3750 5170 3750 5170 3800 5120 Stdev 2150 3280 2150 3280 2140 3290 p (t-test) 0.0056 0.0056 0.010 Min 276 62.8 276 62.8 276 62.8 Max 10700 21200 10700 21200 10700 21200 n (Patient) 52 98 52 98 51 99 UO only Median 4150 4470 4120 4470 4050 4670 Average 4550 5000 4600 4860 4430 5100 Stdev 2740 3510 2760 3390 2640 3460 p (t-test) 0.40 0.61 0.18 Min 62.8 733 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.63 0.52 0.64 0.63 0.51 0.64 0.62 0.55 SE 0.046 0.046 0.052 0.047 0.046 0.050 0.047 0.047 0.048 p Value 0.0010 0.0045 0.67 0.0027 0.0045 0.80 0.0037 0.011 0.30 nCohort Recovered 49 52 104 48 52 97 46 51 91 nCohort Non- 102 98 46 103 98 53 105 99 59 recovered Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 79% 78% 76% 79% 78% 75% 78% 77% 76% Specificity 35% 31% 26% 33% 31% 26% 33% 29% 26% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 52% 57% 57% 53% 57% 57% 56% Specificity 65% 63% 51% 65% 63% 52% 65% 63% 54% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 31% 33% 24% 31% 33% 23% 30% 32% 25% Specificity 88% 88% 74% 88% 88% 73% 87% 88% 75% OR Quartile 2 2.05 1.54 1.12 1.84 1.54 1.07 1.73 1.38 1.15 p Value 0.064 0.27 0.79 0.12 0.27 0.87 0.17 0.41 0.72 Lower limit of 0.959 0.721 0.498 0.858 0.721 0.493 0.798 0.643 0.539 95% CI Upper limit of 4.38 3.27 2.50 3.95 3.27 2.32 3.73 2.95 2.46 95% CI OR Quartile 3 2.58 2.32 1.13 2.45 2.32 1.19 2.50 2.19 1.48 p Value 0.0086 0.017 0.72 0.013 0.017 0.61 0.013 0.026 0.24 Lower limit of 1.27 1.16 0.566 1.20 1.16 0.609 1.22 1.10 0.766 95% CI Upper limit of 5.24 4.63 2.27 4.97 4.63 2.33 5.13 4.39 2.86 95% CI OR Quartile 4 3.28 3.72 0.896 3.15 3.72 0.799 2.92 3.58 1.01 p Value 0.014 0.0067 0.79 0.018 0.0067 0.58 0.027 0.0085 0.98 Lower limit of 1.27 1.44 0.400 1.22 1.44 0.365 1.13 1.38 0.475 95% CI Upper limit of 8.48 9.61 2.01 8.17 9.61 1.75 7.58 9.26 2.14 95% CI

TABLE-US-00153 TABLE 19.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3860 4500 3860 4500 3860 4500 Average 4290 4950 4290 4950 4310 4910 Stdev 2640 3220 2640 3220 2640 3210 p (t-test) 0.18 0.18 0.23 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 64 87 64 87 62 89 sCr only Median 3940 4490 3940 4490 4000 4480 Average 4380 4890 4380 4890 4430 4850 Stdev 2530 3320 2530 3320 2520 3330 p (t-test) 0.30 0.30 0.40 Min 703 62.8 703 62.8 703 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 67 84 67 84 66 85 UO only Median 4060 4710 4050 4710 3930 4780 Average 4550 5020 4540 5010 4420 5170 Stdev 2710 3580 2730 3500 2620 3520 p (t-test) 0.37 0.37 0.14 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 13800 21200 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.54 0.54 0.56 0.54 0.54 0.56 0.53 0.56 SE 0.047 0.047 0.052 0.047 0.047 0.051 0.047 0.047 0.049 p Value 0.18 0.41 0.50 0.18 0.41 0.43 0.22 0.57 0.19 nCohort Recovered 64 67 105 64 67 103 62 66 95 nCohort Non- 87 84 45 87 84 47 89 85 55 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 76% 74% 73% 76% 74% 74% 75% 73% 75% Specificity 27% 24% 25% 27% 24% 25% 26% 23% 25% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 57% 56% 58% 57% 56% 60% 57% 55% 60% Specificity 59% 57% 53% 59% 57% 54% 60% 56% 56% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 28% 29% 27% 28% 29% 26% 27% 28% 27% Specificity 78% 79% 75% 78% 79% 75% 77% 79% 76% OR Quartile 2 1.14 0.884 0.905 1.14 0.884 0.985 1.06 0.793 0.990 p Value 0.73 0.75 0.81 0.73 0.75 0.97 0.88 0.54 0.98 Lower limit of 0.542 0.421 0.408 0.542 0.421 0.446 0.503 0.375 0.462 95% CI Upper limit of 2.38 1.86 2.01 2.38 1.86 2.17 2.23 1.68 2.12 95% CI OR Quartile 3 1.98 1.66 1.56 1.98 1.66 1.76 1.99 1.58 1.89 p Value 0.042 0.12 0.21 0.042 0.12 0.11 0.041 0.17 0.064 Lower limit of 1.03 0.871 0.773 1.03 0.871 0.872 1.03 0.826 0.964 95% CI Upper limit of 3.80 3.18 3.16 3.80 3.18 3.54 3.84 3.01 3.72 95% CI OR Quartile 4 1.36 1.51 1.10 1.36 1.51 1.02 1.27 1.46 1.17 p Value 0.43 0.28 0.81 0.43 0.28 0.97 0.54 0.33 0.68 Lower limit of 0.639 0.711 0.499 0.639 0.711 0.460 0.594 0.686 0.551 95% CI Upper limit of 2.90 3.22 2.45 2.90 3.22 2.24 2.70 3.11 2.50 95% CI

TABLE-US-00154 TABLE 19.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3790 4710 3860 4700 3770 4700 Average 4210 5090 4250 5040 4230 5040 Stdev 2560 3310 2550 3320 2580 3280 p (t-test) 0.072 0.11 0.095 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 73 78 72 79 70 81 sCr only Median 3930 4670 3930 4670 3930 4670 Average 4300 5020 4300 5020 4300 5020 Stdev 2500 3380 2500 3380 2500 3380 p (t-test) 0.14 0.14 0.14 Min 703 62.8 703 62.8 703 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 74 77 74 77 74 77 UO only Median 4050 4800 4050 4800 3930 4820 Average 4460 5230 4470 5170 4390 5230 Stdev 2610 3710 2630 3650 2580 3570 p (t-test) 0.15 0.19 0.096 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 13800 21200 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.56 0.56 0.57 0.56 0.55 0.58 0.56 0.58 SE 0.046 0.047 0.052 0.046 0.047 0.051 0.046 0.047 0.049 p Value 0.073 0.20 0.25 0.12 0.20 0.28 0.086 0.20 0.13 nCohort Recovered 73 74 105 72 74 103 70 74 96 nCohort Non- 78 77 45 79 77 47 81 77 54 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 77% 75% 73% 76% 75% 72% 77% 75% 74% Specificity 27% 26% 25% 26% 26% 24% 27% 26% 25% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 60% 58% 62% 59% 58% 62% 60% 58% 63% Specificity 60% 58% 55% 60% 58% 55% 61% 58% 57% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 29% 30% 29% 29% 30% 28% 28% 30% 28% Specificity 79% 80% 76% 79% 80% 76% 79% 80% 76% OR Quartile 2 1.26 1.05 0.905 1.13 1.05 0.838 1.22 1.05 0.952 p Value 0.54 0.89 0.81 0.74 0.89 0.66 0.60 0.89 0.90 Lower limit of 0.602 0.506 0.408 0.543 0.506 0.384 0.582 0.506 0.444 95% CI Upper limit of 2.63 2.20 2.01 2.36 2.20 1.83 2.54 2.20 2.04 95% CI OR Quartile 3 2.30 1.95 2.03 2.18 1.95 2.00 2.44 1.95 2.28 p Value 0.012 0.043 0.052 0.019 0.043 0.055 0.0077 0.043 0.018 Lower limit of 1.20 1.02 0.994 1.14 1.02 0.987 1.27 1.02 1.15 95% CI Upper limit of 4.42 3.73 4.15 4.18 3.73 4.04 4.70 3.73 4.52 95% CI OR Quartile 4 1.62 1.68 1.30 1.56 1.68 1.19 1.45 1.68 1.22 p Value 0.21 0.18 0.51 0.24 0.18 0.66 0.33 0.18 0.61 Lower limit of 0.765 0.793 0.593 0.739 0.793 0.546 0.688 0.793 0.572 95% CI Upper limit of 3.42 3.54 2.85 3.30 3.54 2.61 3.07 3.54 2.60 95% CI

TABLE-US-00155 TABLE 19.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3860 4710 3920 4690 3790 4690 Average 4250 5090 4290 5040 4260 5040 Stdev 2560 3350 2550 3360 2580 3310 p (t-test) 0.083 0.12 0.11 Min 62.8 276 62.8 276 62.8 276 Max 11800 21200 11800 21200 11800 21200 n (Patient) 76 75 75 76 73 78 sCr only Median 3930 4580 3930 4580 3930 4580 Average 4320 5030 4320 5030 4320 5030 Stdev 2500 3420 2500 3420 2500 3420 p (t-test) 0.15 0.15 0.15 Min 703 62.8 703 62.8 703 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 77 74 77 74 77 74 UO only Median 3930 4820 3930 4820 3920 4840 Average 4460 5160 4460 5160 4380 5230 Stdev 2670 3540 2670 3540 2600 3530 p (t-test) 0.18 0.18 0.092 Min 62.8 276 62.8 276 62.8 276 Max 13800 21200 13800 21200 13800 21200 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.56 0.56 0.57 0.56 0.56 0.57 0.56 0.58 SE 0.046 0.047 0.050 0.047 0.047 0.050 0.046 0.047 0.049 p Value 0.093 0.22 0.20 0.15 0.22 0.20 0.11 0.22 0.10 nCohort Recovered 76 77 100 75 77 100 73 77 95 nCohort Non- 75 74 50 76 74 50 78 74 55 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 77% 76% 74% 76% 76% 74% 77% 76% 75% Specificity 28% 26% 25% 27% 26% 25% 27% 26% 25% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 60% 58% 62% 59% 58% 62% 60% 58% 64% Specificity 59% 57% 56% 59% 57% 56% 60% 57% 58% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 29% 30% 26% 29% 30% 26% 28% 30% 27% Specificity 79% 79% 75% 79% 79% 75% 78% 79% 76% OR Quartile 2 1.30 1.09 0.949 1.17 1.09 0.949 1.26 1.09 0.990 p Value 0.48 0.82 0.89 0.67 0.82 0.89 0.54 0.82 0.98 Lower limit of 0.623 0.523 0.436 0.561 0.523 0.436 0.602 0.523 0.462 95% CI Upper limit of 2.73 2.28 2.06 2.45 2.28 2.06 2.63 2.28 2.12 95% CI OR Quartile 3 2.18 1.85 2.08 2.06 1.85 2.08 2.30 1.85 2.41 p Value 0.019 0.062 0.039 0.029 0.062 0.039 0.012 0.062 0.012 Lower limit of 1.14 0.970 1.04 1.08 0.970 1.04 1.20 0.970 1.21 95% CI Upper limit of 4.17 3.53 4.16 3.94 3.53 4.16 4.42 3.53 4.77 95% CI OR Quartile 4 1.56 1.61 1.05 1.50 1.61 1.05 1.40 1.61 1.17 p Value 0.24 0.21 0.89 0.28 0.21 0.89 0.37 0.21 0.68 Lower limit of 0.741 0.768 0.484 0.715 0.768 0.484 0.666 0.768 0.551 95% CI Upper limit of 3.27 3.39 2.29 3.16 3.39 2.29 2.94 3.39 2.50 95% CI

TABLE-US-00156 TABLE 19.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 4060 4580 4090 4500 4060 4490 Average 4540 4840 4580 4780 4580 4780 Stdev 2720 3370 2710 3380 2730 3350 p (t-test) 0.55 0.68 0.69 Min 703 62.8 703 62.8 703 62.8 Max 13800 21200 13800 21200 13800 21200 n (Patient) 89 62 88 63 87 64 sCr only Median 3930 4690 3930 4690 3930 4690 Average 4310 5060 4310 5060 4310 5060 Stdev 2520 3420 2520 3420 2520 3420 p (t-test) 0.12 0.12 0.12 Min 703 62.8 703 62.8 703 62.8 Max 11800 21200 11800 21200 11800 21200 n (Patient) 79 72 79 72 79 72 UO only Median 3930 4790 3930 4790 3930 4750 Average 4480 5080 4480 5080 4520 5000 Stdev 2670 3520 2670 3520 2680 3490 p (t-test) 0.24 0.24 0.34 Min 413 62.8 413 62.8 413 62.8 Max 13800 21200 13800 21200 13800 21200 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.52 0.56 0.56 0.51 0.56 0.56 0.51 0.56 0.54 SE 0.048 0.047 0.050 0.048 0.047 0.050 0.048 0.047 0.049 p Value 0.61 0.17 0.27 0.78 0.17 0.27 0.77 0.17 0.38 nCohort Recovered 89 79 98 88 79 98 87 79 96 nCohort Non- 62 72 52 63 72 52 64 72 54 recovered Cutoff Quartile 2 2740 2740 2740 2740 2740 2740 2740 2740 2740 Sensitivity 74% 78% 75% 73% 78% 75% 73% 78% 74% Specificity 25% 28% 26% 24% 28% 26% 24% 28% 25% Cutoff Quartile 3 4230 4230 4260 4230 4230 4260 4230 4230 4260 Sensitivity 56% 58% 60% 56% 58% 60% 56% 58% 59% Specificity 54% 57% 55% 53% 57% 55% 54% 57% 55% Cutoff Quartile 4 6010 6010 6060 6010 6010 6060 6010 6010 6060 Sensitivity 24% 28% 25% 24% 28% 25% 23% 28% 24% Specificity 74% 77% 74% 74% 77% 74% 74% 77% 74% OR Quartile 2 0.944 1.35 1.03 0.848 1.35 1.03 0.880 1.35 0.952 p Value 0.88 0.43 0.95 0.66 0.43 0.95 0.73 0.43 0.90 Lower limit of 0.448 0.643 0.473 0.404 0.643 0.473 0.419 0.643 0.444 95% CI Upper limit of 1.99 2.84 2.23 1.78 2.84 2.23 1.85 2.84 2.04 95% CI OR Quartile 3 1.52 1.85 1.81 1.43 1.85 1.81 1.51 1.85 1.79 p Value 0.21 0.061 0.088 0.28 0.061 0.088 0.21 0.061 0.090 Lower limit of 0.790 0.971 0.916 0.748 0.971 0.916 0.789 0.971 0.912 95% CI Upper limit of 2.91 3.54 3.58 2.74 3.54 3.58 2.89 3.54 3.52 95% CI OR Quartile 4 0.916 1.30 0.973 0.883 1.30 0.973 0.852 1.30 0.900 p Value 0.82 0.48 0.95 0.75 0.48 0.95 0.67 0.48 0.79 Lower limit of 0.432 0.624 0.449 0.417 0.624 0.449 0.403 0.624 0.416 95% CI Upper limit of 1.94 2.72 2.11 1.87 2.72 2.11 1.80 2.72 1.95 95% CI

Example 20. Use of CC Motif Chemokine 15 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0178] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 15 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0179] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0180] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00157 TABLE 20.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 65.6 585 65.6 770 77.7 784 Average 1180 2680 1140 3040 1460 2460 Stdev 5100 6030 4920 6440 5910 3940 p (t-test) 0.020 0.0044 0.16 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 204 112 220 96 235 81 sCr only Median 65.2 604 65.6 803 75.3 791 Average 1170 2770 1110 3170 1450 2490 Stdev 5060 6130 4890 6520 5920 3950 p (t-test) 0.014 0.0023 0.14 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 207 108 222 93 234 81 UO only Median 130 344 130 406 129 491 Average 1750 1550 1730 1670 1720 1720 Stdev 5760 3230 5730 3330 5720 3370 p (t-test) 0.83 0.95 1.00 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 18400 53500 18400 53500 18400 n (Patient) 274 40 277 37 278 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.71 0.58 0.73 0.74 0.60 0.72 0.72 0.61 SE 0.032 0.032 0.050 0.033 0.033 0.052 0.035 0.035 0.052 p Value 3.6E10 2.6E11 0.12 4.4E12 2.8E13 0.065 1.0E9 6.9E10 0.034 nCohort Non- 204 207 274 220 222 277 235 234 278 persistent nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 88% 90% 82% 90% 91% 84% 90% 93% 86% Specificity 29% 30% 24% 29% 30% 24% 28% 29% 24% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 71% 71% 68% 75% 75% 70% 77% 74% 72% Specificity 61% 61% 53% 61% 60% 53% 59% 58% 53% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 42% 44% 32% 46% 48% 35% 46% 47% 36% Specificity 84% 85% 76% 84% 85% 76% 82% 82% 76% OR Quartile 2 2.92 3.86 1.50 3.53 4.50 1.65 3.56 5.12 2.01 p Value 9.7E4 1.3E4 0.36 5.6E4 1.6E4 0.29 0.0015 2.7E4 0.16 Lower limit of 1.54 1.93 0.632 1.72 2.06 0.659 1.63 2.13 0.751 95% CI Upper limit of 5.51 7.69 3.54 7.22 9.81 4.12 7.80 12.3 5.37 95% CI OR Quartile 3 3.79 3.86 2.30 4.67 4.63 2.63 4.72 3.97 2.92 p Value 1.3E7 1.3E7 0.020 1.7E8 3.0E8 0.011 1.3E7 1.5E6 0.0062 Lower limit of 2.31 2.34 1.14 2.74 2.69 1.25 2.66 2.26 1.36 95% CI Upper limit of 6.21 6.38 4.65 7.99 7.97 5.54 8.41 6.95 6.28 95% CI OR Quartile 4 3.89 4.21 1.52 4.47 5.18 1.73 3.86 4.16 1.82 p Value 5.7E7 1.4E7 0.25 5.4E8 3.6E9 0.14 1.5E6 4.0E7 0.11 Lower limit of 2.28 2.47 0.741 2.61 3.00 0.835 2.23 2.40 0.871 95% CI Upper limit of 6.62 7.20 3.11 7.68 8.95 3.59 6.70 7.22 3.78 95% CI

TABLE-US-00158 TABLE 20.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 59.2 576 59.2 618 65.6 616 Average 1170 2490 1100 2820 1460 2290 Stdev 5270 5700 5040 6070 6080 3820 p (t-test) 0.034 0.0075 0.21 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 185 131 203 113 218 98 sCr only Median 60.0 577 59.2 717 65.2 616 Average 1140 2610 1090 2900 1460 2300 Stdev 5190 5840 5020 6140 6090 3820 p (t-test) 0.021 0.0050 0.21 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 191 124 205 110 217 98 UO only Median 118 406 118 488 118 521 Average 1790 1450 1760 1530 1760 1560 Stdev 5950 2870 5910 2960 5900 2980 p (t-test) 0.67 0.78 0.81 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 18400 53500 18400 53500 18400 n (Patient) 255 59 259 55 260 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.71 0.60 0.73 0.73 0.61 0.71 0.71 0.62 SE 0.030 0.031 0.042 0.031 0.031 0.044 0.033 0.033 0.044 p Value 2.7E11 1.4E11 0.020 2.3E13 3.9E14 0.014 3.3E10 2.8E10 0.0069 nCohort Non- 185 191 255 203 205 259 218 217 260 persistent nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 87% 89% 85% 89% 91% 85% 89% 91% 87% Specificity 31% 31% 25% 31% 31% 25% 29% 30% 25% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 70% 70% 68% 73% 74% 69% 74% 72% 70% Specificity 64% 63% 54% 63% 62% 54% 61% 60% 54% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 40% 42% 31% 43% 45% 33% 42% 43% 33% Specificity 85% 86% 76% 85% 86% 76% 83% 83% 77% OR Quartile 2 2.99 3.60 1.86 3.70 4.54 1.97 3.21 4.23 2.28 p Value 3.3E4 7.6E5 0.11 1.3E4 3.3E5 0.097 9.4E4 1.5E4 0.054 Lower limit of 1.64 1.91 0.867 1.90 2.22 0.884 1.61 2.01 0.984 95% CI Upper limit of 5.43 6.79 4.00 7.22 9.27 4.38 6.42 8.90 5.30 95% CI OR Quartile 3 4.25 3.97 2.48 4.72 4.64 2.63 4.57 3.93 2.81 p Value 3.5E9 2.3E8 0.0029 1.8E9 3.5E9 0.0023 1.9E8 2.5E7 0.0014 Lower limit of 2.63 2.45 1.36 2.85 2.79 1.41 2.69 2.34 1.49 95% CI Upper limit of 6.88 6.45 4.52 7.83 7.73 4.90 7.76 6.61 5.30 95% CI OR Quartile 4 3.85 4.39 1.40 4.42 5.06 1.58 3.41 3.65 1.63 p Value 8.8E7 8.6E8 0.29 6.1E8 5.0E9 0.16 6.4E6 2.0E6 0.13 Lower limit of 2.25 2.55 0.748 2.58 2.94 0.839 2.00 2.14 0.865 95% CI Upper limit of 6.59 7.54 2.61 7.56 8.71 2.97 5.80 6.22 3.08 95% CI

TABLE-US-00159 TABLE 20.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 55.7 585 55.3 692 63.1 635 Average 1100 2470 1030 2740 1400 2290 Stdev 5340 5580 5130 5840 6200 3820 p (t-test) 0.026 0.0065 0.17 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 174 142 189 127 204 112 sCr only Median 56.1 596 55.7 784 65.0 616 Average 1070 2600 1020 2850 1390 2350 Stdev 5240 5720 5070 5960 6150 3880 p (t-test) 0.014 0.0038 0.14 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 19200 n (Patient) 181 134 194 121 207 108 UO only Median 118 406 118 521 118 521 Average 1780 1510 1750 1610 1750 1610 Stdev 6040 2930 5980 3010 5980 3010 p (t-test) 0.72 0.86 0.86 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 18400 53500 18400 53500 18400 n (Patient) 245 69 250 64 250 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.72 0.59 0.74 0.74 0.61 0.71 0.72 0.61 SE 0.029 0.029 0.040 0.029 0.030 0.041 0.031 0.032 0.041 p Value 3.3E13 4.0E14 0.018 4.4E16 2.2E16 0.0070 1.2E11 1.1E11 0.0070 nCohort Non- 174 181 245 189 194 250 204 207 250 persistent nCohort Persistent 142 134 69 127 121 64 112 108 64 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 87% 89% 84% 89% 91% 86% 88% 91% 86% Specificity 32% 33% 25% 32% 32% 26% 30% 31% 26% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 70% 70% 65% 72% 73% 67% 72% 71% 67% Specificity 66% 65% 54% 65% 64% 54% 62% 61% 54% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 40% 43% 30% 44% 46% 33% 42% 44% 33% Specificity 87% 88% 76% 88% 88% 77% 84% 85% 77% OR Quartile 2 2.99 3.84 1.79 3.75 4.81 2.10 3.25 4.39 2.10 p Value 2.1E4 2.2E5 0.11 4.3E5 7.9E6 0.055 3.9E4 5.0E5 0.055 Lower limit of 1.68 2.06 0.882 1.99 2.42 0.984 1.69 2.15 0.984 95% CI Upper limit of 5.34 7.14 3.62 7.08 9.58 4.50 6.23 8.96 4.50 95% CI OR Quartile 3 4.49 4.30 2.23 4.90 4.72 2.44 4.31 3.86 2.44 p Value 6.4E10 2.5E9 0.0047 2.2E10 8.4E10 0.0025 1.1E8 1.3E7 0.0025 Lower limit of 2.79 2.66 1.28 3.00 2.88 1.37 2.61 2.34 1.37 95% CI Upper limit of 7.22 6.94 3.88 8.00 7.76 4.35 7.12 6.38 4.35 95% CI OR Quartile 4 4.63 5.35 1.41 5.69 6.41 1.62 3.89 4.21 1.62 p Value 7.6E8 5.0E9 0.25 1.1E9 1.0E10 0.12 5.7E7 1.4E7 0.12 Lower limit of 2.65 3.05 0.781 3.25 3.65 0.888 2.28 2.47 0.888 95% CI Upper limit of 8.10 9.39 2.55 9.96 11.2 2.94 6.62 7.20 2.94 95% CI

TABLE-US-00160 TABLE 20.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 54.2 585 54.2 671 60.6 616 Average 1100 2450 1040 2720 1160 2670 Stdev 5380 5540 5150 5820 5100 6000 p (t-test) 0.029 0.0073 0.019 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 52500 n (Patient) 172 144 188 128 200 116 sCr only Cohort Cohort Cohort Cohort Cohort Cohort Median 56.1 585 55.3 701 61.1 616 Average 1080 2560 1030 2790 1150 2740 Stdev 5270 5680 5110 5900 5060 6090 p (t-test) 0.017 0.0053 0.014 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 52500 53500 52500 53500 52500 n (Patient) 179 136 191 124 203 112 UO only Median 116 351 116 380 116 380 Average 1750 1650 1710 1760 1710 1760 Stdev 6010 3470 5940 3590 5940 3590 p (t-test) 0.90 0.95 0.95 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 238 76 244 70 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.72 0.60 0.74 0.74 0.61 0.71 0.72 0.61 SE 0.029 0.030 0.038 0.029 0.030 0.040 0.031 0.031 0.040 p Value 1.3E13 2.7E13 0.011 6.7E16 6.7E16 0.0061 7.6E12 6.2E12 0.0061 nCohort Non- 172 179 238 188 191 244 200 203 244 persistent nCohort Persistent 144 136 76 128 124 70 116 112 70 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 87% 88% 84% 89% 90% 86% 89% 90% 86% Specificity 32% 32% 26% 32% 32% 26% 30% 31% 26% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 69% 69% 66% 72% 72% 67% 71% 71% 67% Specificity 66% 64% 55% 65% 64% 55% 62% 61% 55% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 40% 42% 30% 44% 45% 31% 41% 43% 31% Specificity 88% 88% 76% 88% 88% 77% 84% 85% 77% OR Quartile 2 3.09 3.60 1.84 3.82 4.49 2.09 3.48 4.13 2.09 p Value 1.3E4 3.7E5 0.080 3.5E5 1.1E5 0.047 1.7E4 5.5E5 0.047 Lower limit of 1.73 1.96 0.930 2.02 2.30 1.01 1.81 2.07 1.01 95% CI Upper limit of 5.52 6.61 3.63 7.20 8.75 4.33 6.67 8.24 4.33 95% CI OR Quartile 3 4.47 4.02 2.35 4.72 4.50 2.49 3.93 3.76 2.49 p Value 6.6E10 9.4E9 0.0018 4.5E10 1.8E9 0.0014 4.6E8 1.6E7 0.0014 Lower limit of 2.78 2.50 1.37 2.90 2.75 1.42 2.41 2.29 1.42 95% CI Upper limit of 7.18 6.47 4.03 7.70 7.34 4.35 6.43 6.16 4.35 95% CI OR Quartile 4 4.85 5.15 1.41 5.58 6.02 1.50 3.85 4.16 1.50 p Value 4.3E8 1.1E8 0.24 1.6E9 3.7E10 0.17 6.9E7 1.8E7 0.17 Lower limit of 2.76 2.94 0.795 3.19 3.43 0.837 2.26 2.44 0.837 95% CI Upper limit of 8.53 9.03 2.50 9.76 10.5 2.70 6.55 7.11 2.70 95% CI

TABLE-US-00161 TABLE 20.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 54.2 585 53.2 692 59.6 616 Average 798 2760 754 3040 1170 2600 Stdev 3610 6900 3460 7220 5150 5910 p (t-test) 0.0014 2.2E4 0.024 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 53500 52500 n (Patient) 168 148 183 133 196 120 sCr only Median 56.1 585 55.3 701 61.1 616 Average 787 2890 752 3130 899 3130 Stdev 3540 7070 3430 7350 3490 7630 p (t-test) 6.9E4 1.4E4 4.7E4 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 175 140 187 128 199 116 UO only Median 106 406 104 447 104 447 Average 1730 1710 1710 1760 1710 1760 Stdev 6070 3420 6030 3470 6030 3470 p (t-test) 0.98 0.94 0.94 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 233 81 236 78 236 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.72 0.62 0.75 0.74 0.62 0.72 0.72 0.62 SE 0.029 0.029 0.037 0.029 0.029 0.038 0.031 0.031 0.038 p Value 3.4E14 1.0E13 0.0019 0 2.2E16 0.0012 2.3E12 3.5E12 0.0012 nCohort Non- 168 175 233 183 187 236 196 199 236 persistent nCohort Persistent 148 140 81 133 128 78 120 116 78 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 86% 87% 85% 89% 89% 86% 89% 89% 86% Specificity 32% 32% 26% 33% 32% 26% 31% 31% 26% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 69% 69% 68% 72% 71% 69% 71% 70% 69% Specificity 67% 65% 56% 66% 64% 56% 63% 61% 56% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 41% 42% 32% 44% 45% 33% 42% 43% 33% Specificity 89% 89% 77% 89% 89% 78% 85% 85% 78% OR Quartile 2 3.03 3.19 2.04 4.15 3.85 2.17 3.72 3.50 2.17 p Value 1.4E4 1.1E4 0.040 1.1E5 3.1E5 0.030 7.5E5 1.6E4 0.030 Lower limit of 1.71 1.77 1.03 2.20 2.04 1.08 1.94 1.83 1.08 95% CI Upper limit of 5.37 5.74 4.02 7.82 7.25 4.37 7.13 6.71 4.37 95% CI OR Quartile 3 4.43 3.98 2.72 5.06 4.41 2.91 4.09 3.67 2.91 p Value 6.9E10 1.0E8 2.4E4 6.9E11 2.1E9 1.3E4 1.6E8 1.8E7 1.3E4 Lower limit of 2.76 2.48 1.59 3.11 2.71 1.68 2.51 2.25 1.68 95% CI Upper limit of 7.12 6.38 4.63 8.24 7.16 5.01 6.67 5.98 5.01 95% CI OR Quartile 4 5.35 5.65 1.61 6.50 6.55 1.73 4.11 4.44 1.73 p Value 1.4E8 3.4E9 0.096 2.0E10 1.2E10 0.057 2.3E7 5.8E8 0.057 Lower limit of 3.00 3.18 0.919 3.65 3.70 0.985 2.41 2.59 0.985 95% CI Upper limit of 9.54 10.0 2.81 11.6 11.6 3.03 7.03 7.61 3.03 95% CI

TABLE-US-00162 TABLE 20.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 4090 4500 4090 4500 4170 4300 Average 4460 5020 4470 5090 4630 4780 Stdev 2710 3430 2690 3590 2790 3560 p (t-test) 0.27 0.24 0.78 Min 62.8 413 62.8 413 62.8 413 Max 11800 21200 11800 21200 13800 21200 n (Patient) 96 55 104 47 111 40 sCr only Median 4150 4490 4120 4500 4230 4300 Average 4520 4930 4480 5090 4660 4720 Stdev 2700 3470 2660 3650 2780 3560 p (t-test) 0.42 0.26 0.91 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 94 56 103 47 108 42 UO only Median 4170 4800 4170 4800 4150 4880 Average 4560 5570 4560 5570 4540 5820 Stdev 2670 4660 2670 4660 2680 4660 p (t-test) 0.17 0.17 0.089 Min 62.8 1120 62.8 1120 62.8 1630 Max 13800 21200 13800 21200 13800 21200 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.54 0.52 0.54 0.54 0.54 0.54 0.49 0.49 0.57 SE 0.049 0.049 0.072 0.051 0.051 0.072 0.054 0.053 0.074 p Value 0.44 0.65 0.54 0.43 0.43 0.54 0.89 0.80 0.32 nCohort Non- 96 94 131 104 103 131 111 108 132 persistent nCohort Persistent 55 56 19 47 47 19 40 42 18 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 75% 73% 68% 79% 79% 68% 78% 76% 72% Specificity 25% 24% 24% 27% 27% 24% 26% 26% 25% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 56% 54% 63% 57% 55% 63% 52% 50% 67% Specificity 53% 52% 52% 53% 52% 52% 50% 50% 52% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 29% 29% 26% 28% 30% 26% 20% 21% 28% Specificity 77% 77% 75% 76% 77% 75% 73% 73% 75% OR Quartile 2 0.976 0.885 0.700 1.36 1.38 0.700 1.22 1.12 0.867 p Value 0.95 0.75 0.50 0.46 0.44 0.50 0.65 0.79 0.80 Lower limit of 0.455 0.416 0.246 0.599 0.607 0.246 0.518 0.488 0.287 95% CI Upper limit of 2.09 1.89 1.99 3.10 3.14 1.99 2.86 2.57 2.61 95% CI OR Quartile 3 1.46 1.26 1.85 1.52 1.36 1.85 1.13 1.00 2.19 p Value 0.26 0.50 0.22 0.24 0.38 0.22 0.75 1.0 0.14 Lower limit of 0.751 0.647 0.685 0.756 0.682 0.685 0.546 0.490 0.776 95% CI Upper limit of 2.85 2.44 5.00 3.04 2.73 5.00 2.32 2.04 6.18 95% CI OR Quartile 4 1.38 1.31 1.06 1.21 1.40 1.06 0.675 0.743 1.15 p Value 0.40 0.48 0.92 0.64 0.40 0.92 0.38 0.49 0.80 Lower limit of 0.651 0.618 0.355 0.553 0.644 0.355 0.280 0.317 0.383 95% CI Upper limit of 2.93 2.77 3.17 2.64 3.03 3.17 1.63 1.74 3.48 95% CI

TABLE-US-00163 TABLE 20.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 4000 4480 4000 4480 4170 4420 Average 4440 4980 4480 4980 4640 4720 Stdev 2720 3350 2750 3360 2850 3300 p (t-test) 0.28 0.32 0.88 Min 62.8 413 62.8 413 62.8 413 Max 11800 21200 11800 21200 13800 21200 n (Patient) 88 63 94 57 101 50 sCr only Median 4090 4490 4060 4500 4170 4370 Average 4490 4930 4460 5020 4640 4730 Stdev 2680 3430 2650 3500 2770 3440 p (t-test) 0.38 0.26 0.87 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 88 62 93 57 99 51 UO only Median 4170 4670 4170 4670 4150 4690 Average 4600 5110 4600 5110 4570 5260 Stdev 2710 4090 2710 4090 2710 4090 p (t-test) 0.42 0.42 0.29 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.54 0.53 0.52 0.54 0.54 0.52 0.50 0.49 0.54 SE 0.048 0.048 0.062 0.049 0.049 0.062 0.050 0.050 0.063 p Value 0.39 0.55 0.80 0.39 0.39 0.80 0.98 0.89 0.57 nCohort Non- 88 88 123 94 93 123 101 99 124 persistent nCohort Persistent 63 62 27 57 57 27 50 51 26 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 76% 74% 70% 79% 77% 70% 78% 75% 73% Specificity 26% 25% 24% 28% 27% 24% 27% 25% 25% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 57% 55% 59% 58% 56% 59% 54% 51% 62% Specificity 55% 53% 52% 54% 54% 52% 51% 51% 52% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 27% 27% 22% 26% 28% 22% 20% 22% 23% Specificity 76% 76% 74% 76% 76% 74% 72% 73% 74% OR Quartile 2 1.13 0.958 0.766 1.43 1.24 0.766 1.29 0.988 0.905 p Value 0.75 0.91 0.57 0.37 0.58 0.57 0.53 0.97 0.84 Lower limit of 0.535 0.455 0.304 0.657 0.576 0.304 0.581 0.455 0.347 95% CI Upper limit of 2.40 2.02 1.93 3.13 2.69 1.93 2.88 2.15 2.36 95% CI OR Quartile 3 1.60 1.39 1.58 1.63 1.49 1.58 1.25 1.06 1.76 p Value 0.16 0.32 0.29 0.15 0.24 0.29 0.53 0.86 0.20 Lower limit of 0.834 0.725 0.678 0.839 0.767 0.678 0.632 0.540 0.742 95% CI Upper limit of 3.07 2.67 3.67 3.17 2.89 3.67 2.46 2.09 4.19 95% CI OR Quartile 4 1.18 1.21 0.812 1.10 1.26 0.812 0.652 0.733 0.862 p Value 0.66 0.62 0.68 0.80 0.55 0.68 0.31 0.45 0.77 Lower limit of 0.562 0.574 0.301 0.519 0.595 0.301 0.287 0.329 0.318 95% CI Upper limit of 2.47 2.53 2.19 2.34 2.67 2.19 1.48 1.63 2.34 95% CI

TABLE-US-00164 TABLE 20.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3930 4580 3930 4500 4090 4480 Average 4370 5030 4390 5030 4530 4880 Stdev 2750 3260 2730 3310 2830 3270 p (t-test) 0.18 0.20 0.49 Min 62.8 413 62.8 413 62.8 413 Max 11800 21200 11800 21200 13800 21200 n (Patient) 83 68 86 65 94 57 sCr only Median 3930 4580 3930 4580 4120 4480 Average 4420 4980 4430 5000 4590 4810 Stdev 2720 3310 2690 3380 2800 3330 p (t-test) 0.26 0.25 0.66 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 82 68 86 64 93 57 UO only Median 4060 4780 4060 4780 4050 4790 Average 4550 5150 4550 5150 4520 5270 Stdev 2750 3690 2750 3690 2750 3680 p (t-test) 0.30 0.30 0.20 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.55 0.55 0.56 0.55 0.55 0.53 0.52 0.57 SE 0.047 0.047 0.057 0.047 0.048 0.057 0.049 0.049 0.057 p Value 0.18 0.27 0.37 0.22 0.29 0.37 0.51 0.73 0.23 nCohort Non- 83 82 115 86 86 115 94 93 116 persistent nCohort Persistent 68 68 35 65 64 35 57 57 34 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 76% 74% 78% 77% 74% 79% 75% 76% Specificity 28% 27% 25% 28% 27% 25% 28% 26% 26% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 59% 57% 63% 58% 58% 63% 56% 54% 65% Specificity 57% 56% 54% 56% 56% 54% 53% 53% 54% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 28% 28% 26% 28% 28% 26% 25% 25% 26% Specificity 77% 77% 75% 77% 77% 75% 74% 74% 75% OR Quartile 2 1.35 1.19 0.974 1.41 1.19 0.974 1.43 1.07 1.13 p Value 0.43 0.64 0.95 0.37 0.65 0.95 0.37 0.86 0.78 Lower limit of 0.641 0.567 0.409 0.662 0.563 0.409 0.657 0.499 0.463 95% CI Upper limit of 2.86 2.51 2.32 3.00 2.52 2.32 3.13 2.29 2.77 95% CI OR Quartile 3 1.87 1.72 1.98 1.78 1.73 1.98 1.45 1.33 2.18 p Value 0.060 0.10 0.085 0.083 0.100 0.085 0.27 0.40 0.054 Lower limit of 0.974 0.898 0.910 0.927 0.900 0.910 0.751 0.685 0.986 95% CI Upper limit of 3.57 3.29 4.31 3.41 3.33 4.31 2.82 2.57 4.81 95% CI OR Quartile 4 1.31 1.29 1.03 1.26 1.29 1.03 0.950 0.936 1.08 p Value 0.48 0.50 0.95 0.53 0.50 0.95 0.89 0.86 0.86 Lower limit of 0.625 0.615 0.431 0.604 0.616 0.431 0.444 0.437 0.452 95% CI Upper limit of 2.73 2.69 2.44 2.65 2.71 2.44 2.03 2.00 2.58 95% CI

TABLE-US-00165 TABLE 20.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3920 4690 3930 4580 4060 4490 Average 4350 5040 4380 5040 4520 4880 Stdev 2780 3210 2740 3280 2860 3200 p (t-test) 0.16 0.18 0.48 Min 62.8 413 62.8 413 62.8 413 Max 11800 21200 11800 21200 13800 21200 n (Patient) 81 70 85 66 91 60 sCr only Median 3930 4670 3930 4580 4090 4490 Average 4410 4990 4430 4990 4570 4820 Stdev 2740 3280 2720 3330 2840 3260 p (t-test) 0.24 0.26 0.62 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 81 69 84 66 90 60 UO only Median 3940 4800 3990 4790 3940 4800 Average 4500 5200 4510 5200 4480 5300 Stdev 2760 3510 2750 3560 2760 3540 p (t-test) 0.21 0.21 0.14 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.56 0.57 0.56 0.55 0.57 0.54 0.53 0.58 SE 0.047 0.047 0.054 0.047 0.048 0.054 0.048 0.048 0.054 p Value 0.12 0.22 0.20 0.18 0.28 0.23 0.44 0.60 0.14 nCohort Non- 81 81 109 85 84 110 91 90 111 persistent nCohort Persistent 70 69 41 66 66 40 60 60 39 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 79% 77% 76% 79% 77% 75% 78% 77% 77% Specificity 28% 27% 26% 28% 27% 25% 27% 27% 26% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 60% 58% 63% 59% 58% 62% 57% 55% 64% Specificity 58% 57% 55% 56% 56% 55% 54% 53% 55% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 27% 28% 24% 27% 27% 25% 25% 25% 26% Specificity 77% 77% 74% 76% 76% 75% 75% 74% 75% OR Quartile 2 1.45 1.24 1.07 1.46 1.28 1.02 1.37 1.19 1.18 p Value 0.33 0.58 0.87 0.33 0.52 0.95 0.42 0.65 0.71 Lower limit of 0.688 0.587 0.466 0.686 0.606 0.445 0.636 0.559 0.500 95% CI Upper limit of 3.07 2.60 2.46 3.11 2.71 2.36 2.95 2.55 2.78 95% CI OR Quartile 3 2.07 1.81 2.12 1.87 1.72 2.00 1.53 1.40 2.18 p Value 0.028 0.073 0.046 0.059 0.10 0.067 0.21 0.32 0.043 Lower limit of 1.08 0.947 1.01 0.977 0.899 0.952 0.792 0.725 1.03 95% CI Upper limit of 3.97 3.47 4.44 3.60 3.31 4.20 2.94 2.69 4.63 95% CI OR Quartile 4 1.22 1.24 0.933 1.22 1.20 0.976 0.986 0.971 1.02 p Value 0.60 0.57 0.87 0.60 0.63 0.95 0.97 0.94 0.96 Lower limit of 0.582 0.593 0.406 0.583 0.573 0.424 0.465 0.458 0.443 95% CI Upper limit of 2.54 2.59 2.14 2.55 2.51 2.25 2.09 2.06 2.36 95% CI

TABLE-US-00166 TABLE 20.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3930 4670 3930 4580 4090 4480 Average 4330 5030 4350 5030 4590 4770 Stdev 2660 3300 2640 3350 2860 3190 p (t-test) 0.15 0.17 0.71 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 78 73 81 70 88 63 sCr only Median 3930 4670 3930 4580 4090 4490 Average 4340 5050 4360 5050 4510 4900 Stdev 2640 3340 2620 3390 2760 3330 p (t-test) 0.15 0.16 0.44 Min 276 62.8 276 62.8 276 62.8 Max 11800 21200 11800 21200 13800 21200 n (Patient) 79 71 82 68 88 62 UO only Median 3930 4790 3930 4790 3930 4800 Average 4500 5170 4500 5170 4470 5270 Stdev 2780 3480 2780 3480 2780 3460 p (t-test) 0.22 0.22 0.15 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.56 0.57 0.56 0.56 0.57 0.52 0.53 0.58 SE 0.047 0.047 0.053 0.047 0.047 0.053 0.048 0.048 0.053 p Value 0.16 0.17 0.21 0.20 0.22 0.21 0.66 0.51 0.12 nCohort Non- 78 79 108 81 82 108 88 88 109 persistent nCohort Persistent 73 71 42 70 68 42 63 62 41 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 77% 76% 79% 78% 76% 78% 77% 78% Specificity 28% 28% 26% 28% 28% 26% 27% 27% 27% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 59% 58% 62% 59% 57% 62% 56% 55% 63% Specificity 58% 57% 55% 57% 56% 55% 53% 53% 55% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 27% 28% 24% 27% 28% 24% 24% 26% 24% Specificity 77% 77% 74% 77% 77% 74% 74% 75% 74% OR Quartile 2 1.40 1.33 1.12 1.45 1.38 1.12 1.31 1.29 1.29 p Value 0.37 0.46 0.79 0.33 0.40 0.79 0.48 0.52 0.56 Lower limit of 0.666 0.631 0.488 0.688 0.651 0.488 0.616 0.603 0.549 95% CI Upper limit of 2.94 2.79 2.57 3.07 2.91 2.57 2.80 2.74 3.02 95% CI OR Quartile 3 1.95 1.81 1.96 1.86 1.72 1.96 1.43 1.39 2.12 p Value 0.042 0.073 0.071 0.061 0.10 0.071 0.28 0.32 0.046 Lower limit of 1.02 0.946 0.944 0.972 0.898 0.944 0.748 0.725 1.01 95% CI Upper limit of 3.73 3.46 4.06 3.55 3.29 4.06 2.74 2.67 4.44 95% CI OR Quartile 4 1.26 1.33 0.893 1.22 1.29 0.893 0.883 1.04 0.933 p Value 0.54 0.45 0.79 0.60 0.50 0.79 0.75 0.91 0.87 Lower limit of 0.602 0.636 0.389 0.582 0.615 0.389 0.417 0.495 0.406 95% CI Upper limit of 2.63 2.78 2.05 2.54 2.69 2.05 1.87 2.20 2.14 95% CI

Example 21. Use of CC Motif Chemokine 15 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0181] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 15 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0182] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0183] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00167 TABLE 21.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.1 428 59.2 423 58.2 565 Average 764 2280 881 2540 859 2820 Stdev 4180 6070 3730 6700 3560 7110 p (t-test) 0.017 0.0070 0.0015 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 118 198 157 159 178 138 sCr only Median 22.1 428 59.2 434 57.2 596 Average 738 2400 843 2640 812 2980 Stdev 4000 6250 3680 6790 3510 7250 p (t-test) 0.0080 0.0036 5.0E4 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 129 186 161 154 183 132 UO only Median 108 420 127 434 127 585 Average 1750 1620 1740 1630 1710 1780 Stdev 6070 2990 5930 3050 5860 3210 p (t-test) 0.86 0.88 0.94 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 18400 53500 18400 53500 18400 n (Patient) 240 74 255 59 262 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.61 0.67 0.68 0.59 0.69 0.71 0.61 SE 0.028 0.028 0.039 0.030 0.030 0.042 0.030 0.030 0.045 p Value 0 2.2E16 0.0048 2.6E8 1.5E9 0.026 1.1E10 1.5E12 0.011 nCohort Non- 118 129 240 157 161 255 178 183 262 persistent nCohort Persistent 198 186 74 159 154 59 138 132 52 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 85% 85% 85% 84% 85% 81% 86% 86% 83% Specificity 37% 36% 26% 31% 32% 24% 30% 31% 24% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 65% 66% 65% 63% 64% 66% 67% 70% 69% Specificity 75% 72% 55% 63% 63% 54% 63% 64% 54% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 36% 37% 32% 36% 38% 32% 40% 42% 35% Specificity 93% 92% 77% 87% 87% 76% 87% 87% 77% OR Quartile 2 3.33 3.38 1.99 2.25 2.64 1.40 2.57 2.79 1.54 p Value 1.2E5 1.1E5 0.054 0.0032 5.9E4 0.35 0.0012 6.2E4 0.27 Lower limit of 1.94 1.96 0.988 1.31 1.52 0.686 1.45 1.55 0.714 95% CI Upper limit of 5.71 5.81 4.03 3.87 4.59 2.87 4.55 5.03 3.34 95% CI OR Quartile 3 5.36 4.92 2.22 2.89 3.11 2.26 3.59 4.08 2.62 p Value 8.1E11 1.7E10 0.0039 5.1E6 1.3E6 0.0069 8.9E8 8.5E9 0.0030 Lower limit of 3.23 3.02 1.29 1.83 1.96 1.25 2.25 2.53 1.39 95% CI Upper limit of 8.90 8.03 3.81 4.57 4.93 4.09 5.74 6.58 4.96 95% CI OR Quartile 4 7.69 7.02 1.61 3.72 4.03 1.54 4.25 5.13 1.74 p Value 2.4E7 7.7E8 0.10 4.6E6 1.2E6 0.17 2.3E7 8.8E9 0.088 Lower limit of 3.54 3.45 0.911 2.12 2.29 0.832 2.46 2.94 0.921 95% CI Upper limit of 16.7 14.3 2.86 6.52 7.07 2.86 7.36 8.95 3.31 95% CI

TABLE-US-00168 TABLE 21.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.0 423 53.2 436 54.2 565 Average 793 2220 857 2450 849 2650 Stdev 4300 5980 3850 6490 3700 6810 p (t-test) 0.027 0.0096 0.0034 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 111 205 146 170 164 152 sCr only Median 22.0 428 53.2 436 53.2 576 Average 750 2360 836 2550 830 2740 Stdev 4060 6190 3770 6630 3650 6910 p (t-test) 0.011 0.0053 0.0020 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 125 190 153 162 168 147 UO only Median 88.0 406 110 434 113 565 Average 1750 1650 1740 1680 1700 1790 Stdev 6210 3290 6030 3410 5950 3540 p (t-test) 0.87 0.93 0.91 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 221 93 237 77 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.61 0.69 0.70 0.60 0.70 0.71 0.61 SE 0.028 0.028 0.036 0.029 0.029 0.038 0.029 0.029 0.040 p Value 0 0 0.0025 1.2E10 2.9E11 0.0086 3.9E12 3.2E13 0.0038 nCohort Non- 111 125 221 146 153 237 164 168 244 persistent nCohort Persistent 205 190 93 170 162 77 152 147 70 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 86% 84% 84% 86% 82% 85% 86% 83% Specificity 38% 38% 26% 32% 33% 25% 31% 32% 25% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 64% 65% 63% 64% 65% 65% 68% 69% 67% Specificity 76% 73% 56% 66% 65% 55% 66% 66% 55% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 35% 36% 31% 36% 38% 31% 39% 40% 33% Specificity 93% 92% 77% 88% 88% 77% 88% 88% 77% OR Quartile 2 3.29 3.64 1.85 2.51 3.02 1.49 2.53 3.01 1.61 p Value 1.4E5 3.4E6 0.055 7.9E4 9.3E5 0.23 0.0010 1.6E4 0.17 Lower limit of 1.92 2.11 0.987 1.47 1.74 0.779 1.46 1.70 0.811 95% CI Upper limit of 5.64 6.27 3.47 4.31 5.26 2.86 4.40 5.33 3.20 95% CI OR Quartile 3 5.51 5.03 2.18 3.54 3.48 2.25 4.17 4.28 2.49 p Value 1.2E10 1.5E10 0.0022 1.0E7 1.4E7 0.0029 2.6E9 1.7E9 0.0014 Lower limit of 3.28 3.07 1.32 2.22 2.19 1.32 2.60 2.66 1.42 95% CI Upper limit of 9.25 8.24 3.59 5.63 5.53 3.84 6.66 6.86 4.35 95% CI OR Quartile 4 6.82 6.56 1.55 4.36 4.53 1.50 4.57 4.96 1.64 p Value 1.2E6 2.1E7 0.11 1.2E6 4.3E7 0.16 1.8E7 4.0E8 0.094 Lower limit of 3.14 3.22 0.903 2.40 2.52 0.848 2.58 2.80 0.919 95% CI Upper limit of 14.8 13.3 2.66 7.89 8.14 2.65 8.08 8.79 2.94 95% CI

TABLE-US-00169 TABLE 21.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.1 414 53.2 434 53.2 550 Average 800 2210 870 2420 866 2560 Stdev 4320 5970 3890 6440 3770 6670 p (t-test) 0.030 0.012 0.0060 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 110 206 143 173 157 159 sCr only Median 22.1 414 54.2 434 54.2 550 Average 762 2330 848 2510 855 2640 Stdev 4090 6160 3800 6580 3720 6790 p (t-test) 0.013 0.0070 0.0039 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 123 192 150 165 162 153 UO only Median 91.3 347 116 351 118 406 Average 1810 1540 1780 1570 1740 1660 Stdev 6340 3150 6180 3250 6100 3360 p (t-test) 0.67 0.76 0.91 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 211 103 224 90 231 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.72 0.59 0.68 0.69 0.58 0.70 0.70 0.59 SE 0.028 0.028 0.035 0.030 0.030 0.036 0.029 0.029 0.037 p Value 4.4E16 1.3E15 0.0084 6.1E10 1.5E10 0.029 2.2E11 1.4E11 0.016 nCohort Non- 110 123 211 143 150 224 157 162 231 persistent nCohort Persistent 206 192 103 173 165 90 159 153 83 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 85% 83% 83% 85% 80% 84% 86% 81% Specificity 37% 37% 26% 31% 33% 25% 31% 32% 25% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 64% 65% 60% 64% 64% 60% 66% 67% 61% Specificity 75% 72% 55% 66% 65% 54% 66% 65% 54% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 34% 36% 31% 36% 37% 31% 38% 39% 33% Specificity 93% 92% 78% 88% 88% 77% 88% 88% 77% OR Quartile 2 3.12 3.24 1.66 2.28 2.72 1.30 2.43 2.81 1.37 p Value 3.3E5 1.9E5 0.093 0.0024 3.3E4 0.39 0.0014 2.9E4 0.32 Lower limit of 1.82 1.89 0.919 1.34 1.57 0.715 1.41 1.61 0.736 95% CI Upper limit of 5.33 5.56 3.02 3.88 4.69 2.37 4.19 4.92 2.56 95% CI OR Quartile 3 5.37 4.77 1.85 3.46 3.39 1.76 3.82 3.79 1.88 p Value 2.2E10 5.4E10 0.012 1.7E7 2.4E7 0.025 1.8E8 2.3E8 0.016 Lower limit of 3.20 2.91 1.14 2.17 2.13 1.07 2.39 2.37 1.13 95% CI Upper limit of 9.02 7.82 2.98 5.50 5.38 2.90 6.08 6.04 3.14 95% CI OR Quartile 4 6.71 6.34 1.57 4.14 4.30 1.53 4.40 4.46 1.66 p Value 1.5E6 3.5E7 0.093 2.8E6 1.0E6 0.12 4.8E7 2.8E7 0.073 Lower limit of 3.09 3.11 0.927 2.29 2.40 0.889 2.47 2.52 0.954 95% CI Upper limit of 14.6 12.9 2.67 7.50 7.72 2.64 7.84 7.88 2.89 95% CI

TABLE-US-00170 TABLE 21.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.0 406 53.2 434 53.2 537 Average 805 2200 875 2400 875 2530 Stdev 4340 5950 3910 6430 3800 6630 p (t-test) 0.032 0.014 0.0073 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 109 207 142 174 155 161 sCr only Median 22.1 414 53.2 434 53.2 544 Average 762 2330 853 2500 860 2620 Stdev 4090 6160 3820 6560 3730 6770 p (t-test) 0.013 0.0077 0.0043 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 123 192 149 166 161 154 UO only Median 88.0 338 115 338 115 341 Average 1850 1480 1820 1500 1790 1560 Stdev 6400 3110 6250 3180 6170 3270 p (t-test) 0.58 0.64 0.75 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 207 107 219 95 225 89 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.72 0.59 0.68 0.69 0.58 0.70 0.70 0.58 SE 0.028 0.028 0.034 0.030 0.030 0.036 0.029 0.029 0.036 p Value 2.2E16 1.3E15 0.011 6.8E10 1.7E10 0.035 2.4E11 1.6E11 0.021 nCohort Non- 109 123 207 142 149 219 155 161 225 persistent nCohort Persistent 207 192 107 174 166 95 161 154 89 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 85% 83% 83% 85% 81% 84% 86% 82% Specificity 38% 37% 27% 32% 33% 25% 32% 32% 25% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 64% 65% 60% 63% 64% 60% 66% 66% 62% Specificity 76% 72% 55% 66% 65% 54% 66% 65% 55% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 34% 36% 30% 36% 37% 29% 37% 38% 30% Specificity 93% 92% 77% 88% 88% 77% 88% 88% 77% OR Quartile 2 3.18 3.24 1.79 2.32 2.76 1.43 2.51 2.86 1.55 p Value 2.5E5 1.9E5 0.055 0.0020 2.6E4 0.24 9.0E4 2.3E4 0.17 Lower limit of 1.86 1.89 0.989 1.36 1.60 0.790 1.46 1.64 0.834 95% CI Upper limit of 5.44 5.56 3.24 3.95 4.77 2.61 4.34 5.01 2.87 95% CI OR Quartile 3 5.62 4.77 1.82 3.37 3.30 1.78 3.82 3.68 1.95 p Value 1.1E10 5.4E10 0.013 3.1E7 4.3E7 0.020 1.8E8 4.2E8 0.0090 Lower limit of 3.33 2.91 1.14 2.12 2.08 1.09 2.40 2.31 1.18 95% CI Upper limit of 9.49 7.82 2.93 5.36 5.23 2.91 6.08 5.86 3.22 95% CI OR Quartile 4 6.59 6.34 1.45 4.07 4.23 1.38 4.25 4.38 1.45 p Value 1.9E6 3.5E7 0.16 3.6E6 1.4E6 0.25 8.7E7 3.8E7 0.18 Lower limit of 3.04 3.11 0.858 2.25 2.36 0.801 2.39 2.48 0.838 95% CI Upper limit of 14.3 12.9 2.46 7.37 7.59 2.36 7.57 7.74 2.51 95% CI

TABLE-US-00171 TABLE 21.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 22.0 406 53.2 434 53.2 497 Average 799 2170 889 2350 893 2450 Stdev 4420 5900 3970 6340 3870 6530 p (t-test) 0.036 0.019 0.012 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 105 211 137 179 149 167 sCr only Median 22.1 423 53.2 436 53.2 544 Average 749 2320 836 2470 845 2590 Stdev 4130 6120 3860 6490 3770 6690 p (t-test) 0.014 0.0082 0.0047 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 34200 53500 34200 53500 34200 53500 n (Patient) 120 195 145 170 157 158 UO only Median 81.4 347 88.0 341 97.4 344 Average 1830 1530 1820 1530 1790 1570 Stdev 6480 3070 6350 3120 6280 3180 p (t-test) 0.65 0.66 0.74 Min 0.0116 0.0116 0.0116 0.0116 0.0116 0.0116 Max 53500 19200 53500 19200 53500 19200 n (Patient) 201 113 211 103 216 98 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.61 0.68 0.70 0.59 0.69 0.71 0.59 SE 0.028 0.028 0.034 0.030 0.029 0.035 0.029 0.029 0.035 p Value 0 2.2E16 0.0014 1.1E9 2.1E11 0.0075 4.6E11 1.9E12 0.0076 nCohort Non- 105 120 201 137 145 211 149 157 216 persistent nCohort Persistent 211 195 113 179 170 103 167 158 98 Cutoff Quartile 2 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 0.0489 Sensitivity 84% 85% 84% 83% 85% 83% 84% 85% 83% Specificity 38% 37% 27% 32% 33% 26% 32% 32% 26% Cutoff Quartile 3 155 154 155 155 154 155 155 154 155 Sensitivity 64% 65% 62% 63% 64% 61% 65% 66% 62% Specificity 77% 73% 57% 66% 66% 55% 66% 66% 56% Cutoff Quartile 4 909 912 902 909 912 902 909 912 902 Sensitivity 34% 36% 32% 35% 37% 31% 37% 39% 32% Specificity 93% 92% 79% 88% 89% 78% 88% 89% 78% OR Quartile 2 3.20 3.18 1.99 2.35 2.74 1.66 2.58 2.82 1.67 p Value 2.2E5 2.4E5 0.023 0.0016 2.7E4 0.093 6.1E4 2.4E4 0.098 Lower limit of 1.87 1.86 1.10 1.38 1.59 0.919 1.50 1.62 0.911 95% CI Upper limit of 5.49 5.45 3.59 4.00 4.71 3.02 4.43 4.91 3.05 95% CI OR Quartile 3 5.87 5.02 2.13 3.31 3.50 1.96 3.62 3.89 2.06 p Value 8.7E11 2.5E10 0.0016 5.0E7 1.3E7 0.0060 5.7E8 1.2E8 0.0037 Lower limit of 3.44 3.05 1.33 2.07 2.20 1.21 2.28 2.44 1.26 95% CI Upper limit of 10.0 8.28 3.42 5.27 5.58 3.17 5.77 6.20 3.36 95% CI OR Quartile 4 7.25 6.91 1.72 4.11 4.75 1.57 4.19 4.86 1.62 p Value 2.1E6 3.0E7 0.041 4.7E6 4.6E7 0.093 1.6E6 1.3E7 0.076 Lower limit of 3.20 3.30 1.02 2.24 2.59 0.927 2.33 2.70 0.950 95% CI Upper limit of 16.4 14.5 2.89 7.52 8.70 2.67 7.52 8.73 2.76 95% CI

TABLE-US-00172 TABLE 21.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3500 4670 3940 4690 4060 4580 Average 3630 5180 4270 5060 4340 5090 Stdev 2250 3190 2560 3340 2610 3410 p (t-test) 0.0024 0.10 0.13 Min 62.8 413 62.8 413 62.8 413 Max 10700 21200 11800 21200 11800 21200 n (Patient) 50 101 75 76 85 66 sCr only Median 3700 4680 3950 4670 3950 4720 Average 3750 5170 4340 4990 4300 5170 Stdev 2150 3280 2490 3410 2460 3570 p (t-test) 0.0056 0.19 0.079 Min 276 62.8 276 62.8 276 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 52 98 73 77 86 64 UO only Median 4050 4720 4050 4840 4120 4800 Average 4550 5100 4490 5500 4500 5660 Stdev 2770 3580 2700 3890 2680 4160 p (t-test) 0.33 0.096 0.076 Min 62.8 1120 62.8 1120 62.8 1630 Max 13800 21200 13800 21200 13800 21200 n (Patient) 112 38 120 30 125 25 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.63 0.54 0.56 0.55 0.58 0.56 0.57 0.58 SE 0.046 0.046 0.055 0.047 0.047 0.060 0.047 0.048 0.065 p Value 8.4E4 0.0045 0.44 0.17 0.32 0.16 0.24 0.17 0.22 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 79% 78% 76% 75% 73% 80% 76% 77% 80% Specificity 34% 31% 26% 25% 23% 27% 26% 27% 26% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 58% 57% 56% 67% 56% 58% 64% Specificity 66% 63% 53% 56% 56% 54% 54% 56% 53% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 32% 33% 24% 29% 30% 30% 29% 31% 28% Specificity 88% 88% 74% 79% 79% 76% 78% 79% 75% OR Quartile 2 1.96 1.54 1.13 1.02 0.810 1.45 1.09 1.19 1.43 p Value 0.081 0.27 0.79 0.96 0.58 0.45 0.82 0.65 0.50 Lower limit of 0.920 0.721 0.477 0.488 0.387 0.545 0.519 0.563 0.498 95% CI Upper limit of 4.18 3.27 2.66 2.12 1.70 3.88 2.29 2.52 4.13 95% CI OR Quartile 3 2.73 2.32 1.53 1.66 1.62 2.36 1.50 1.73 1.99 p Value 0.0054 0.017 0.26 0.12 0.14 0.045 0.22 0.100 0.13 Lower limit of 1.35 1.16 0.728 0.872 0.850 1.02 0.788 0.900 0.818 95% CI Upper limit of 5.53 4.63 3.22 3.16 3.09 5.47 2.87 3.33 4.84 95% CI OR Quartile 4 3.40 3.72 0.888 1.50 1.65 1.34 1.40 1.72 1.18 p Value 0.012 0.0067 0.79 0.28 0.19 0.51 0.37 0.15 0.74 Lower limit of 1.31 1.44 0.376 0.715 0.779 0.555 0.671 0.818 0.450 95% CI Upper limit of 8.80 9.61 2.10 3.16 3.48 3.26 2.94 3.60 3.09 95% CI

TABLE-US-00173 TABLE 21.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3620 4600 3930 4500 3940 4490 Average 3690 5130 4340 4950 4400 4960 Stdev 2220 3210 2550 3320 2610 3360 p (t-test) 0.0053 0.21 0.26 Min 62.8 276 62.8 276 62.8 276 Max 10700 21200 11800 21200 11800 21200 n (Patient) 49 102 70 81 79 72 sCr only Median 3730 4670 4000 4490 3940 4500 Average 3820 5120 4410 4910 4350 5030 Stdev 2120 3300 2500 3390 2480 3480 p (t-test) 0.012 0.31 0.17 Min 703 62.8 703 62.8 703 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 51 99 70 80 79 71 UO only Median 3940 4710 3940 4840 4050 4790 Average 4500 5110 4440 5420 4450 5520 Stdev 2770 3420 2700 3640 2680 3820 p (t-test) 0.25 0.078 0.067 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 103 47 111 39 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.56 0.55 0.53 0.59 0.54 0.55 0.59 SE 0.046 0.047 0.051 0.047 0.047 0.054 0.047 0.047 0.057 p Value 0.0027 0.012 0.27 0.30 0.48 0.089 0.38 0.31 0.13 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort Persistent 102 99 47 81 80 39 72 71 34 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 77% 77% 74% 72% 79% 75% 75% 79% Specificity 33% 29% 26% 24% 23% 27% 25% 25% 27% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 60% 57% 55% 67% 57% 56% 65% Specificity 65% 63% 54% 57% 56% 56% 56% 56% 54% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 31% 32% 26% 28% 29% 31% 28% 30% 29% Specificity 88% 88% 75% 79% 79% 77% 77% 78% 76% OR Quartile 2 1.76 1.38 1.16 0.916 0.781 1.44 1.02 0.998 1.41 p Value 0.14 0.41 0.71 0.82 0.51 0.42 0.96 1.00 0.47 Lower limit of 0.824 0.643 0.520 0.438 0.372 0.594 0.487 0.478 0.556 95% CI Upper limit of 3.77 2.95 2.60 1.92 1.64 3.47 2.12 2.09 3.56 95% CI OR Quartile 3 2.58 2.19 1.76 1.75 1.54 2.53 1.66 1.62 2.18 p Value 0.0086 0.026 0.11 0.089 0.19 0.017 0.12 0.14 0.054 Lower limit of 1.27 1.10 0.872 0.918 0.806 1.18 0.873 0.850 0.986 95% CI Upper limit of 5.24 4.39 3.54 3.34 2.93 5.43 3.17 3.09 4.81 95% CI OR Quartile 4 3.28 3.58 1.02 1.45 1.48 1.45 1.30 1.53 1.31 p Value 0.014 0.0085 0.97 0.33 0.31 0.37 0.48 0.26 0.53 Lower limit of 1.27 1.38 0.460 0.688 0.700 0.647 0.624 0.731 0.559 95% CI Upper limit of 8.48 9.26 2.24 3.07 3.13 3.26 2.72 3.21 3.07 95% CI

TABLE-US-00174 TABLE 21.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3620 4600 3930 4580 3920 4690 Average 3690 5130 4300 4980 4240 5090 Stdev 2220 3210 2550 3310 2530 3360 p (t-test) 0.0053 0.17 0.081 Min 62.8 276 62.8 276 62.8 276 Max 10700 21200 11800 21200 11800 21200 n (Patient) 49 102 69 82 75 76 sCr only Median 3730 4670 3940 4500 3930 4670 Average 3820 5120 4370 4930 4300 5040 Stdev 2120 3300 2500 3370 2490 3430 p (t-test) 0.012 0.25 0.13 Min 703 62.8 703 62.8 703 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 51 99 69 81 75 75 UO only Median 3930 4790 3920 4860 3930 4910 Average 4400 5250 4320 5550 4340 5650 Stdev 2720 3410 2660 3550 2630 3690 p (t-test) 0.098 0.021 0.018 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 98 52 105 45 110 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.58 0.56 0.54 0.62 0.58 0.56 0.62 SE 0.046 0.047 0.050 0.047 0.047 0.051 0.046 0.047 0.054 p Value 0.0027 0.012 0.096 0.22 0.37 0.017 0.10 0.20 0.027 nCohort Non- 49 51 98 69 69 105 75 75 110 persistent nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 77% 77% 74% 73% 80% 76% 75% 80% Specificity 33% 29% 27% 25% 23% 28% 27% 25% 27% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 62% 57% 56% 69% 59% 57% 68% Specificity 65% 63% 56% 58% 57% 58% 59% 57% 56% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 31% 32% 29% 29% 30% 33% 30% 31% 32% Specificity 88% 88% 77% 80% 80% 78% 80% 80% 77% OR Quartile 2 1.76 1.38 1.20 0.950 0.810 1.53 1.17 1.00 1.50 p Value 0.14 0.41 0.64 0.89 0.58 0.33 0.67 1.0 0.37 Lower limit of 0.824 0.643 0.549 0.454 0.385 0.655 0.561 0.479 0.621 95% CI Upper limit of 3.77 2.95 2.64 1.99 1.70 3.56 2.45 2.09 3.62 95% CI OR Quartile 3 2.58 2.19 2.05 1.85 1.62 3.07 2.06 1.81 2.68 p Value 0.0086 0.026 0.041 0.062 0.14 0.0030 0.029 0.073 0.011 Lower limit of 1.27 1.10 1.03 0.969 0.851 1.46 1.08 0.945 1.25 95% CI Upper limit of 5.24 4.39 4.07 3.54 3.10 6.44 3.94 3.45 5.74 95% CI OR Quartile 4 3.28 3.58 1.32 1.63 1.65 1.78 1.74 1.77 1.64 p Value 0.014 0.0085 0.47 0.21 0.19 0.14 0.15 0.14 0.23 Lower limit of 1.27 1.38 0.618 0.764 0.777 0.823 0.822 0.837 0.737 95% CI Upper limit of 8.48 9.26 2.83 3.46 3.52 3.86 3.67 3.74 3.64 95% CI

TABLE-US-00175 TABLE 21.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3620 4600 3930 4670 3860 4710 Average 3690 5130 4280 4980 4220 5100 Stdev 2220 3210 2560 3290 2540 3340 p (t-test) 0.0053 0.15 0.072 Min 62.8 276 62.8 276 62.8 276 Max 10700 21200 11800 21200 11800 21200 n (Patient) 49 102 68 83 74 77 sCr only Median 3730 4670 3930 4580 3930 4690 Average 3820 5120 4350 4940 4290 5050 Stdev 2120 3300 2510 3350 2500 3400 p (t-test) 0.012 0.23 0.12 Min 703 62.8 703 62.8 703 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 51 99 68 82 74 76 UO only Median 3920 4800 3920 4860 3930 4860 Average 4390 5200 4340 5400 4360 5470 Stdev 2750 3330 2710 3410 2680 3530 p (t-test) 0.11 0.041 0.037 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 95 55 100 50 105 45 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.62 0.58 0.56 0.55 0.61 0.58 0.57 0.60 SE 0.046 0.047 0.049 0.047 0.047 0.050 0.046 0.047 0.052 p Value 0.0027 0.012 0.089 0.17 0.31 0.027 0.081 0.16 0.043 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 77% 76% 75% 73% 78% 77% 75% 78% Specificity 33% 29% 26% 25% 24% 27% 27% 26% 27% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 62% 58% 56% 66% 60% 58% 64% Specificity 65% 63% 57% 59% 57% 58% 59% 58% 56% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 31% 32% 27% 29% 29% 30% 30% 30% 29% Specificity 88% 88% 76% 79% 79% 77% 80% 80% 76% OR Quartile 2 1.76 1.38 1.15 0.984 0.839 1.31 1.21 1.04 1.27 p Value 0.14 0.41 0.72 0.97 0.64 0.51 0.61 0.92 0.57 Lower limit of 0.824 0.643 0.533 0.470 0.399 0.588 0.582 0.496 0.558 95% CI Upper limit of 3.77 2.95 2.50 2.06 1.76 2.92 2.53 2.16 2.90 95% CI OR Quartile 3 2.58 2.19 2.13 1.96 1.72 2.68 2.18 1.91 2.32 p Value 0.0086 0.026 0.029 0.043 0.10 0.0063 0.019 0.051 0.022 Lower limit of 1.27 1.10 1.08 1.02 0.898 1.32 1.14 0.997 1.13 95% CI Upper limit of 5.24 4.39 4.20 3.75 3.29 5.44 4.17 3.65 4.79 95% CI OR Quartile 4 3.28 3.58 1.17 1.57 1.60 1.43 1.68 1.71 1.30 p Value 0.014 0.0085 0.68 0.24 0.23 0.35 0.18 0.16 0.51 Lower limit of 1.27 1.38 0.551 0.737 0.749 0.669 0.793 0.807 0.593 95% CI Upper limit of 8.48 9.26 2.50 3.34 3.40 3.08 3.54 3.61 2.85 95% CI

TABLE-US-00176 TABLE 21.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 3620 4600 3930 4490 3930 4500 Average 3740 5090 4360 4890 4340 4950 Stdev 2190 3220 2560 3280 2530 3340 p (t-test) 0.0100 0.28 0.21 Min 703 62.8 703 62.8 703 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 47 104 65 86 70 81 sCr only Median 3700 4680 3930 4580 3930 4690 Average 3790 5120 4360 4920 4290 5030 Stdev 2130 3280 2540 3320 2520 3370 p (t-test) 0.010 0.26 0.14 Min 703 62.8 703 62.8 703 62.8 Max 10700 21200 11800 21200 11800 21200 n (Patient) 50 100 66 84 72 78 UO only Median 3930 4750 3920 4800 3930 4780 Average 4430 5100 4410 5180 4420 5220 Stdev 2790 3280 2750 3340 2730 3410 p (t-test) 0.19 0.13 0.12 Min 62.8 513 62.8 513 62.8 513 Max 13800 21200 13800 21200 13800 21200 n (Patient) 92 58 95 55 99 51 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.62 0.57 0.55 0.55 0.58 0.55 0.56 0.57 SE 0.047 0.047 0.049 0.047 0.047 0.049 0.047 0.047 0.050 p Value 0.0049 0.0079 0.17 0.34 0.32 0.11 0.27 0.17 0.14 nCohort Non- 47 50 92 65 66 95 70 72 99 persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 2740 2730 2740 2740 2730 2740 2740 2730 2740 Sensitivity 78% 77% 76% 74% 74% 76% 75% 76% 76% Specificity 32% 30% 26% 25% 24% 26% 26% 26% 26% Cutoff Quartile 3 4230 4260 4260 4230 4260 4260 4230 4260 4260 Sensitivity 58% 57% 59% 57% 56% 62% 58% 58% 61% Specificity 66% 64% 55% 58% 58% 57% 59% 58% 56% Cutoff Quartile 4 6010 6060 6060 6010 6060 6060 6010 6060 6060 Sensitivity 31% 32% 26% 28% 29% 27% 28% 29% 25% Specificity 87% 88% 75% 78% 79% 76% 79% 79% 75% OR Quartile 2 1.65 1.43 1.11 0.950 0.902 1.15 1.06 1.11 1.16 p Value 0.20 0.35 0.79 0.89 0.79 0.72 0.89 0.78 0.72 Lower limit of 0.765 0.669 0.519 0.452 0.429 0.533 0.506 0.533 0.527 95% CI Upper limit of 3.56 3.08 2.37 2.00 1.90 2.50 2.20 2.32 2.54 95% CI OR Quartile 3 2.64 2.36 1.76 1.86 1.72 2.13 1.95 1.91 1.94 p Value 0.0080 0.016 0.095 0.061 0.10 0.029 0.043 0.051 0.059 Lower limit of 1.29 1.17 0.906 0.971 0.899 1.08 1.02 0.998 0.974 95% CI Upper limit of 5.42 4.75 3.43 3.58 3.31 4.20 3.74 3.65 3.85 95% CI OR Quartile 4 3.04 3.45 1.05 1.41 1.49 1.17 1.45 1.59 1.01 p Value 0.022 0.011 0.91 0.37 0.31 0.68 0.33 0.23 0.97 Lower limit of 1.17 1.33 0.492 0.662 0.697 0.551 0.688 0.752 0.466 95% CI Upper limit of 7.87 8.93 2.22 3.00 3.17 2.50 3.07 3.36 2.20 95% CI

Example 22. Use of CC Motif Chemokine 18 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0184] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 18 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0185] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0186] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00177 TABLE 22.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.870 1.22 0.716 1.23 0.716 1.18 Average 0.858 2.90 0.745 2.86 0.739 2.83 Stdev 0.658 9.70 0.561 9.57 0.588 9.49 p (t-test) 0.32 0.33 0.35 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.61 60.0 2.01 60.0 2.01 60.0 n (Patient) 23 109 20 112 18 114 sCr only Median 0.797 1.27 0.819 1.26 0.797 1.24 Average 0.783 3.07 0.794 3.04 0.786 3.02 Stdev 0.513 10.1 0.519 10.0 0.527 9.96 p (t-test) 0.22 0.23 0.24 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.01 60.0 2.01 60.0 2.01 60.0 n (Patient) 30 101 29 102 28 103 UO only Median 0.970 1.36 0.947 1.42 0.915 1.36 Average 1.06 5.16 0.957 4.78 0.923 4.33 Stdev 0.834 14.3 0.720 13.4 0.707 12.6 p (t-test) 0.010 0.014 0.028 Min 0.00242 0.273 0.00242 0.273 0.00242 0.273 Max 4.23 60.0 3.20 60.0 3.20 60.0 n (Patient) 83 48 76 55 68 63 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.69 0.67 0.70 0.68 0.71 0.70 0.68 0.71 SE 0.058 0.051 0.050 0.057 0.052 0.047 0.059 0.052 0.045 p Value 0.0071 2.4E4 8.4E4 5.7E4 5.5E4 4.6E6 9.9E4 5.0E4 4.7E6 nCohort Recovered 23 30 83 20 29 76 18 28 68 nCohort Non- 109 101 48 112 102 55 114 103 63 recovered Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 77% 78% 90% 78% 77% 91% 78% 78% 89% Specificity 35% 37% 34% 40% 34% 37% 44% 36% 38% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 54% 56% 67% 54% 56% 69% 54% 55% 65% Specificity 70% 70% 59% 75% 69% 63% 72% 68% 63% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 28% 31% 31% 28% 30% 36% 27% 30% 35% Specificity 87% 93% 78% 90% 93% 83% 89% 93% 84% OR Quartile 2 1.79 2.08 4.38 2.32 1.81 5.83 2.85 1.93 4.95 p Value 0.24 0.10 0.0050 0.099 0.20 8.0E4 0.046 0.15 7.0E4 Lower limit of 0.681 0.862 1.56 0.854 0.738 2.08 1.02 0.784 1.96 95% CI Upper limit of 4.71 5.01 12.3 6.30 4.43 16.4 7.98 4.76 12.5 95% CI OR Quartile 3 2.70 3.02 2.88 3.59 2.81 3.83 2.99 2.62 3.21 p Value 0.044 0.013 0.0052 0.020 0.021 3.6E4 0.050 0.033 0.0014 Lower limit of 1.03 1.26 1.37 1.22 1.17 1.83 1.00 1.08 1.57 95% CI Upper limit of 7.08 7.25 6.06 10.5 6.78 8.01 8.95 6.33 6.55 95% CI OR Quartile 4 2.53 6.20 1.64 3.44 5.89 2.77 2.99 5.60 2.78 p Value 0.16 0.017 0.23 0.11 0.020 0.014 0.16 0.024 0.015 Lower limit of 0.701 1.39 0.735 0.755 1.32 1.23 0.649 1.25 1.22 95% CI Upper limit of 9.14 27.7 3.66 15.7 26.3 6.23 13.8 25.1 6.36 95% CI

TABLE-US-00178 TABLE 22.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.695 1.32 0.659 1.32 0.604 1.30 Average 0.763 3.18 0.738 3.14 0.692 3.09 Stdev 0.593 10.2 0.599 10.1 0.577 10.0 p (t-test) 0.17 0.18 0.19 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.01 60.0 2.01 60.0 2.01 60.0 n (Patient) 35 97 33 99 30 102 sCr only Median 0.735 1.35 0.774 1.35 0.735 1.34 Average 0.781 3.36 0.788 3.33 0.782 3.31 Stdev 0.564 10.6 0.569 10.6 0.575 10.5 p (t-test) 0.12 0.13 0.13 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.01 60.0 2.01 60.0 2.01 60.0 n (Patient) 42 90 41 91 40 92 UO only Median 0.978 1.39 0.974 1.42 0.983 1.36 Average 1.08 5.69 1.06 5.25 1.04 4.66 Stdev 0.846 15.3 0.838 14.5 0.843 13.4 p (t-test) 0.0051 0.0091 0.020 Min 0.00242 0.273 0.00242 0.273 0.00242 0.273 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 89 42 84 47 76 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.72 0.67 0.73 0.71 0.68 0.74 0.71 0.67 SE 0.047 0.045 0.052 0.046 0.046 0.050 0.046 0.046 0.049 p Value 3.6E6 1.2E6 0.0010 1.0E6 3.6E6 4.4E4 1.2E7 3.3E6 5.8E4 nCohort Recovered 35 42 89 33 41 84 30 40 76 nCohort Non- 97 90 42 99 91 47 102 92 55 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 81% 82% 88% 82% 81% 89% 82% 82% 87% Specificity 43% 40% 31% 45% 39% 33% 50% 40% 34% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 58% 59% 69% 58% 58% 68% 57% 58% 64% Specificity 71% 69% 58% 73% 68% 60% 73% 68% 59% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 30% 32% 33% 29% 32% 34% 29% 32% 33% Specificity 89% 90% 79% 88% 90% 80% 90% 90% 80% OR Quartile 2 3.29 3.14 3.40 3.75 2.79 4.20 4.67 2.94 3.57 p Value 0.0056 0.0061 0.021 0.0024 0.014 0.0064 5.9E4 0.010 0.0070 Lower limit of 1.42 1.39 1.21 1.60 1.23 1.50 1.94 1.29 1.42 95% CI Upper limit of 7.65 7.14 9.57 8.81 6.32 11.8 11.2 6.70 8.98 95% CI OR Quartile 3 3.41 3.20 3.14 3.62 3.00 3.14 3.62 2.82 2.54 p Value 0.0040 0.0034 0.0040 0.0035 0.0056 0.0029 0.0050 0.0091 0.011 Lower limit of 1.48 1.47 1.44 1.53 1.38 1.48 1.48 1.29 1.24 95% CI Upper limit of 7.88 6.95 6.83 8.58 6.54 6.66 8.91 6.16 5.19 95% CI OR Quartile 4 3.31 4.52 1.84 3.00 4.33 2.03 3.75 4.14 1.98 p Value 0.038 0.0084 0.14 0.057 0.010 0.084 0.041 0.013 0.094 Lower limit of 1.07 1.47 0.813 0.969 1.41 0.910 1.06 1.35 0.891 95% CI Upper limit of 10.2 13.9 4.17 9.31 13.3 4.55 13.3 12.7 4.39 95% CI

TABLE-US-00179 TABLE 22.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.739 1.30 0.700 1.30 0.700 1.28 Average 0.865 3.50 0.851 3.45 0.842 3.34 Stdev 0.690 11.0 0.700 10.9 0.702 10.6 p (t-test) 0.100 0.11 0.13 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 3.02 60.0 3.02 60.0 3.02 60.0 n (Patient) 48 84 46 86 42 90 sCr only Median 0.797 1.34 0.819 1.33 0.819 1.28 Average 0.857 3.71 0.864 3.67 0.874 3.59 Stdev 0.614 11.4 0.617 11.3 0.622 11.2 p (t-test) 0.068 0.074 0.086 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.07 60.0 2.07 60.0 2.07 60.0 n (Patient) 54 78 53 79 51 81 UO only Median 1.02 1.36 1.00 1.36 1.00 1.36 Average 1.11 5.75 1.10 5.36 1.07 4.76 Stdev 0.842 15.5 0.855 14.8 0.863 13.7 p (t-test) 0.0050 0.0085 0.019 Min 0.00242 0.273 0.00242 0.273 0.00242 0.273 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 90 41 86 45 78 53 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.69 0.64 0.69 0.69 0.65 0.69 0.68 0.65 SE 0.046 0.045 0.054 0.046 0.046 0.052 0.047 0.046 0.050 p Value 4.4E5 1.7E5 0.010 2.5E5 4.2E5 0.0047 5.0E5 1.6E4 0.0023 nCohort Recovered 48 54 90 46 53 86 42 51 78 nCohort Non- 84 78 41 86 79 45 90 81 53 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 83% 83% 85% 84% 82% 87% 83% 81% 87% Specificity 40% 37% 30% 41% 36% 31% 43% 35% 33% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 58% 59% 63% 58% 58% 64% 57% 57% 62% Specificity 65% 63% 56% 65% 62% 57% 64% 61% 58% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 32% 35% 32% 31% 34% 31% 31% 33% 32% Specificity 88% 89% 78% 87% 89% 78% 88% 88% 79% OR Quartile 2 3.28 2.94 2.50 3.62 2.59 2.97 3.75 2.40 3.29 p Value 0.0043 0.0092 0.066 0.0021 0.020 0.028 0.0017 0.033 0.012 Lower limit of 1.45 1.31 0.942 1.59 1.16 1.12 1.64 1.08 1.30 95% CI Upper limit of 7.40 6.63 6.64 8.22 5.81 7.87 8.56 5.36 8.28 95% CI OR Quartile 3 2.55 2.44 2.17 2.60 2.30 2.40 2.35 2.04 2.25 p Value 0.012 0.014 0.046 0.012 0.022 0.021 0.027 0.051 0.026 Lower limit of 1.23 1.20 1.01 1.24 1.13 1.14 1.10 0.998 1.10 95% CI Upper limit of 5.32 4.99 4.63 5.47 4.69 5.06 5.02 4.16 4.60 95% CI OR Quartile 4 3.32 4.24 1.62 3.05 4.07 1.59 3.34 3.75 1.83 p Value 0.015 0.0035 0.25 0.024 0.0045 0.26 0.022 0.0075 0.14 Lower limit of 1.26 1.61 0.713 1.15 1.54 0.708 1.19 1.42 0.825 95% CI Upper limit of 8.75 11.2 3.71 8.06 10.7 3.58 9.41 9.88 4.06 95% CI

TABLE-US-00180 TABLE 22.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.774 1.35 0.704 1.33 0.700 1.30 Average 0.862 3.74 0.846 3.61 0.837 3.45 Stdev 0.661 11.4 0.678 11.2 0.684 10.9 p (t-test) 0.065 0.080 0.11 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 3.02 60.0 3.02 60.0 3.02 60.0 n (Patient) 55 77 51 81 46 86 sCr only Median 0.774 1.36 0.797 1.35 0.819 1.35 Average 0.842 3.83 0.849 3.79 0.861 3.74 Stdev 0.606 11.6 0.609 11.5 0.608 11.4 p (t-test) 0.054 0.059 0.065 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 2.07 60.0 2.07 60.0 2.07 60.0 n (Patient) 57 75 56 76 55 77 UO only Median 1.02 1.36 1.00 1.36 1.02 1.35 Average 1.09 5.57 1.08 5.20 1.08 4.67 Stdev 0.825 15.1 0.840 14.5 0.864 13.6 p (t-test) 0.0063 0.010 0.022 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 88 43 84 47 77 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.71 0.64 0.71 0.70 0.65 0.70 0.69 0.64 SE 0.045 0.044 0.053 0.045 0.045 0.051 0.046 0.045 0.050 p Value 5.3E6 1.6E6 0.0064 4.1E6 4.5E6 0.0045 1.4E5 2.0E5 0.0056 nCohort Recovered 55 57 88 51 56 84 46 55 77 nCohort Non- 77 75 43 81 76 47 86 77 54 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 84% 85% 84% 85% 84% 85% 85% 83% 85% Specificity 38% 39% 30% 41% 38% 31% 43% 36% 32% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 61% 61% 63% 60% 61% 64% 58% 60% 61% Specificity 65% 65% 56% 67% 64% 57% 65% 64% 57% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 35% 36% 35% 33% 36% 32% 33% 35% 31% Specificity 89% 89% 80% 88% 89% 79% 89% 89% 79% OR Quartile 2 3.35 3.66 2.16 4.02 3.20 2.56 4.32 2.81 2.76 p Value 0.0040 0.0023 0.11 9.9E4 0.0054 0.047 5.5E4 0.012 0.025 Lower limit of 1.47 1.59 0.851 1.76 1.41 1.01 1.88 1.25 1.14 95% CI Upper limit of 7.61 8.41 5.47 9.22 7.27 6.47 9.90 6.33 6.73 95% CI OR Quartile 3 2.97 2.93 2.12 3.06 2.76 2.35 2.60 2.60 2.10 p Value 0.0031 0.0032 0.049 0.0028 0.0053 0.023 0.012 0.0088 0.041 Lower limit of 1.44 1.43 1.00 1.47 1.35 1.13 1.24 1.27 1.03 95% CI Upper limit of 95% CI 6.10 6.00 4.48 6.37 5.64 4.91 5.47 5.30 4.26 OR Quartile 4 4.41 4.78 2.08 3.75 4.59 1.72 3.96 4.41 1.75 p Value 0.0027 0.0015 0.077 0.0075 0.0020 0.19 0.0090 0.0027 0.17 Lower limit of 1.67 1.82 0.924 1.42 1.74 0.769 1.41 1.67 0.791 95% CI Upper limit of 95% CI 11.6 12.6 4.70 9.88 12.1 3.84 11.1 11.6 3.88

TABLE-US-00181 TABLE 22.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 1.02 1.35 1.02 1.33 1.02 1.33 Average 1.04 4.93 1.04 4.78 1.04 4.78 Stdev 0.797 13.9 0.805 13.7 0.805 13.7 p (t-test) 0.013 0.017 0.017 Min 0.00242 0.197 0.00242 0.197 0.00242 0.197 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 81 51 79 53 79 53 sCr only Median 0.950 1.35 0.950 1.35 0.950 1.35 Average 0.990 4.19 0.990 4.19 0.990 4.19 Stdev 0.779 12.5 0.779 12.5 0.779 12.5 p (t-test) 0.037 0.037 0.037 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 68 64 68 64 68 64 UO only Median 1.02 1.39 1.02 1.35 1.02 1.35 Average 1.09 5.46 1.10 5.26 1.10 5.18 Stdev 0.828 15.0 0.836 14.7 0.841 14.5 p (t-test) 0.0073 0.0098 0.011 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 87 44 85 46 84 47 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.66 0.64 0.65 0.66 0.63 0.65 0.66 0.63 SE 0.050 0.047 0.053 0.050 0.047 0.052 0.050 0.047 0.052 p Value 0.0020 7.5E4 0.0087 0.0029 7.5E4 0.012 0.0029 7.5E4 0.011 nCohort Recovered 81 68 87 79 68 85 79 68 84 nCohort Non- 51 64 44 53 64 46 53 64 47 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 86% 84% 84% 87% 84% 85% 87% 84% 85% Specificity 32% 34% 30% 33% 34% 31% 33% 34% 31% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 59% 61% 61% 58% 61% 61% 58% 61% 62% Specificity 56% 60% 55% 56% 60% 55% 56% 60% 56% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 35% 34% 34% 34% 34% 33% 34% 34% 32% Specificity 81% 84% 79% 81% 84% 79% 81% 84% 79% OR Quartile 2 2.97 2.76 2.25 3.22 2.76 2.46 3.22 2.76 2.56 p Value 0.021 0.018 0.087 0.013 0.018 0.058 0.013 0.018 0.047 Lower limit of 1.18 1.19 0.890 1.28 1.19 0.971 1.28 1.19 1.01 95% CI Upper limit of 7.49 6.40 5.71 8.12 6.40 6.21 8.12 6.40 6.47 95% CI OR Quartile 3 1.79 2.37 1.95 1.77 2.37 1.92 1.77 2.37 2.05 p Value 0.11 0.016 0.076 0.11 0.016 0.079 0.11 0.016 0.054 Lower limit of 0.879 1.18 0.933 0.876 1.18 0.927 0.876 1.18 0.987 95% CI Upper limit of 3.63 4.76 4.09 3.58 4.76 3.99 3.58 4.76 4.24 95% CI OR Quartile 4 2.40 2.71 1.98 2.19 2.71 1.80 2.19 2.71 1.72 p Value 0.033 0.018 0.098 0.054 0.018 0.15 0.054 0.018 0.19 Lower limit of 1.08 1.19 0.881 0.986 1.19 0.804 0.986 1.19 0.769 95% CI Upper limit of 5.36 6.20 4.46 4.88 6.20 4.04 4.88 6.20 3.84 95% CI

Example 23. Use of CC Motif Chemokine 18 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0187] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 18 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0188] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0189] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00182 TABLE 23.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non Recovered recovered Recovered recovered Recovered covered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.822 1.30 0.822 1.30 0.822 1.28 Average 0.944 3.40 0.944 3.40 0.955 3.34 Stdev 0.827 10.9 0.827 10.9 0.843 10.7 p (t-test) 0.13 0.13 0.15 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 46 86 46 86 44 88 sCr only Median 0.819 1.34 0.819 1.34 0.870 1.31 Average 0.934 3.71 0.934 3.71 0.952 3.63 Stdev 0.778 11.5 0.778 11.5 0.787 11.4 p (t-test) 0.077 0.077 0.090 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 55 76 55 76 53 78 UO only Median 1.02 1.42 0.974 1.43 1.00 1.36 Average 1.71 4.64 1.70 4.33 1.74 4.02 Stdev 6.16 13.3 6.33 12.5 6.48 12.0 p (t-test) 0.086 0.11 0.16 Min 0.00242 0.273 0.00242 0.273 0.00242 0.273 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 93 38 88 43 84 47 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.67 0.66 0.66 0.67 0.69 0.65 0.66 0.66 SE 0.048 0.047 0.055 0.048 0.047 0.051 0.049 0.047 0.051 p Value 8.0E4 2.0E4 0.0031 8.0E4 2.0E4 2.0E4 0.0020 8.6E4 0.0019 nCohort Recovered 46 55 93 46 55 88 44 53 84 nCohort Non- 86 76 38 86 76 43 88 78 47 recovered Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 81% 83% 87% 81% 83% 88% 81% 81% 87% Specificity 37% 36% 30% 37% 36% 32% 36% 34% 32% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 58% 61% 68% 58% 61% 70% 57% 59% 64% Specificity 65% 64% 57% 65% 64% 59% 64% 62% 57% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 29% 33% 34% 29% 33% 37% 28% 32% 34% Specificity 83% 85% 78% 83% 85% 81% 82% 85% 80% OR Quartile 2 2.56 2.77 2.84 2.56 2.77 3.55 2.39 2.16 3.24 p Value 0.022 0.014 0.049 0.022 0.014 0.016 0.035 0.059 0.018 Lower limit of 1.14 1.23 1.01 1.14 1.23 1.26 1.06 0.970 1.23 95% CI Upper limit of 5.76 6.23 8.04 5.76 6.23 9.98 5.37 4.81 8.55 95% CI OR Quartile 3 2.60 2.68 2.87 2.60 2.68 3.33 2.30 2.37 2.35 p Value 0.012 0.0069 0.0096 0.012 0.0069 0.0024 0.028 0.018 0.023 Lower limit of 1.24 1.31 1.29 1.24 1.31 1.53 1.09 1.16 1.13 95% CI Upper limit of 5.47 5.49 6.37 5.47 5.49 7.25 4.85 4.85 4.91 95% CI OR Quartile 4 1.95 2.88 1.90 1.95 2.88 2.47 1.79 2.65 2.03 p Value 0.14 0.020 0.13 0.14 0.020 0.029 0.20 0.032 0.084 Lower limit of 0.797 1.18 0.825 0.797 1.18 1.10 0.729 1.09 0.910 95% CI Upper limit of 4.76 7.01 4.37 4.76 7.01 5.59 4.37 6.46 4.55 95% CI

TABLE-US-00183 TABLE 23.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.940 1.33 0.940 1.33 0.960 1.32 Average 0.935 3.76 0.935 3.76 0.944 3.68 Stdev 0.763 11.6 0.763 11.6 0.774 11.5 p (t-test) 0.069 0.069 0.079 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 57 75 57 75 55 77 sCr only Median 0.905 1.36 0.905 1.36 0.950 1.35 Average 0.928 4.06 0.928 4.06 0.943 3.96 Stdev 0.731 12.1 0.731 12.1 0.738 12.0 p (t-test) 0.041 0.041 0.050 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 64 68 64 68 62 70 UO only Median 0.983 1.36 0.974 1.42 1.00 1.36 Average 1.71 4.72 1.69 4.60 1.75 4.10 Stdev 6.13 13.4 6.20 13.1 6.41 12.2 p (t-test) 0.080 0.086 0.15 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 94 37 92 39 86 45 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.69 0.67 0.67 0.69 0.69 0.66 0.67 0.65 SE 0.046 0.046 0.055 0.046 0.046 0.053 0.047 0.046 0.052 p Value 2.0E4 3.2E5 0.0023 2.0E4 3.2E5 3.9E4 5.4E4 1.7E4 0.0039 nCohort Recovered 57 64 94 57 64 92 55 62 86 nCohort Non- 75 68 37 75 68 39 77 70 45 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 84% 85% 89% 84% 85% 90% 83% 83% 89% Specificity 37% 36% 31% 37% 36% 32% 36% 34% 33% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 59% 60% 70% 59% 60% 72% 57% 59% 64% Specificity 61% 61% 57% 61% 61% 59% 60% 60% 57% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 33% 37% 32% 33% 37% 36% 32% 36% 31% Specificity 86% 88% 78% 86% 88% 79% 85% 87% 78% OR Quartile 2 3.06 3.25 3.68 3.06 3.25 4.03 2.81 2.48 3.86 p Value 0.0074 0.0061 0.023 0.0074 0.0061 0.015 0.012 0.029 0.010 Lower limit of 1.35 1.40 1.19 1.35 1.40 1.31 1.25 1.10 1.37 95% CI Upper limit of 6.95 7.56 11.4 6.95 7.56 12.4 6.33 5.59 10.9 95% CI OR Quartile 3 2.26 2.37 3.19 2.26 2.37 3.62 2.00 2.09 2.40 p Value 0.023 0.016 0.0053 0.023 0.016 0.0019 0.053 0.037 0.021 Lower limit of 1.12 1.18 1.41 1.12 1.18 1.61 0.990 1.04 1.14 95% CI Upper limit of 4.57 4.76 7.21 4.57 4.76 8.14 4.04 4.19 5.06 95% CI OR Quartile 4 3.06 4.07 1.67 3.06 4.07 2.15 2.82 3.75 1.59 p Value 0.014 0.0020 0.23 0.014 0.0020 0.069 0.022 0.0036 0.26 Lower limit of 1.26 1.67 0.719 1.26 1.67 0.942 1.16 1.54 0.708 95% CI Upper limit of 7.44 9.91 3.87 7.44 9.91 4.92 6.87 9.12 3.58 95% CI

TABLE-US-00184 TABLE 23.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.970 1.35 0.970 1.35 0.970 1.33 Average 0.991 4.05 0.991 4.05 0.987 3.96 Stdev 0.774 12.2 0.774 12.2 0.785 12.1 p (t-test) 0.047 0.047 0.053 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 65 67 65 67 63 69 sCr only Median 0.960 1.36 0.960 1.36 0.965 1.36 Average 0.948 4.18 0.948 4.18 0.955 4.13 Stdev 0.723 12.4 0.723 12.4 0.726 12.3 p (t-test) 0.035 0.035 0.039 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 67 65 67 65 66 66 UO only Median 1.02 1.36 1.02 1.36 1.02 1.35 Average 1.72 4.78 1.72 4.78 1.76 4.27 Stdev 6.10 13.6 6.10 13.6 6.30 12.7 p (t-test) 0.078 0.078 0.13 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 95 36 95 36 89 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.68 0.64 0.65 0.68 0.64 0.65 0.67 0.63 SE 0.048 0.047 0.056 0.048 0.047 0.056 0.047 0.047 0.053 p Value 0.0014 1.1E4 0.012 0.0014 1.1E4 0.012 0.0014 2.5E4 0.012 nCohort Recovered 65 67 95 65 67 95 63 66 89 nCohort Non- 67 65 36 67 65 36 69 66 42 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 84% 85% 86% 84% 85% 86% 84% 83% 88% Specificity 34% 34% 29% 34% 34% 29% 35% 33% 31% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 58% 60% 64% 58% 60% 64% 58% 59% 62% Specificity 58% 60% 55% 58% 60% 55% 59% 59% 55% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 34% 37% 33% 34% 37% 33% 33% 36% 31% Specificity 85% 87% 78% 85% 87% 78% 84% 86% 78% OR Quartile 2 2.60 2.88 2.59 2.60 2.88 2.59 2.83 2.50 3.40 p Value 0.023 0.014 0.073 0.023 0.014 0.073 0.014 0.030 0.021 Lower limit of 1.14 1.24 0.914 1.14 1.24 0.914 1.24 1.10 1.21 95% CI Upper limit of 5.95 6.67 7.35 5.95 6.67 7.35 6.47 5.71 9.57 95% CI OR Quartile 3 1.96 2.22 2.14 1.96 2.22 2.14 1.96 2.09 1.99 p Value 0.057 0.025 0.059 0.057 0.025 0.059 0.056 0.038 0.072 Lower limit of 0.981 1.11 0.970 0.981 1.11 0.970 0.982 1.04 0.940 95% CI Upper limit of 3.92 4.46 4.72 3.92 4.46 4.72 3.92 4.18 4.21 95% CI OR Quartile 4 2.87 3.77 1.76 2.87 3.77 1.76 2.65 3.62 1.55 p Value 0.014 0.0026 0.19 0.014 0.0026 0.19 0.023 0.0035 0.30 Lower limit of 1.24 1.59 0.756 1.24 1.59 0.756 1.14 1.53 0.680 95% CI Upper limit of 6.67 8.95 4.10 6.67 8.95 4.10 6.14 8.58 3.52 95% CI

TABLE-US-00185 TABLE 23.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.970 1.35 0.979 1.34 0.979 1.33 Average 1.84 3.31 1.86 3.27 1.88 3.20 Stdev 7.14 10.4 7.20 10.3 7.30 10.2 p (t-test) 0.34 0.36 0.39 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 69 63 68 64 66 66 sCr only Median 0.965 1.36 0.965 1.36 0.970 1.36 Average 1.79 3.39 1.79 3.39 1.81 3.34 Stdev 7.09 10.5 7.09 10.5 7.14 10.4 p (t-test) 0.30 0.30 0.32 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 70 62 70 62 69 63 UO only Median 1.02 1.36 1.04 1.36 1.02 1.35 Average 1.73 4.44 1.75 4.35 1.76 4.14 Stdev 6.23 13.0 6.26 12.8 6.37 12.4 p (t-test) 0.11 0.12 0.15 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 91 40 90 41 87 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.67 0.64 0.64 0.67 0.63 0.64 0.66 0.63 SE 0.048 0.047 0.054 0.048 0.047 0.054 0.048 0.048 0.053 p Value 0.0024 4.1E4 0.0096 0.0040 4.1E4 0.016 0.0040 8.4E4 0.012 nCohort Recovered 69 70 91 68 70 90 66 69 87 nCohort Non- 63 62 40 64 62 41 66 63 44 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 83% 84% 85% 83% 84% 85% 83% 83% 86% Specificity 32% 33% 30% 32% 33% 30% 33% 32% 31% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 59% 60% 62% 58% 60% 61% 58% 59% 61% Specificity 58% 59% 55% 57% 59% 54% 58% 58% 55% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 35% 37% 35% 34% 37% 34% 33% 37% 32% Specificity 84% 86% 79% 84% 86% 79% 83% 86% 78% OR Quartile 2 2.21 2.54 2.39 2.30 2.54 2.50 2.50 2.21 2.85 p Value 0.059 0.029 0.081 0.047 0.029 0.066 0.030 0.059 0.035 Lower limit of 0.970 1.10 0.899 1.01 1.10 0.942 1.10 0.970 1.08 95% CI Upper limit of 5.05 5.90 6.35 5.26 5.90 6.64 5.71 5.05 7.54 95% CI OR Quartile 3 1.96 2.09 2.03 1.84 2.09 1.87 1.84 1.96 1.95 p Value 0.056 0.037 0.068 0.083 0.037 0.10 0.083 0.056 0.076 Lower limit of 0.982 1.04 0.949 0.924 1.04 0.880 0.923 0.982 0.933 95% CI Upper limit of 3.92 4.19 4.35 3.68 4.19 3.96 3.67 3.92 4.09 95% CI OR Quartile 4 2.83 3.54 2.04 2.71 3.54 1.94 2.50 3.39 1.67 p Value 0.014 0.0034 0.090 0.018 0.0034 0.11 0.030 0.0046 0.22 Lower limit of 1.24 1.52 0.896 1.19 1.52 0.853 1.10 1.46 0.741 95% CI Upper limit of 6.47 8.24 4.65 6.20 8.24 4.40 5.71 7.89 3.77 95% CI

TABLE-US-00186 TABLE 23.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 1.02 1.36 1.04 1.35 1.02 1.35 Average 1.73 4.22 1.75 4.13 1.75 4.07 Stdev 6.30 12.5 6.33 12.4 6.37 12.2 p (t-test) 0.13 0.14 0.15 Min 0.00242 0.197 0.00242 0.197 0.00242 0.197 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 89 43 88 44 87 45 sCr only Median 0.989 1.36 0.989 1.36 0.989 1.36 Average 1.78 3.68 1.78 3.68 1.78 3.68 Stdev 6.68 11.3 6.68 11.3 6.68 11.3 p (t-test) 0.23 0.23 0.23 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 79 53 79 53 79 53 UO only Median 1.05 1.35 1.05 1.35 1.05 1.34 Average 1.74 4.43 1.75 4.33 1.76 4.26 Stdev 6.23 13.0 6.26 12.8 6.30 12.7 p (t-test) 0.11 0.12 0.13 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 91 40 90 41 89 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.64 0.63 0.62 0.64 0.62 0.63 0.64 0.62 SE 0.053 0.050 0.054 0.053 0.050 0.054 0.052 0.050 0.054 p Value 0.011 0.0054 0.017 0.018 0.0054 0.027 0.016 0.0054 0.023 nCohort Recovered 89 79 91 88 79 90 87 79 89 nCohort Non- 43 53 40 44 53 41 45 53 42 recovered Cutoff Quartile 2 0.561 0.561 0.569 0.561 0.561 0.569 0.561 0.561 0.569 Sensitivity 84% 81% 85% 84% 81% 85% 84% 81% 86% Specificity 29% 29% 30% 30% 29% 30% 30% 29% 30% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 62% 60% 59% 62% 59% 60% 62% 60% Specificity 55% 58% 54% 55% 58% 53% 55% 58% 54% Cutoff Quartile 4 1.65 1.65 1.66 1.65 1.65 1.66 1.65 1.65 1.66 Sensitivity 35% 36% 35% 34% 36% 34% 33% 36% 33% Specificity 80% 82% 79% 80% 82% 79% 79% 82% 79% OR Quartile 2 2.12 1.77 2.39 2.22 1.77 2.50 2.31 1.77 2.61 p Value 0.11 0.19 0.081 0.093 0.19 0.066 0.076 0.19 0.054 Lower limit of 0.838 0.761 0.899 0.876 0.761 0.942 0.915 0.761 0.985 95% CI Upper limit of 5.38 4.10 6.35 5.61 4.10 6.64 5.85 4.10 6.93 95% CI OR Quartile 3 1.87 2.30 1.75 1.73 2.30 1.61 1.85 2.30 1.72 p Value 0.097 0.022 0.15 0.14 0.022 0.21 0.10 0.022 0.15 Lower limit of 0.894 1.13 0.823 0.833 1.13 0.765 0.889 1.13 0.818 95% CI Upper limit of 3.93 4.69 3.72 3.61 4.69 3.40 3.83 4.69 3.62 95% CI OR Quartile 4 2.11 2.59 2.04 2.01 2.59 1.94 1.92 2.59 1.84 p Value 0.071 0.020 0.090 0.091 0.020 0.11 0.11 0.020 0.14 Lower limit of 0.937 1.16 0.896 0.894 1.16 0.853 0.854 1.16 0.813 95% CI Upper limit of 4.76 5.81 4.65 4.52 5.81 4.40 4.30 5.81 4.17 95% CI

Example 24. Use of CC Motif Chemokine 18 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0190] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 18 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0191] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0192] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00187 TABLE 24.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.989 1.36 0.978 1.54 0.989 1.54 Average 1.70 4.28 1.66 4.64 1.68 4.94 Stdev 6.30 12.5 6.16 13.1 6.04 13.8 p (t-test) 0.12 0.078 0.062 Min 0.00242 0.233 0.00242 0.233 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 89 43 93 39 97 35 sCr only Median 0.978 1.39 0.983 1.59 1.00 1.54 Average 1.69 4.37 1.65 4.81 1.69 4.90 Stdev 6.30 12.6 6.13 13.4 6.07 13.8 p (t-test) 0.11 0.066 0.066 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 89 42 94 37 96 35 UO only Median 1.06 1.58 1.06 1.74 1.06 1.74 Average 1.65 8.26 1.64 9.16 1.64 9.16 Stdev 5.60 18.9 5.55 19.9 5.55 19.9 p (t-test) 0.0030 0.0013 0.0013 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 113 18 115 16 115 16 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.68 0.71 0.70 0.70 0.73 0.68 0.67 0.73 SE 0.052 0.052 0.072 0.053 0.054 0.075 0.055 0.056 0.075 p Value 0.0013 4.8E4 0.0046 2.2E4 2.6E4 0.0018 8.4E4 0.0026 0.0018 nCohort Non- 89 89 113 93 94 115 97 96 115 persistent nCohort Persistent 43 42 18 39 37 16 35 35 16 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 88% 88% 94% 87% 86% 94% 89% 86% 94% Specificity 31% 31% 28% 30% 30% 28% 30% 29% 28% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 65% 69% 72% 72% 70% 75% 71% 69% 75% Specificity 57% 58% 53% 59% 57% 53% 58% 56% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 35% 36% 44% 38% 41% 50% 37% 37% 50% Specificity 80% 80% 78% 81% 81% 78% 79% 79% 78% OR Quartile 2 3.49 3.40 6.72 2.93 2.72 5.78 3.31 2.47 5.78 p Value 0.018 0.021 0.070 0.042 0.060 0.096 0.038 0.090 0.096 Lower limit of 1.24 1.21 0.858 1.04 0.959 0.733 1.07 0.870 0.733 95% CI Upper limit of 9.81 9.57 52.6 8.27 7.69 45.6 10.2 7.02 45.6 95% CI OR Quartile 3 2.51 3.14 2.94 3.68 3.19 3.39 3.41 2.81 3.39 p Value 0.017 0.0040 0.053 0.0016 0.0053 0.044 0.0040 0.014 0.044 Lower limit of 1.18 1.44 0.984 1.64 1.41 1.03 1.48 1.24 1.03 95% CI Upper limit of 5.33 6.83 8.80 8.29 7.21 11.1 7.88 6.37 11.1 95% CI OR Quartile 4 2.11 2.19 2.82 2.60 2.88 3.60 2.28 2.25 3.60 p Value 0.071 0.060 0.049 0.023 0.013 0.020 0.056 0.060 0.020 Lower limit of 0.937 0.969 1.00 1.14 1.25 1.23 0.978 0.965 1.23 95% CI Upper limit of 4.76 4.96 7.89 5.94 6.63 10.6 5.29 5.22 10.6 95% CI

TABLE-US-00188 TABLE 24.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.970 1.36 0.960 1.54 0.970 1.54 Average 1.73 3.75 1.67 4.12 1.68 4.32 Stdev 6.68 11.3 6.45 12.0 6.30 12.5 p (t-test) 0.20 0.13 0.11 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 79 53 85 47 89 43 sCr only Median 0.965 1.36 0.965 1.43 0.978 1.39 Average 1.72 3.84 1.68 4.09 1.71 4.20 Stdev 6.64 11.5 6.48 12.0 6.37 12.4 p (t-test) 0.18 0.14 0.13 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 80 51 84 47 87 44 UO only Median 1.05 1.48 1.05 1.58 1.05 1.58 Average 1.67 6.52 1.66 7.02 1.66 7.02 Stdev 5.75 16.5 5.70 17.2 5.70 17.2 p (t-test) 0.015 0.0093 0.0093 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 107 24 109 22 109 22 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.68 0.68 0.71 0.70 0.69 0.70 0.67 0.69 SE 0.049 0.049 0.065 0.049 0.050 0.067 0.051 0.052 0.067 p Value 3.3E4 2.6E4 0.0068 2.0E5 8.2E5 0.0039 7.5E5 9.1E4 0.0039 nCohort Non- 79 80 107 85 84 109 89 87 109 persistent nCohort Persistent 53 51 24 47 47 22 43 44 22 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 87% 86% 92% 87% 87% 91% 88% 86% 91% Specificity 33% 32% 29% 32% 32% 28% 31% 31% 28% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 62% 65% 67% 68% 66% 68% 70% 66% 68% Specificity 58% 59% 53% 60% 58% 53% 60% 57% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 38% 37% 42% 40% 38% 45% 40% 36% 45% Specificity 84% 82% 79% 84% 82% 79% 82% 80% 79% OR Quartile 2 3.22 3.03 4.49 3.18 3.24 3.97 3.49 2.85 3.97 p Value 0.013 0.019 0.051 0.019 0.018 0.074 0.018 0.035 0.074 Lower limit of 1.28 1.20 0.995 1.20 1.23 0.876 1.24 1.08 0.876 95% CI Upper limit of 8.12 7.63 20.2 8.40 8.55 18.0 9.81 7.54 18.0 95% CI OR Quartile 3 2.30 2.61 2.28 3.20 2.71 2.44 3.40 2.61 2.44 p Value 0.022 0.0096 0.082 0.0024 0.0085 0.073 0.0020 0.013 0.073 Lower limit of 1.13 1.26 0.900 1.51 1.29 0.921 1.56 1.23 0.921 95% CI Upper limit of 4.69 5.40 5.78 6.78 5.70 6.45 7.38 5.56 6.45 95% CI OR Quartile 4 3.08 2.80 2.61 3.44 2.86 3.12 2.98 2.35 3.12 p Value 0.0068 0.013 0.044 0.0030 0.011 0.020 0.0087 0.039 0.020 Lower limit of 1.36 1.25 1.03 1.52 1.27 1.20 1.32 1.05 1.20 95% CI Upper limit of 6.94 6.29 6.63 7.79 6.42 8.11 6.75 5.30 8.11 95% CI

TABLE-US-00189 TABLE 24.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.965 1.35 0.960 1.36 0.965 1.39 Average 1.79 3.50 1.73 3.75 1.72 3.88 Stdev 6.90 10.8 6.68 11.3 6.56 11.6 p (t-test) 0.27 0.20 0.17 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 74 58 79 53 82 50 sCr only Median 0.960 1.36 0.960 1.39 0.970 1.39 Average 1.75 3.68 1.71 3.90 1.72 3.98 Stdev 6.77 11.2 6.60 11.6 6.52 11.9 p (t-test) 0.22 0.17 0.16 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 77 54 81 50 83 48 UO only Median 1.05 1.36 1.05 1.45 1.05 1.45 Average 1.69 5.61 1.67 6.16 1.67 6.16 Stdev 5.89 15.1 5.80 15.9 5.80 15.9 p (t-test) 0.035 0.020 0.020 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 102 29 105 26 105 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.67 0.64 0.68 0.69 0.67 0.68 0.67 0.67 SE 0.048 0.049 0.061 0.049 0.049 0.063 0.049 0.050 0.063 p Value 0.0011 4.5E4 0.018 2.3E4 1.6E4 0.0058 2.3E4 5.2E4 0.0058 nCohort Non- 74 77 102 79 81 105 82 83 105 persistent nCohort Persistent 58 54 29 53 50 26 50 48 26 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 84% 85% 86% 85% 86% 88% 86% 85% 88% Specificity 32% 32% 28% 32% 32% 29% 32% 31% 29% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 63% 62% 64% 64% 65% 66% 65% 65% Specificity 58% 58% 53% 59% 58% 53% 60% 58% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 34% 35% 38% 36% 36% 42% 36% 35% 42% Specificity 82% 82% 78% 82% 81% 79% 82% 81% 79% OR Quartile 2 2.61 2.76 2.48 2.60 2.90 3.07 2.85 2.67 3.07 p Value 0.029 0.025 0.12 0.035 0.024 0.085 0.026 0.038 0.085 Lower limit of 1.10 1.14 0.794 1.07 1.15 0.857 1.13 1.06 0.857 95% CI Upper limit of 6.18 6.73 7.76 6.34 7.32 11.0 7.19 6.74 11.0 95% CI OR Quartile 3 2.11 2.39 1.84 2.63 2.46 2.16 2.88 2.50 2.16 p Value 0.036 0.017 0.16 0.0084 0.015 0.092 0.0046 0.014 0.092 Lower limit of 1.05 1.17 0.791 1.28 1.19 0.883 1.38 1.20 0.883 95% CI Upper limit of 4.25 4.88 4.29 5.39 5.08 5.28 6.00 5.21 5.28 95% CI OR Quartile 4 2.47 2.44 2.22 2.59 2.47 2.77 2.51 2.30 2.77 p Value 0.028 0.030 0.077 0.020 0.027 0.028 0.025 0.043 0.028 Lower limit of 1.10 1.09 0.916 1.16 1.11 1.11 1.12 1.03 1.11 95% CI Upper limit of 5.54 5.46 5.39 5.81 5.53 6.87 5.62 5.13 6.87 95% CI

TABLE-US-00190 TABLE 24.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.960 1.36 0.950 1.39 0.965 1.39 Average 1.79 3.47 1.73 3.71 1.74 3.77 Stdev 6.95 10.7 6.73 11.2 6.64 11.4 p (t-test) 0.28 0.21 0.20 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 73 59 78 54 80 52 sCr only Median 0.960 1.36 0.960 1.39 0.970 1.39 Average 1.77 3.59 1.73 3.79 1.74 3.86 Stdev 6.86 11.0 6.68 11.4 6.60 11.6 p (t-test) 0.25 0.19 0.18 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 75 56 79 52 81 50 UO only Median 1.05 1.36 1.05 1.45 1.05 1.45 Average 1.70 5.11 1.67 5.54 1.67 5.54 Stdev 6.01 14.2 5.92 14.8 5.92 14.8 p (t-test) 0.056 0.036 0.036 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 98 33 101 30 101 30 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.67 0.65 0.69 0.68 0.67 0.67 0.67 0.67 SE 0.048 0.048 0.058 0.048 0.049 0.059 0.049 0.050 0.059 p Value 5.6E4 4.5E4 0.011 1.0E4 1.7E4 0.0037 3.5E4 5.5E4 0.0037 nCohort Non- 73 75 98 78 79 101 80 81 101 persistent nCohort Persistent 59 56 33 54 52 30 52 50 30 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 85% 84% 88% 85% 85% 90% 85% 84% 90% Specificity 33% 32% 30% 32% 32% 30% 31% 31% 30% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 61% 62% 61% 65% 63% 63% 65% 64% 63% Specificity 59% 59% 53% 60% 58% 53% 60% 58% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 36% 36% 39% 37% 37% 43% 37% 36% 43% Specificity 84% 83% 80% 83% 82% 80% 82% 81% 80% OR Quartile 2 2.72 2.46 3.05 2.71 2.55 3.80 2.50 2.34 3.80 p Value 0.023 0.041 0.054 0.028 0.040 0.039 0.043 0.061 0.039 Lower limit of 1.15 1.04 0.983 1.12 1.05 1.07 1.03 0.961 1.07 95% CI Upper limit of 6.44 5.82 9.45 6.60 6.20 13.5 6.08 5.71 13.5 95% CI OR Quartile 3 2.24 2.37 1.74 2.79 2.42 1.98 2.83 2.46 1.98 p Value 0.024 0.017 0.18 0.0051 0.016 0.11 0.0049 0.015 0.11 Lower limit of 1.11 1.16 0.779 1.36 1.18 0.857 1.37 1.19 0.857 95% CI Upper limit of 4.52 4.81 3.88 5.73 4.97 4.59 5.85 5.08 4.59 95% CI OR Quartile 4 2.81 2.65 2.54 2.94 2.67 3.10 2.71 2.47 3.10 p Value 0.013 0.018 0.033 0.0092 0.017 0.011 0.015 0.027 0.011 Lower limit of 1.24 1.18 1.08 1.31 1.19 1.29 1.21 1.11 1.29 95% CI Upper limit of 6.36 5.96 5.95 6.63 5.99 7.41 6.08 5.53 7.41 95% CI

TABLE-US-00191 TABLE 24.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.960 1.36 0.950 1.39 0.965 1.39 Average 1.79 3.47 1.73 3.71 1.74 3.77 Stdev 6.95 10.7 6.73 11.2 6.64 11.4 p (t-test) 0.28 0.21 0.20 Min 0.0156 0.00242 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 73 59 78 54 80 52 sCr only Median 0.965 1.36 0.965 1.36 0.979 1.36 Average 1.79 3.53 1.75 3.72 1.76 3.78 Stdev 6.90 10.9 6.72 11.3 6.64 11.5 p (t-test) 0.27 0.21 0.20 Min 0.0264 0.00242 0.00242 0.0156 0.00242 0.0156 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 74 57 78 53 80 51 UO only Median 1.05 1.36 1.05 1.36 1.05 1.36 Average 1.71 4.88 1.70 5.12 1.70 5.12 Stdev 6.07 13.8 6.01 14.2 6.01 14.2 p (t-test) 0.070 0.055 0.055 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 96 35 98 33 98 33 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.65 0.64 0.69 0.67 0.65 0.67 0.65 0.65 SE 0.048 0.049 0.057 0.048 0.049 0.058 0.049 0.050 0.058 p Value 5.6E4 0.0016 0.013 1.0E4 7.0E4 0.0093 3.5E4 0.0020 0.0093 nCohort Non- 73 74 96 78 78 98 80 80 98 persistent nCohort Persistent 59 57 35 54 53 33 52 51 33 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 85% 82% 89% 85% 83% 88% 85% 82% 88% Specificity 33% 31% 30% 32% 31% 30% 31% 30% 30% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 61% 61% 60% 65% 62% 61% 65% 63% 61% Specificity 59% 58% 53% 60% 58% 53% 60% 57% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 36% 35% 37% 37% 36% 39% 37% 35% 39% Specificity 84% 82% 79% 83% 82% 80% 82% 81% 80% OR Quartile 2 2.72 2.12 3.35 2.71 2.17 3.05 2.50 2.00 3.05 p Value 0.023 0.080 0.036 0.028 0.078 0.054 0.043 0.12 0.054 Lower limit of 1.15 0.914 1.08 1.12 0.916 0.983 1.03 0.843 0.983 95% CI Upper limit of 6.44 4.92 10.4 6.60 5.15 9.45 6.08 4.75 9.45 95% CI OR Quartile 3 2.24 2.21 1.70 2.79 2.25 1.74 2.83 2.28 1.74 p Value 0.024 0.028 0.19 0.0051 0.026 0.18 0.0049 0.025 0.18 Lower limit of 1.11 1.09 0.775 1.36 1.10 0.779 1.37 1.11 0.779 95% CI Upper limit of 4.52 4.47 3.73 5.73 4.60 3.88 5.85 4.68 3.88 95% CI OR Quartile 4 2.81 2.54 2.25 2.94 2.55 2.54 2.71 2.36 2.54 p Value 0.013 0.024 0.060 0.0092 0.023 0.033 0.015 0.036 0.033 Lower limit of 1.24 1.13 0.965 1.31 1.14 1.08 1.21 1.06 1.08 95% CI Upper limit of 6.36 5.70 5.22 6.63 5.72 5.95 6.08 5.28 5.95 95% CI

Example 25. Use of CC Motif Chemokine 18 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0193] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 18 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0194] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0195] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00192 TABLE 25.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.845 1.33 0.979 1.34 0.989 1.36 Average 0.977 3.63 1.02 4.25 1.02 4.55 Stdev 0.836 11.4 0.798 12.7 0.777 13.2 p (t-test) 0.091 0.036 0.023 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 54 78 70 62 75 57 sCr only Median 0.870 1.31 0.970 1.35 0.989 1.44 Average 0.984 3.75 1.000 4.38 1.00 4.75 Stdev 0.819 11.7 0.777 12.9 0.752 13.6 p (t-test) 0.077 0.030 0.017 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 57 74 71 60 77 54 UO only Median 0.983 1.59 1.02 1.59 1.04 1.61 Average 1.64 5.80 1.64 6.89 1.63 7.41 Stdev 5.89 15.1 5.73 16.8 5.67 17.5 p (t-test) 0.025 0.0095 0.0058 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 102 29 108 23 110 21 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.65 0.73 0.64 0.66 0.74 0.65 0.66 0.74 SE 0.047 0.048 0.057 0.048 0.048 0.063 0.049 0.049 0.066 p Value 0.0011 0.0017 5.0E5 0.0038 0.0012 1.8E4 0.0017 8.2E4 2.7E4 nCohort Non- 54 57 102 70 71 108 75 77 110 persistent nCohort Persistent 78 74 29 62 60 23 57 54 21 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 83% 82% 97% 85% 85% 96% 86% 85% 95% Specificity 37% 35% 31% 34% 34% 30% 33% 32% 29% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 59% 59% 79% 58% 62% 78% 60% 61% 76% Specificity 63% 61% 58% 57% 59% 56% 57% 57% 55% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 29% 31% 38% 32% 33% 43% 35% 37% 48% Specificity 81% 82% 78% 81% 82% 79% 83% 83% 79% OR Quartile 2 2.94 2.54 12.8 3.07 2.89 9.26 3.06 2.76 8.21 p Value 0.0092 0.024 0.014 0.011 0.016 0.033 0.014 0.025 0.044 Lower limit of 1.31 1.13 1.67 1.30 1.22 1.20 1.26 1.14 1.06 95% CI Upper limit of 6.63 5.70 98.3 7.27 6.86 71.7 7.44 6.73 63.7 95% CI OR Quartile 3 2.44 2.33 5.26 1.85 2.33 4.50 1.99 2.10 3.84 p Value 0.014 0.019 9.1E4 0.082 0.018 0.0055 0.054 0.041 0.014 Lower limit of 1.20 1.15 1.97 0.924 1.15 1.56 0.987 1.03 1.31 95% CI Upper limit of 4.99 4.73 14.0 3.69 4.71 13.0 4.00 4.26 11.2 95% CI OR Quartile 4 1.84 2.12 2.22 2.09 2.23 2.84 2.58 2.90 3.44 p Value 0.16 0.080 0.077 0.073 0.051 0.030 0.022 0.010 0.013 Lower limit of 0.793 0.914 0.916 0.934 0.996 1.11 1.15 1.28 1.30 95% CI Upper limit of 4.27 4.92 5.39 4.67 5.00 7.31 5.79 6.53 9.09 95% CI

TABLE-US-00193 TABLE 25.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.774 1.33 0.965 1.31 0.965 1.35 Average 0.895 3.51 0.997 4.00 0.988 4.19 Stdev 0.778 11.0 0.784 12.2 0.766 12.5 p (t-test) 0.10 0.051 0.037 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 49 83 64 68 68 64 sCr only Median 0.797 1.35 0.950 1.35 0.960 1.36 Average 0.903 3.70 0.953 4.16 0.952 4.32 Stdev 0.750 11.5 0.734 12.4 0.721 12.7 p (t-test) 0.076 0.038 0.030 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 54 77 66 65 69 62 UO only Median 0.974 1.42 1.00 1.43 1.02 1.54 Average 1.69 4.77 1.68 5.39 1.68 5.66 Stdev 6.13 13.4 5.95 14.6 5.89 15.1 p (t-test) 0.073 0.042 0.032 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 94 37 100 31 102 29 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.69 0.69 0.65 0.67 0.68 0.66 0.68 0.67 SE 0.046 0.046 0.054 0.048 0.047 0.058 0.047 0.047 0.060 p Value 4.1E5 4.7E5 5.7E4 0.0023 3.2E4 0.0024 8.2E4 1.8E4 0.0039 nCohort Non- 49 54 94 64 66 100 68 69 102 persistent nCohort Persistent 83 77 37 68 65 31 64 62 29 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 83% 83% 92% 84% 85% 90% 84% 85% 90% Specificity 39% 37% 32% 34% 35% 30% 34% 35% 29% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 61% 73% 57% 60% 71% 59% 60% 69% Specificity 67% 65% 59% 58% 59% 56% 59% 58% 55% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 31% 34% 32% 32% 34% 35% 34% 35% 38% Specificity 86% 87% 78% 83% 83% 78% 84% 84% 78% OR Quartile 2 3.12 2.90 5.31 2.71 2.94 4.00 2.76 3.14 3.61 p Value 0.0060 0.010 0.0092 0.018 0.012 0.032 0.018 0.0093 0.047 Lower limit of 1.38 1.28 1.51 1.19 1.27 1.13 1.19 1.33 1.02 95% CI Upper limit of 7.03 6.53 18.7 6.20 6.83 14.2 6.40 7.44 12.8 95% CI OR Quartile 3 3.12 2.89 3.81 1.84 2.17 3.11 2.09 2.04 2.71 p Value 0.0026 0.0040 0.0017 0.083 0.030 0.011 0.038 0.045 0.026 Lower limit of 1.49 1.40 1.65 0.924 1.08 1.30 1.04 1.02 1.12 95% CI Upper limit of 6.56 5.94 8.76 3.68 4.35 7.43 4.18 4.10 6.51 95% CI OR Quartile 4 2.74 3.42 1.67 2.30 2.56 1.95 2.71 2.90 2.22 p value 0.033 0.0090 0.23 0.047 0.026 0.13 0.018 0.012 0.077 Lower limit of 1.09 1.36 0.719 1.01 1.12 0.813 1.19 1.27 0.916 95% CI Upper limit of 6.90 8.62 3.87 5.26 5.85 4.68 6.20 6.64 5.39 95% CI

TABLE-US-00194 TABLE 25.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.774 1.33 0.965 1.31 0.979 1.34 Average 0.895 3.51 0.997 4.00 1.00 4.08 Stdev 0.778 11.0 0.784 12.2 0.773 12.3 p (t-test) 0.10 0.051 0.045 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 49 83 64 68 66 66 sCr only Median 0.819 1.34 0.960 1.34 0.970 1.35 Average 0.911 3.66 0.960 4.11 0.967 4.20 Stdev 0.755 11.4 0.737 12.3 0.727 12.5 p (t-test) 0.082 0.042 0.037 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 53 78 65 66 67 64 UO only Median 1.02 1.35 1.05 1.35 1.06 1.34 Average 1.75 4.29 1.74 4.73 1.73 4.93 Stdev 6.30 12.7 6.10 13.6 6.04 14.0 p (t-test) 0.13 0.085 0.071 Min 0.00242 0.310 0.00242 0.310 0.00242 0.310 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 89 42 95 36 97 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.64 0.65 0.66 0.62 0.64 0.66 0.62 SE 0.046 0.046 0.053 0.048 0.047 0.057 0.048 0.048 0.058 p Value 4.1E5 1.1E4 0.0096 0.0023 6.6E4 0.031 0.0028 8.3E4 0.046 nCohort Non- 49 53 89 64 65 95 66 67 97 persistent nCohort Persistent 83 78 42 68 66 36 66 64 34 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 83% 82% 88% 84% 83% 86% 83% 83% 85% Specificity 39% 36% 31% 34% 34% 29% 33% 33% 29% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 60% 64% 57% 59% 61% 58% 58% 59% Specificity 67% 64% 56% 58% 58% 54% 58% 57% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 31% 33% 29% 32% 33% 31% 33% 34% 32% Specificity 86% 87% 76% 83% 83% 77% 83% 84% 77% OR Quartile 2 3.12 2.55 3.40 2.71 2.56 2.59 2.50 2.36 2.35 p Value 0.0060 0.023 0.021 0.018 0.026 0.073 0.030 0.042 0.11 Lower limit of 1.38 1.14 1.21 1.19 1.12 0.914 1.10 1.03 0.827 95% CI Upper limit of 7.03 5.72 9.57 6.20 5.85 7.35 5.71 5.38 6.70 95% CI OR Quartile 3 3.12 2.71 2.31 1.84 2.03 1.82 1.84 1.80 1.58 p Value 0.0026 0.0067 0.030 0.083 0.046 0.13 0.083 0.098 0.25 Lower limit of 1.49 1.32 1.08 0.924 1.01 0.833 0.923 0.898 0.718 95% CI Upper limit of 6.56 5.58 4.92 3.68 4.08 3.98 3.67 3.59 3.49 95% CI OR Quartile 4 2.74 3.29 1.30 2.30 2.45 1.46 2.50 2.67 1.63 p Value 0.033 0.012 0.54 0.047 0.033 0.39 0.030 0.020 0.27 Lower limit of 1.09 1.30 0.565 1.01 1.07 0.621 1.10 1.17 0.689 95% CI Upper limit of 6.90 8.28 2.97 5.26 5.61 3.43 5.71 6.10 3.86 95% CI

TABLE-US-00195 TABLE 25.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.774 1.33 0.960 1.33 0.970 1.35 Average 0.895 3.51 0.985 3.96 0.991 4.05 Stdev 0.778 11.0 0.785 12.1 0.774 12.2 p (t-test) 0.10 0.053 0.047 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 49 83 63 69 65 67 sCr only Median 0.819 1.34 0.950 1.35 0.965 1.36 Average 0.911 3.66 0.949 4.07 0.955 4.16 Stdev 0.755 11.4 0.736 12.2 0.726 12.4 p (t-test) 0.082 0.044 0.038 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 53 78 64 67 66 65 UO only Median 1.00 1.36 1.05 1.35 1.06 1.34 Average 1.75 4.11 1.76 4.39 1.75 4.55 Stdev 6.41 12.2 6.23 13.0 6.16 13.3 p (t-test) 0.15 0.12 0.10 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 86 45 91 40 93 38 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.64 0.65 0.67 0.62 0.65 0.67 0.61 SE 0.046 0.046 0.052 0.047 0.047 0.055 0.048 0.047 0.056 p Value 4.1E5 1.1E4 0.0059 0.0012 2.9E4 0.032 0.0014 3.8E4 0.047 nCohort Non- 49 53 86 63 64 91 65 66 93 persistent nCohort Persistent 83 78 45 69 67 40 67 65 38 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 83% 82% 87% 84% 84% 85% 84% 83% 84% Specificity 39% 36% 31% 35% 34% 30% 34% 33% 29% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 60% 64% 58% 60% 60% 58% 58% 58% Specificity 67% 64% 57% 59% 59% 54% 58% 58% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 31% 33% 31% 33% 34% 32% 34% 35% 34% Specificity 86% 87% 78% 84% 84% 78% 85% 85% 78% OR Quartile 2 3.12 2.55 2.97 2.83 2.67 2.39 2.60 2.45 2.18 p Value 0.0060 0.023 0.028 0.014 0.020 0.081 0.023 0.033 0.12 Lower limit of 1.38 1.14 1.12 1.24 1.17 0.899 1.14 1.07 0.819 95% CI Upper limit of 7.03 5.72 7.87 6.47 6.10 6.35 5.95 5.61 5.81 95% CI OR Quartile 3 3.12 2.71 2.40 1.96 2.17 1.75 1.96 1.91 1.53 p Value 0.0026 0.0067 0.021 0.056 0.030 0.15 0.057 0.068 0.27 Lower limit of 1.49 1.32 1.14 0.982 1.08 0.823 0.981 0.954 0.715 95% CI Upper limit of 6.56 5.58 5.06 3.92 4.35 3.72 3.92 3.82 3.28 95% CI OR Quartile 4 2.74 3.29 1.59 2.65 2.82 1.71 2.87 3.07 1.90 p Value 0.033 0.012 0.26 0.023 0.016 0.20 0.014 0.0092 0.13 Lower limit of 1.09 1.30 0.708 1.14 1.22 0.748 1.24 1.32 0.825 95% CI Upper limit of 6.90 8.28 3.58 6.14 6.55 3.91 6.67 7.13 4.37 95% CI

TABLE-US-00196 TABLE 25.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.774 1.33 0.950 1.33 0.965 1.34 Average 0.895 3.51 0.980 3.93 0.986 4.01 Stdev 0.778 11.0 0.791 12.0 0.779 12.2 p (t-test) 0.10 0.056 0.049 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 49 83 62 70 64 68 sCr only Median 0.819 1.34 0.950 1.35 0.965 1.36 Average 0.911 3.66 0.949 4.07 0.955 4.16 Stdev 0.755 11.4 0.736 12.2 0.726 12.4 p (t-test) 0.082 0.044 0.038 Min 0.0264 0.00242 0.0264 0.00242 0.0264 0.00242 Max 4.23 60.0 4.23 60.0 4.23 60.0 n (Patient) 53 78 64 67 66 65 UO only Median 1.00 1.36 1.04 1.35 1.05 1.33 Average 1.77 3.98 1.78 4.17 1.77 4.30 Stdev 6.48 12.0 6.33 12.5 6.26 12.8 p (t-test) 0.17 0.15 0.13 Min 0.00242 0.233 0.00242 0.233 0.00242 0.233 Max 60.0 60.0 60.0 60.0 60.0 60.0 n (Patient) 84 47 88 43 90 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.64 0.66 0.67 0.62 0.65 0.67 0.61 SE 0.046 0.046 0.052 0.047 0.047 0.054 0.047 0.047 0.054 p Value 4.1E5 1.1E4 0.0064 8.8E4 2.9E4 0.030 0.0011 3.8E4 0.045 nCohort Non- 49 53 84 62 64 88 64 66 90 persistent nCohort Persistent 83 78 47 70 67 43 68 65 41 Cutoff Quartile 2 0.561 0.557 0.569 0.561 0.557 0.569 0.561 0.557 0.569 Sensitivity 83% 82% 87% 84% 84% 86% 84% 83% 85% Specificity 39% 36% 32% 35% 34% 31% 34% 33% 30% Cutoff Quartile 3 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 1.07 Sensitivity 60% 60% 64% 59% 60% 60% 59% 58% 59% Specificity 67% 64% 57% 60% 59% 55% 59% 58% 53% Cutoff Quartile 4 1.65 1.64 1.66 1.65 1.64 1.66 1.65 1.64 1.66 Sensitivity 31% 33% 30% 33% 34% 30% 34% 35% 32% Specificity 86% 87% 77% 84% 84% 77% 84% 85% 78% OR Quartile 2 3.12 2.55 3.24 2.95 2.67 2.73 2.71 2.45 2.50 p Value 0.0060 0.023 0.018 0.010 0.020 0.043 0.018 0.033 0.066 Lower limit of 1.38 1.14 1.23 1.29 1.17 1.03 1.19 1.07 0.942 95% CI Upper limit of 7.03 5.72 8.55 6.75 6.10 7.23 6.20 5.61 6.64 95% CI OR Quartile 3 3.12 2.71 2.35 2.09 2.17 1.84 2.09 1.91 1.61 p Value 0.0026 0.0067 0.023 0.037 0.030 0.11 0.038 0.068 0.21 Lower limit of 1.49 1.32 1.13 1.04 1.08 0.874 1.04 0.954 0.765 95% CI Upper limit of 6.56 5.58 4.91 4.19 4.35 3.85 4.18 3.82 3.40 95% CI OR Quartile 4 2.74 3.29 1.45 2.54 2.82 1.47 2.76 3.07 1.62 p Value 0.033 0.012 0.37 0.029 0.016 0.35 0.018 0.0092 0.25 Lower limit of 1.09 1.30 0.647 1.10 1.22 0.649 1.19 1.32 0.713 95% CI Upper limit of 6.90 8.28 3.25 5.90 6.55 3.34 6.40 7.13 3.71 95% CI

Example 26. Use of CC Motif Chemokine 23 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0196] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0197] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0198] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00197 TABLE 26.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00282 0.0144 0.00258 0.0130 0.00282 0.0123 Average 0.00875 0.134 0.00707 0.129 0.00774 0.127 Stdev 0.0140 0.372 0.00989 0.366 0.0103 0.363 p (t-test) 0.012 0.025 0.037 Min 7.19E7 3.28E9 7.19E7 3.28E9 7.19E7 3.28E9 Max 0.0790 2.47 0.0380 2.47 0.0380 2.47 n (Patient) 57 260 46 271 41 276 sCr only Median 0.00278 0.0172 0.00278 0.0168 0.00282 0.0162 Average 0.00748 0.144 0.00760 0.143 0.00783 0.141 Stdev 0.0121 0.386 0.0123 0.384 0.0125 0.382 p (t-test) 0.0022 0.0027 0.0038 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.0790 2.47 0.0790 2.47 0.0790 2.47 n (Patient) 76 240 74 242 70 246 UO only Median 0.00780 0.0134 0.00783 0.0129 0.00764 0.0134 Average 0.0920 0.144 0.0859 0.144 0.0865 0.137 Stdev 0.347 0.331 0.338 0.345 0.350 0.332 p (t-test) 0.19 0.14 0.19 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 1.82 2.47 1.92 2.47 1.92 n (Patient) 194 121 173 142 156 159 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.73 0.57 0.71 0.73 0.57 0.69 0.72 0.57 SE 0.035 0.030 0.033 0.037 0.030 0.033 0.040 0.031 0.032 p Value 9.9E9 5.1E15 0.036 1.9E8 5.0E14 0.034 2.0E6 1.1E12 0.020 nCohort Recovered 57 76 194 46 74 173 41 70 156 nCohort Non- 260 240 121 271 242 142 276 246 159 recovered Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 78% 80% 78% 78% 80% 78% 77% 80% 78% Specificity 40% 42% 27% 43% 42% 28% 39% 41% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 56% 59% 55% 55% 59% 54% 54% 58% 54% Specificity 75% 79% 53% 76% 78% 53% 73% 77% 54% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 30% 32% 36% 30% 32% 35% 29% 32% 33% Specificity 98% 99% 82% 100% 99% 83% 100% 99% 83% OR Quartile 2 2.46 2.99 1.27 2.76 2.91 1.37 2.16 2.77 1.39 p Value 0.0035 1.1E4 0.37 0.0022 1.8E4 0.23 0.028 4.3E4 0.21 Lower limit of 1.34 1.71 0.748 1.44 1.67 0.818 1.09 1.57 0.834 95% CI Upper limit of 4.52 5.21 2.17 5.30 5.10 2.31 4.30 4.89 2.32 95% CI OR Quartile 3 3.87 5.43 1.40 3.83 5.15 1.35 3.15 4.61 1.37 p Value 4.6E5 5.0E8 0.14 2.5E4 1.4E7 0.19 0.0021 1.0E6 0.16 Lower limit of 2.02 2.96 0.890 1.87 2.80 0.862 1.52 2.50 0.882 95% CI Upper limit of 7.42 9.99 2.22 7.85 9.47 2.10 6.55 8.50 2.14 95% CI OR Quartile 4 24.4 36.1 2.60 39.1 34.7 2.51 34.0 32.0 2.50 p Value 0.0017 4.2E4 3.3E4 0.010 4.8E4 5.7E4 0.014 6.5E4 7.9E4 Lower limit of 3.32 4.93 1.54 2.38 4.74 1.49 2.07 4.37 1.46 95% CI Upper limit of 180 265 4.37 642 254 4.24 559 235 4.27 95% CI

TABLE-US-00198 TABLE 26.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00296 0.0184 0.00282 0.0168 0.00285 0.0162 Average 0.00925 0.152 0.00872 0.145 0.00897 0.141 Stdev 0.0164 0.395 0.0154 0.387 0.0157 0.382 p (t-test) 7.3E4 0.0019 0.0039 Min 7.09E7 3.28E9 7.09E7 3.28E9 7.09E7 3.28E9 Max 0.102 2.47 0.102 2.47 0.102 2.47 n (Patient) 90 227 79 238 71 246 sCr only Median 0.00328 0.0222 0.00328 0.0220 0.00329 0.0213 Average 0.00870 0.163 0.00881 0.161 0.00872 0.158 Stdev 0.0153 0.408 0.0154 0.406 0.0155 0.402 p (t-test) 1.3E4 1.6E4 2.7E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.102 2.47 0.102 2.47 0.102 2.47 n (Patient) 106 211 104 213 99 218 UO only Median 0.00764 0.0192 0.00780 0.0175 0.00764 0.0169 Average 0.0920 0.153 0.0981 0.134 0.0990 0.129 Stdev 0.336 0.351 0.350 0.328 0.361 0.315 p (t-test) 0.14 0.37 0.44 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 212 103 194 121 178 137 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.75 0.59 0.73 0.75 0.57 0.72 0.74 0.57 SE 0.029 0.027 0.035 0.030 0.027 0.033 0.031 0.028 0.033 p Value 7.5E15 0 0.012 3.1E14 0 0.035 6.9E12 0 0.026 nCohort Recovered 90 106 212 79 104 194 71 99 178 nCohort Non- 227 211 103 238 213 121 246 218 137 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 81% 82% 78% 81% 82% 79% 80% 82% 79% Specificity 39% 40% 26% 42% 39% 28% 41% 39% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 60% 64% 59% 59% 63% 56% 57% 62% 55% Specificity 76% 77% 54% 76% 77% 54% 75% 77% 54% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 34% 36% 36% 33% 36% 33% 32% 35% 32% Specificity 97% 97% 80% 97% 97% 80% 97% 97% 80% OR Quartile 2 2.65 3.09 1.25 2.99 3.00 1.48 2.71 2.89 1.45 p Value 3.8E4 2.7E5 0.43 9.5E5 4.5E5 0.15 5.6E4 8.4E5 0.16 Lower limit of 1.55 1.82 0.717 1.73 1.77 0.863 1.54 1.70 0.861 95% CI Upper limit of 4.53 5.23 2.18 5.19 5.08 2.54 4.77 4.91 2.46 95% CI OR Quartile 3 4.71 6.07 1.72 4.51 5.77 1.48 3.95 5.48 1.46 p Value 3.3E8 3.9E11 0.026 3.1E7 1.3E10 0.091 5.2E6 7.1E10 0.098 Lower limit of 2.72 3.56 1.07 2.53 3.38 0.939 2.19 3.19 0.932 95% CI Upper limit of 8.15 10.4 2.77 8.03 9.85 2.34 7.14 9.41 2.28 95% CI OR Quartile 4 14.9 19.7 2.27 18.8 19.1 1.96 16.0 17.5 1.93 p Value 7.7E6 7.6E7 0.0022 5.8E5 1.0E6 0.011 1.5E4 2.1E6 0.012 Lower limit of 4.56 6.05 1.34 4.49 5.85 1.17 3.83 5.36 1.15 95% CI Upper limit of 48.6 64.3 3.84 78.4 62.1 3.29 67.0 57.0 3.24 95% CI

TABLE-US-00199 TABLE 26.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00324 0.0215 0.00306 0.0200 0.00321 0.0178 Average 0.0146 0.165 0.0151 0.160 0.0158 0.153 Stdev 0.0391 0.415 0.0403 0.409 0.0422 0.401 p (t-test) 1.3E4 3.0E4 8.6E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.361 2.47 0.361 2.47 0.361 2.47 n (Patient) 114 203 107 210 97 220 sCr only Median 0.00365 0.0249 0.00367 0.0232 0.00365 0.0226 Average 0.0139 0.176 0.0142 0.174 0.0142 0.170 Stdev 0.0371 0.427 0.0375 0.424 0.0382 0.420 p (t-test) 2.6E5 3.9E5 7.2E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.361 2.47 0.361 2.47 0.361 2.47 n (Patient) 127 190 124 193 119 198 UO only Median 0.00730 0.0207 0.00764 0.0182 0.00724 0.0182 Average 0.0934 0.151 0.0971 0.139 0.0964 0.135 Stdev 0.335 0.354 0.342 0.340 0.350 0.328 p (t-test) 0.16 0.30 0.32 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 214 101 204 111 190 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.73 0.59 0.72 0.73 0.57 0.71 0.72 0.59 SE 0.028 0.028 0.035 0.029 0.028 0.034 0.029 0.028 0.033 p Value 1.8E15 0 0.0072 2.2E14 6.7E16 0.029 7.5E13 1.1E15 0.0092 nCohort Recovered 114 127 214 107 124 204 97 119 190 nCohort Non- 203 190 101 210 193 111 220 198 125 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 82% 83% 79% 82% 83% 79% 82% 82% 80% Specificity 38% 37% 27% 39% 37% 27% 40% 37% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 63% 65% 61% 61% 64% 58% 60% 64% 58% Specificity 72% 72% 55% 71% 72% 54% 71% 72% 55% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 36% 38% 34% 35% 38% 32% 33% 37% 32% Specificity 94% 94% 79% 93% 94% 78% 93% 94% 79% OR Quartile 2 2.81 2.90 1.42 3.02 2.86 1.45 3.03 2.73 1.59 p Value 1.1E4 6.7E5 0.23 3.8E5 8.2E5 0.19 4.4E5 1.6E4 0.093 Lower limit of 1.67 1.72 0.803 1.79 1.70 0.833 1.78 1.62 0.926 95% CI Upper limit of 4.74 4.90 2.50 5.11 4.82 2.52 5.15 4.60 2.73 95% CI OR Quartile 3 4.28 4.94 1.95 3.83 4.57 1.59 3.63 4.56 1.64 p Value 1.0E8 1.8E10 0.0065 1.5E7 1.2E9 0.050 9.5E7 1.9E9 0.033 Lower limit of 2.60 3.02 1.21 2.32 2.80 0.999 2.17 2.78 1.04 95% CI Upper limit of 7.04 8.07 3.17 6.32 7.46 2.54 6.07 7.48 2.59 95% CI OR Quartile 4 8.58 10.7 1.91 7.61 10.2 1.67 6.38 9.34 1.82 p Value 2.5E7 1.3E8 0.017 1.1E6 2.6E8 0.052 9.1E6 8.1E8 0.022 Lower limit of 3.79 4.73 1.12 3.36 4.50 0.994 2.82 4.13 1.09 95% CI Upper limit of 19.4 24.2 3.23 17.2 23.0 2.82 14.5 21.1 3.05 95% CI

TABLE-US-00200 TABLE 26.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00383 0.0238 0.00365 0.0217 0.00348 0.0194 Average 0.0158 0.181 0.0164 0.173 0.0171 0.164 Stdev 0.0389 0.434 0.0402 0.426 0.0419 0.416 p (t-test) 1.5E5 5.3E5 2.0E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.361 2.47 0.361 2.47 0.361 2.47 n (Patient) 134 183 125 192 114 203 sCr only Median 0.00383 0.0285 0.00396 0.0284 0.00379 0.0272 Average 0.0150 0.187 0.0152 0.185 0.0151 0.183 Stdev 0.0379 0.440 0.0382 0.438 0.0385 0.435 p (t-test) 5.8E6 8.0E6 1.2E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 0.361 2.47 0.361 2.47 0.361 2.47 n (Patient) 140 177 138 179 135 182 UO only Median 0.00717 0.0215 0.00711 0.0199 0.00710 0.0184 Average 0.0925 0.154 0.0956 0.143 0.0948 0.139 Stdev 0.333 0.357 0.340 0.344 0.347 0.333 p (t-test) 0.14 0.24 0.26 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 216 99 207 108 194 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.74 0.61 0.71 0.73 0.59 0.70 0.73 0.59 SE 0.028 0.028 0.035 0.029 0.028 0.034 0.029 0.028 0.033 p Value 5.1E15 0 0.0024 1.1E13 4.4E16 0.0073 5.9E12 0 0.0063 nCohort Recovered 134 140 216 125 138 207 114 135 194 nCohort Non- 183 177 99 192 179 108 203 182 121 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 83% 84% 80% 83% 84% 80% 82% 84% 79% Specificity 35% 36% 27% 37% 36% 28% 38% 37% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 64% 66% 65% 62% 65% 61% 61% 65% 60% Specificity 69% 70% 56% 68% 70% 56% 68% 70% 56% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 38% 40% 34% 36% 40% 32% 34% 39% 32% Specificity 93% 94% 79% 92% 93% 79% 91% 93% 79% OR Quartile 2 2.55 3.05 1.48 2.81 2.94 1.49 2.81 3.10 1.48 p Value 4.3E4 3.8E5 0.18 1.1E4 6.2E5 0.17 1.1E4 2.7E5 0.15 Lower limit of 1.51 1.79 0.836 1.66 1.73 0.849 1.67 1.83 0.863 95% CI Upper limit of 4.29 5.18 2.64 4.73 4.98 2.60 4.74 5.27 2.54 95% CI OR Quartile 3 4.12 4.55 2.37 3.46 4.31 1.96 3.33 4.49 1.85 p Value 5.7E9 4.8E10 5.8E4 3.0E7 1.7E9 0.0053 1.2E6 8.4E10 0.0091 Lower limit of 2.56 2.82 1.45 2.15 2.68 1.22 2.05 2.78 1.16 95% CI Upper limit of 6.63 7.33 3.88 5.57 6.94 3.16 5.41 7.24 2.92 95% CI OR Quartile 4 7.68 9.75 1.99 6.60 9.42 1.78 5.47 8.95 1.83 p Value 1.8E8 1.6E9 0.011 1.9E7 2.7E9 0.031 2.7E6 6.1E9 0.022 Lower limit of 3.78 4.66 1.17 3.24 4.50 1.05 2.69 4.28 1.09 95% CI Upper limit of 15.6 20.4 3.37 13.4 19.7 3.00 11.1 18.7 3.07 95% CI

TABLE-US-00201 TABLE 26.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00615 0.0222 0.00601 0.0213 0.00601 0.0213 Average 0.0697 0.172 0.0707 0.168 0.0707 0.168 Stdev 0.294 0.392 0.297 0.388 0.297 0.388 p (t-test) 0.0086 0.012 0.012 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.43 2.47 2.43 2.47 2.43 2.47 n (Patient) 188 129 185 132 185 132 sCr only Median 0.00460 0.0298 0.00458 0.0284 0.00443 0.0284 Average 0.0332 0.191 0.0336 0.187 0.0338 0.186 Stdev 0.161 0.443 0.163 0.439 0.163 0.438 p (t-test) 3.2E5 4.9E5 5.7E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 1.92 2.47 1.92 2.47 1.92 2.47 n (Patient) 160 157 157 160 156 161 UO only Median 0.00709 0.0213 0.00710 0.0207 0.00709 0.0209 Average 0.0861 0.164 0.0872 0.160 0.0868 0.159 Stdev 0.328 0.363 0.330 0.359 0.332 0.355 p (t-test) 0.056 0.074 0.075 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 211 104 208 107 205 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.71 0.61 0.65 0.71 0.61 0.65 0.71 0.61 SE 0.032 0.029 0.034 0.032 0.029 0.034 0.032 0.029 0.034 p Value 2.6E6 3.5E13 9.2E4 3.0E6 3.9E13 0.0021 3.0E6 3.8E13 0.0013 nCohort Recovered 188 160 211 185 157 208 185 156 205 nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 83% 83% 80% 83% 84% 79% 83% 84% 79% Specificity 30% 33% 27% 31% 34% 27% 31% 34% 27% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 67% 68% 65% 66% 68% 64% 66% 68% 64% Specificity 61% 68% 57% 61% 68% 57% 61% 68% 57% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 36% 41% 35% 35% 40% 34% 35% 40% 34% Specificity 82% 90% 80% 82% 90% 79% 82% 90% 80% OR Quartile 2 2.12 2.50 1.50 2.23 2.63 1.46 2.23 2.67 1.42 p Value 0.0080 7.9E4 0.16 0.0046 4.0E4 0.19 0.0046 3.2E4 0.21 Lower limit of 1.22 1.46 0.851 1.28 1.54 0.834 1.28 1.57 0.818 95% CI Upper limit of 3.68 4.26 2.64 3.87 4.48 2.55 .3.87 4.56 2.47 95% CI OR Quartile 3 3.15 4.44 2.54 3.03 4.57 2.29 3.03 4.44 2.33 p Value 1.6E6 5.6E10 1.8E4 3.0E6 2.9E10 7.3E4 3.0E6 5.6E10 5.2E4 Lower limit of 1.97 2.77 1.56 1.90 2.85 1.41 1.90 2.77 1.44 95% CI Upper limit of 5.04 7.12 4.13 4.83 7.34 3.69 4.83 7.12 3.75 95% CI OR Quartile 4 2.51 6.19 2.07 2.38 5.88 1.95 2.38 5.77 1.97 p Value 4.9E4 3.8E9 0.0066 0.0010 1.0E8 0.013 0.0010 1.4E8 0.011 Lower limit of 1.50 3.38 1.22 1.42 3.20 1.15 1.42 3.15 1.17 95% CI Upper limit of 4.21 11.4 3.50 3.98 10.8 3.28 3.98 10.6 3.31 95% CI

Example 27. Use of CC Motif Chemokine 23 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0199] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0200] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0201] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00202 TABLE 27.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00335 0.0207 0.00326 0.0192 0.00296 0.0192 Average 0.0505 0.143 0.0522 0.140 0.0531 0.138 Stdev 0.299 0.357 0.305 0.354 0.311 0.351 p (t-test) 0.022 0.031 0.039 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 108 209 104 213 100 217 sCr only Median 0.00335 0.0249 0.00335 0.0235 0.00335 0.0231 Average 0.0443 0.156 0.0449 0.154 0.0456 0.153 Stdev 0.277 0.372 0.279 0.370 0.282 0.368 p (t-test) 0.0042 0.0052 0.0063 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 126 190 124 192 122 194 UO only Median 0.00809 0.0175 0.00780 0.0169 0.00744 0.0175 Average 0.0873 0.171 0.0900 0.155 0.0930 0.144 Stdev 0.327 0.370 0.337 0.348 0.345 0.335 p (t-test) 0.048 0.11 0.20 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 222 93 208 107 198 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.74 0.57 0.70 0.74 0.58 0.72 0.73 0.59 SE 0.029 0.027 0.036 0.029 0.028 0.034 0.029 0.028 0.034 p Value 9.9E13 0 0.042 3.1E12 0 0.021 1.4E13 0 0.011 nCohort Recovered 108 126 222 104 124 208 100 122 198 nCohort Non- 209 190 93 213 192 107 217 194 117 recovered Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 80% 83% 75% 81% 83% 79% 81% 82% 79% Specificity 35% 37% 25% 37% 37% 27% 38% 37% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 62% 66% 58% 61% 65% 57% 60% 64% 57% Specificity 72% 74% 53% 71% 73% 53% 72% 73% 54% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 36% 38% 39% 35% 38% 38% 35% 38% 38% Specificity 95% 95% 81% 95% 95% 82% 96% 95% 82% OR Quartile 2 2.22 2.94 1.03 2.42 2.84 1.35 2.63 2.75 1.49 p Value 0.0027 5.6E5 0.93 9.9E4 9.0E5 0.29 3.3E4 1.4E4 0.15 Lower limit of 1.32 1.74 0.586 1.43 1.68 0.773 1.55 1.63 0.863 95% CI Upper limit of 3.75 4.96 1.80 4.08 4.79 2.34 4.46 4.63 2.57 95% CI OR Quartile 3 4.19 5.42 1.57 3.79 5.14 1.52 3.92 4.89 1.58 p Value 2.7E8 2.8E11 0.070 2.4E7 1.0E10 0.082 2.0E7 3.6E10 0.053 Lower limit of 2.53 3.30 0.963 2.29 3.13 0.949 2.34 2.98 0.994 95% CI Upper limit of 6.95 8.91 2.56 6.28 8.45 2.43 6.55 8.02 2.50 95% CI OR Quartile 4 11.5 12.5 2.63 10.8 12.1 2.78 12.9 11.7 2.81 p Value 3.5E7 1.3E8 3.9E4 7.5E7 2.1E8 1.4E4 1.4E6 3.2E8 1.1E4 Lower limit of 4.50 5.23 1.54 4.20 5.05 1.64 4.58 4.88 1.66 95% CI Upper limit of 29.5 29.8 4.48 27.6 28.8 4.70 36.5 27.9 4.73 95% CI

TABLE-US-00203 TABLE 27.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00396 0.0222 0.00396 0.0220 0.00368 0.0217 Average 0.0487 0.158 0.0494 0.157 0.0503 0.153 Stdev 0.268 0.380 0.270 0.378 0.275 0.374 p (t-test) 0.0045 0.0055 0.0081 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 136 181 134 183 129 188 sCr only Median 0.00420 0.0272 0.00413 0.0260 0.00413 0.0259 Average 0.0452 0.170 0.0455 0.169 0.0460 0.167 Stdev 0.257 0.392 0.257 0.391 0.259 0.389 p (t-test) 0.0011 0.0012 0.0015 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 149 168 148 169 146 171 UO only Median 0.00730 0.0220 0.00744 0.0215 0.00722 0.0209 Average 0.0877 0.173 0.0889 0.165 0.0927 0.149 Stdev 0.326 0.374 0.330 0.363 0.340 0.344 p (t-test) 0.045 0.069 0.17 Min 6.85E7 3.28E9 6.85E7 3.28E9 6.85E7 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 226 89 220 95 207 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.72 0.61 0.69 0.72 0.61 0.69 0.71 0.61 SE 0.029 0.028 0.036 0.029 0.028 0.035 0.029 0.029 0.034 p Value 1.5E10 3.1E14 0.0017 2.5E10 3.3E14 0.0019 3.4E11 1.9E13 0.0020 nCohort Recovered 136 149 226 134 148 220 129 146 207 nCohort Non- 181 168 89 183 169 95 188 171 108 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 81% 83% 80% 81% 83% 81% 81% 82% 81% Specificity 32% 34% 27% 33% 34% 28% 34% 34% 29% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 63% 67% 64% 62% 66% 62% 62% 65% 60% Specificity 67% 68% 55% 66% 68% 55% 67% 68% 55% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 38% 40% 38% 37% 40% 38% 37% 39% 36% Specificity 91% 91% 80% 91% 91% 80% 91% 91% 81% OR Quartile 2 2.00 2.42 1.46 2.07 2.46 1.64 2.26 2.37 1.75 p Value 0.0086 9.7E4 0.21 0.0058 7.7E4 0.10 0.0020 0.0012 0.054 Lower limit of 1.19 1.43 0.804 1.23 1.46 0.908 1.35 1.41 0.990 95% CI Upper limit of 3.34 4.09 2.64 3.46 4.16 2.97 3.80 4.00 3.11 95% CI OR Quartile 3 3.44 4.34 2.20 3.27 4.22 2.00 3.22 4.00 1.85 p Value 2.2E7 1.0E9 0.0022 6.6E7 2.0E9 0.0057 1.0E6 7.0E9 0.011 Lower limit of 2.16 2.71 1.33 2.05 2.64 1.22 2.01 2.50 1.15 95% CI Upper limit of 5.49 6.95 3.66 5.21 6.76 3.28 5.15 6.39 2.97 95% CI OR Quartile 4 6.22 6.94 2.49 6.01 6.82 2.51 6.22 6.59 2.36 p Value 7.0E8 4.5E9 9.1E4 1.2E7 6.1E9 6.9E4 1.7E7 1.1E8 0.0013 Lower limit of 3.20 3.63 1.45 3.09 3.57 1.48 3.13 3.45 1.40 95% CI Upper limit of 12.1 13.3 4.26 11.7 13.0 4.27 12.3 12.6 3.98 95% CI

TABLE-US-00204 TABLE 27.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00427 0.0260 0.00427 0.0259 0.00396 0.0232 Average 0.0490 0.170 0.0496 0.168 0.0506 0.164 Stdev 0.255 0.397 0.257 0.395 0.260 0.391 p (t-test) 0.0015 0.0019 0.0029 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 154 163 152 165 148 169 sCr only Median 0.00427 0.0295 0.00427 0.0293 0.00427 0.0289 Average 0.0471 0.177 0.0473 0.176 0.0476 0.175 Stdev 0.250 0.404 0.251 0.403 0.251 0.402 p (t-test) 6.0E4 6.8E4 7.9E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 161 156 160 157 159 158 UO only Median 0.00710 0.0222 0.00711 0.0221 0.00717 0.0212 Average 0.0895 0.167 0.0899 0.165 0.0934 0.150 Stdev 0.328 0.370 0.328 0.368 0.336 0.351 p (t-test) 0.068 0.075 0.17 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 224 91 223 92 212 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.72 0.62 0.70 0.72 0.62 0.70 0.72 0.61 SE 0.029 0.029 0.036 0.029 0.029 0.036 0.029 0.029 0.035 p Value 7.9E13 7.8E15 4.9E4 3.3E12 8.7E15 6.1E4 2.7E12 5.9E14 0.0013 nCohort Recovered 154 161 224 152 160 223 148 159 212 nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 84% 85% 81% 84% 85% 82% 84% 85% 83% Specificity 34% 35% 28% 34% 35% 28% 35% 35% 29% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 65% 67% 67% 64% 67% 66% 63% 66% 62% Specificity 66% 66% 57% 65% 66% 57% 65% 66% 56% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 39% 41% 37% 39% 41% 37% 38% 41% 35% Specificity 90% 90% 80% 89% 90% 80% 89% 90% 80% OR Quartile 2 2.77 3.08 1.67 2.66 3.14 1.70 2.85 2.95 1.91 p Value 1.9E4 5.7E5 0.097 3.1E4 4.4E5 0.085 1.2E4 9.5E5 0.032 Lower limit of 1.62 1.78 0.912 1.56 1.81 0.930 1.67 1.71 1.06 95% CI Upper limit of 4.72 5.34 3.04 4.52 5.43 3.10 4.85 5.09 3.44 95% CI OR Quartile 3 3.54 4.08 2.66 3.36 3.96 2.56 3.19 3.85 2.06 p Value 8.4E8 3.9E9 1.7E4 2.7E7 7.3E9 2.9E4 8.0E7 1.4E8 0.0033 Lower limit of 2.23 2.56 1.60 2.12 2.49 1.54 2.01 2.42 1.27 95% CI Upper limit of 5.63 6.51 4.44 5.32 6.32 4.24 5.05 6.14 3.33 95% CI OR Quartile 4 5.58 6.30 2.37 5.39 6.19 2.32 5.03 6.09 2.11 p Value 2.7E8 2.7E9 0.0016 5.0E8 3.8E9 0.0021 1.7E7 5.4E9 0.0053 Lower limit of 3.04 3.44 1.39 2.94 3.38 1.36 2.75 3.32 1.25 95% CI Upper limit of 10.2 11.6 4.06 9.87 11.4 3.96 9.21 11.2 3.57 95% CI

TABLE-US-00205 TABLE 27.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00443 0.0285 0.00428 0.0272 0.00427 0.0249 Average 0.0480 0.183 0.0488 0.179 0.0497 0.175 Stdev 0.245 0.412 0.248 0.409 0.251 0.405 p (t-test) 4.1E4 6.1E4 0.0010 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 168 149 165 152 161 156 sCr only Median 0.00443 0.0336 0.00428 0.0317 0.00443 0.0298 Average 0.0468 0.188 0.0471 0.186 0.0473 0.185 Stdev 0.243 0.417 0.243 0.416 0.244 0.415 p (t-test) 2.2E4 2.5E4 2.9E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 172 145 171 146 170 147 UO only Median 0.00711 0.0227 0.00710 0.0222 0.00710 0.0215 Average 0.0898 0.165 0.0902 0.164 0.0927 0.153 Stdev 0.328 0.368 0.329 0.366 0.335 0.354 p (t-test) 0.074 0.081 0.15 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 223 92 222 93 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.72 0.62 0.70 0.72 0.62 0.70 0.72 0.62 SE 0.029 0.029 0.036 0.029 0.029 0.036 0.029 0.029 0.035 p Value 8.1E13 1.0E14 4.6E4 3.6E12 1.2E14 4.9E4 3.5E12 8.0E14 8.7E4 nCohort 168 172 223 165 171 222 161 170 214 Recovered nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 85% 86% 82% 84% 86% 82% 85% 86% 82% Specificity 33% 34% 28% 33% 35% 28% 34% 34% 29% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 67% 68% 68% 66% 68% 68% 65% 67% 64% Specificity 65% 65% 57% 64% 65% 57% 64% 65% 57% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 41% 43% 37% 40% 42% 37% 39% 42% 35% Specificity 89% 90% 80% 88% 89% 80% 88% 89% 79% OR Quartile 2 2.74 3.26 1.70 2.67 3.32 1.73 2.85 3.11 1.84 p Value 3.1E4 4.4E5 0.085 4.0E4 3.4E5 0.074 1.6E4 7.3E5 0.043 Lower limit of 1.58 1.85 0.930 1.55 1.88 0.949 1.66 1.77 1.02 95% CI Upper limit of 4.74 5.76 3.10 4.59 5.85 3.16 4.91 5.44 3.32 95% CI OR Quartile 3 3.77 4.02 2.93 3.46 3.90 2.81 3.26 3.78 2.35 p Value 2.4E8 6.5E9 4.2E5 1.5E7 1.2E8 7.2E5 4.7E7 2.3E8 6.1E4 Lower limit of 2.37 2.51 1.75 2.18 2.44 1.69 2.06 2.37 1.44 95% CI Upper limit of 6.01 6.43 4.89 5.49 6.22 4.67 5.16 6.03 3.83 95% CI OR Quartile 4 5.44 6.39 2.32 5.15 6.27 2.27 4.80 6.16 2.05 p Value 9.7E9 6.6E10 0.0021 2.7E8 9.5E10 0.0027 9.8E8 1.4E9 0.0077 Lower limit of 3.05 3.55 1.36 2.89 3.48 1.33 2.70 3.42 1.21 95% CI Upper limit of 9.69 11.5 3.96 9.18 11.3 3.87 8.54 11.1 3.47 95% CI

TABLE-US-00206 TABLE 27.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00638 0.0249 0.00638 0.0235 0.00651 0.0232 Average 0.0834 0.161 0.0842 0.158 0.0846 0.157 Stdev 0.333 0.350 0.334 0.348 0.335 0.347 p (t-test) 0.052 0.063 0.069 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 203 114 201 116 200 117 sCr only Median 0.00574 0.0344 0.00574 0.0344 0.00574 0.0344 Average 0.0509 0.196 0.0509 0.196 0.0509 0.196 Stdev 0.238 0.433 0.238 0.433 0.238 0.433 p (t-test) 1.7E4 1.7E4 1.7E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 185 132 185 132 185 132 UO only Median 0.00708 0.0235 0.00701 0.0232 0.00709 0.0222 Average 0.0838 0.174 0.0841 0.172 0.0849 0.169 Stdev 0.324 0.372 0.325 0.370 0.326 0.367 p (t-test) 0.029 0.033 0.041 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 217 98 216 99 214 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.71 0.64 0.64 0.71 0.64 0.64 0.71 0.63 SE 0.033 0.030 0.035 0.033 0.030 0.035 0.033 0.030 0.035 p Value 4.7E6 7.9E12 6.6E5 1.1E5 7.9E12 7.0E5 1.5E5 7.9E12 1.9E4 nCohort 203 185 217 201 185 216 200 185 214 Recovered nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 0.00202 0.00202 0.00207 Sensitivity 83% 84% 83% 83% 84% 83% 83% 84% 82% Specificity 30% 31% 29% 29% 31% 29% 30% 31% 29% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 69% 71% 69% 68% 71% 69% 68% 71% 67% Specificity 61% 65% 59% 60% 65% 58% 60% 65% 58% Cutoff Quartile 4 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 0.0477 0.0477 0.0478 Sensitivity 37% 42% 37% 36% 42% 36% 36% 42% 36% Specificity 81% 87% 80% 81% 87% 80% 81% 87% 80% OR Quartile 2 2.10 2.41 1.91 1.99 2.41 1.94 2.03 2.41 1.84 p Value 0.012 0.0021 0.035 0.017 0.0021 0.030 0.015 0.0021 0.043 Lower limit of 1.18 1.38 1.05 1.13 1.38 1.07 1.15 1.38 1.02 95% CI Upper limit of 3.74 4.23 3.47 3.52 4.23 3.54 3.59 4.23 3.32 95% CI OR Quartile 3 3.47 4.57 3.20 3.23 4.57 3.07 3.12 4.57 2.84 p Value 5.7E7 7.0E10 7.1E6 1.9E6 7.0E10 1.3E5 3.3E6 7.0E10 3.8E5 Lower limit of 2.13 2.82 1.93 1.99 2.82 1.86 1.93 2.82 1.73 95% CI Upper limit of 5.65 7.40 5.31 5.23 7.40 5.08 5.04 7.40 4.66 95% CI OR Quartile 4 2.53 4.94 2.35 2.43 4.94 2.30 2.39 4.94 2.20 p Value 4.5E4 1.3E8 0.0016 7.6E4 1.3E8 0.0020 9.7E4 1.3E8 0.0033 Lower limit of 1.51 2.85 1.38 1.45 2.85 1.36 1.42 2.85 1.30 95% CI Upper limit of 4.26 8.57 3.99 4.09 8.57 3.90 4.00 8.57 3.73 95% CI

Example 28. Use of CC Motif Chemokine 23 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0202] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0203] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0204] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00207 TABLE 28.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00597 0.0390 0.00601 0.0499 0.00709 0.0479 Average 0.0619 0.201 0.0592 0.231 0.0780 0.208 Stdev 0.283 0.412 0.273 0.438 0.320 0.380 p (t-test) 4.5E4 3.0E5 0.0029 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 1.82 n (Patient) 205 112 221 96 236 81 sCr only Median 0.00599 0.0390 0.00630 0.0479 0.00694 0.0443 Average 0.0644 0.202 0.0621 0.230 0.0812 0.199 Stdev 0.284 0.417 0.274 0.444 0.323 0.379 p (t-test) 6.2E4 5.8E5 0.0072 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 1.82 n (Patient) 208 108 223 93 235 81 UO only Median 0.00870 0.0349 0.00864 0.0832 0.00859 0.0861 Average 0.0897 0.265 0.0887 0.286 0.0884 0.294 Stdev 0.311 0.484 0.309 0.497 0.309 0.502 p (t-test) 0.0023 9.0E4 6.2E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 275 40 278 37 279 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.70 0.63 0.73 0.72 0.66 0.70 0.69 0.68 SE 0.032 0.032 0.050 0.032 0.033 0.051 0.036 0.036 0.051 p Value 9.9E11 1.6E10 0.011 6.3E13 2.0E11 0.0017 4.1E8 1.1E7 4.7E4 nCohort Non- 205 208 275 221 223 278 236 235 279 persistent nCohort 112 108 40 96 93 37 81 81 36 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 84% 85% 78% 86% 87% 81% 84% 86% 83% Specificity 30% 30% 25% 30% 30% 26% 28% 29% 26% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 72% 73% 68% 76% 75% 73% 73% 74% 75% Specificity 62% 62% 52% 61% 61% 53% 58% 58% 53% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 47% 47% 48% 52% 51% 51% 51% 48% 53% Specificity 87% 87% 78% 86% 86% 78% 83% 83% 78% OR Quartile 2 2.21 2.50 1.18 2.72 2.90 1.50 2.03 2.59 1.77 p Value 0.0080 0.0031 0.69 0.0026 0.0019 0.36 0.035 0.0073 0.22 Lower limit of 1.23 1.36 0.534 1.42 1.48 0.630 1.05 1.29 0.709 95% CI Upper limit of 3.98 4.59 2.59 5.22 5.67 3.56 3.92 5.19 4.43 95% CI OR Quartile 3 4.25 4.45 2.28 4.98 4.67 3.03 3.65 3.99 3.39 p Value 1.5E8 9.3E9 0.021 6.0E9 2.5E8 0.0044 4.6E6 1.3E6 0.0025 Lower limit of 2.58 2.67 1.13 2.90 2.71 1.41 2.10 2.28 1.54 95% CI Upper limit of 7.02 7.40 4.61 8.56 8.03 6.50 6.34 7.00 7.47 95% CI OR Quartile 4 5.92 5.75 3.24 6.92 6.10 3.84 5.18 4.53 4.08 p Value 2.2E10 4.2E10 7.4E4 8.7E12 1.4E10 1.9E4 6.3E9 8.7E8 1.1E4 Lower limit of 3.42 3.32 1.64 3.97 3.51 1.89 2.97 2.60 2.00 95% CI Upper limit of 10.3 9.96 6.42 12.1 10.6 7.76 9.02 7.87 8.33 95% CI

TABLE-US-00208 TABLE 28.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00500 0.0347 0.00576 0.0465 0.00630 0.0472 Average 0.0512 0.196 0.0487 0.224 0.0681 0.207 Stdev 0.245 0.429 0.234 0.456 0.294 0.413 p (t-test) 1.6E4 8.6E6 7.0E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.34 n (Patient) 186 131 204 113 219 98 sCr only Median 0.00576 0.0338 0.00578 0.0422 0.00615 0.0387 Average 0.0548 0.199 0.0526 0.222 0.0724 0.198 Stdev 0.244 0.439 0.236 0.461 0.297 0.412 p (t-test) 2.1E4 2.2E5 0.0023 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.34 n (Patient) 192 124 206 110 218 98 UO only Median 0.00780 0.0298 0.00780 0.0355 0.00778 0.0410 Average 0.0894 0.210 0.0882 0.224 0.0879 0.228 Stdev 0.319 0.414 0.317 0.425 0.316 0.428 p (t-test) 0.014 0.0073 0.0059 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 256 59 260 55 261 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.71 0.65 0.74 0.73 0.67 0.72 0.70 0.68 SE 0.030 0.031 0.042 0.030 0.031 0.043 0.033 0.033 0.043 p Value 2.1E13 1.3E11 4.3E4 6.7E16 8.0E14 8.4E5 2.1E11 8.4E10 2.3E5 nCohort Non- 186 192 256 204 206 260 219 218 261 persistent nCohort 131 124 59 113 110 55 98 98 54 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 84% 85% 81% 87% 87% 84% 86% 87% 85% Specificity 31% 31% 27% 31% 32% 27% 30% 30% 27% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 72% 72% 71% 76% 75% 75% 74% 74% 76% Specificity 65% 64% 55% 64% 64% 55% 61% 61% 55% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 45% 44% 46% 50% 47% 47% 50% 46% 48% Specificity 89% 87% 80% 88% 87% 80% 86% 84% 80% OR Quartile 2 2.37 2.51 1.58 2.99 3.16 1.88 2.53 2.84 2.15 p Value 0.0025 0.0017 0.21 5.3E4 3.7E4 0.10 0.0042 0.0017 0.061 Lower limit of 1.36 1.41 0.775 1.61 1.68 0.876 1.34 1.48 0.967 95% CI Upper limit of 4.16 4.47 3.22 5.54 5.95 4.05 4.78 5.45 4.78 95% CI OR Quartile 3 4.73 4.53 2.98 5.72 5.37 3.58 4.52 4.57 3.88 p Value 3.5E10 1.5E9 5.0E4 4.4E11 2.2E10 1.3E4 2.3E8 1.9E8 7.2E5 Lower limit of 2.91 2.78 1.61 3.40 3.20 1.86 2.66 2.69 1.99 95% CI Upper limit of 7.68 7.40 5.51 9.60 9.02 6.88 7.66 7.76 7.58 95% CI OR Quartile 4 6.44 5.15 3.31 7.37 5.94 3.50 6.06 4.59 3.64 p Value 1.5E10 5.2E9 8.2E5 3.7E12 2.3E10 5.5E5 1.2E10 3.1E8 3.6E5 Lower limit of 3.64 2.97 1.82 4.19 3.43 1.90 3.50 2.68 1.97 95% CI Upper limit of 11.4 8.93 6.01 12.9 10.3 6.44 10.5 7.89 6.73 95% CI

TABLE-US-00209 TABLE 28.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00463 0.0344 0.00466 0.0443 0.00597 0.0434 Average 0.0451 0.193 0.0427 0.214 0.0589 0.207 Stdev 0.240 0.421 0.230 0.440 0.280 0.415 p (t-test) 1.1E4 9.0E6 1.9E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.34 n (Patient) 175 142 190 127 205 112 sCr only Median 0.00500 0.0344 0.00531 0.0425 0.00599 0.0387 Average 0.0479 0.198 0.0462 0.217 0.0622 0.206 Stdev 0.239 0.430 0.231 0.449 0.280 0.421 p (t-test) 9.9E5 1.2E5 3.3E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.34 n (Patient) 182 134 195 121 208 108 UO only Median 0.00765 0.0238 0.00751 0.0272 0.00751 0.0272 Average 0.0863 0.203 0.0849 0.218 0.0849 0.218 Stdev 0.314 0.415 0.311 0.428 0.311 0.428 p (t-test) 0.012 0.0053 0.0053 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 246 69 251 64 251 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.72 0.63 0.75 0.75 0.66 0.72 0.71 0.66 SE 0.029 0.029 0.040 0.029 0.029 0.040 0.031 0.032 0.040 p Value 7.8E15 2.9E14 9.5E4 0 0 9.0E5 9.3E13 1.4E11 9.0E5 nCohort Non- 175 182 246 190 195 251 205 208 251 persistent nCohort 142 134 69 127 121 64 112 108 64 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 84% 85% 81% 87% 88% 84% 86% 87% 84% Specificity 32% 32% 27% 33% 33% 27% 31% 31% 27% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 71% 72% 68% 76% 75% 72% 74% 74% 72% Specificity 67% 66% 55% 67% 66% 55% 63% 62% 55% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 44% 44% 42% 48% 47% 44% 47% 45% 44% Specificity 90% 89% 80% 90% 89% 80% 87% 86% 80% OR Quartile 2 2.43 2.73 1.58 3.13 3.45 2.05 2.66 3.05 2.05 p Value 0.0015 5.1E4 0.18 1.6E4 8.5E5 0.054 0.0016 5.6E4 0.054 Lower limit of 1.41 1.55 0.811 1.73 1.86 0.987 1.45 1.62 0.987 95% CI Upper limit of 4.21 4.82 3.07 5.68 6.40 4.25 4.88 5.75 4.25 95% CI OR Quartile 3 4.97 4.89 2.60 6.24 5.80 3.17 4.86 4.76 3.17 p Value 6.1E11 1.4E10 9.3E4 1.2E12 1.2E11 1.6E4 1.2E9 2.6E9 1.6E4 Lower limit of 3.07 3.01 1.48 3.77 3.49 1.74 2.92 2.85 1.74 95% CI Upper limit of 8.03 7.94 4.57 10.3 9.63 5.77 8.08 7.96 5.77 95% CI OR Quartile 4 7.41 6.37 2.84 8.32 7.00 3.05 5.92 4.93 3.05 p Value 6.0E11 3.0E10 3.3E4 1.7E12 2.1E11 1.7E4 2.2E10 7.8E9 1.7E4 Lower limit of 4.07 3.58 1.61 4.62 3.96 1.70 3.42 2.87 1.70 95% CI Upper limit of 13.5 11.3 5.03 15.0 12.4 5.46 10.3 8.47 5.46 95% CI

TABLE-US-00210 TABLE 28.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00463 0.0338 0.00470 0.0434 0.00578 0.0422 Average 0.0456 0.190 0.0429 0.212 0.0478 0.221 Stdev 0.241 0.418 0.231 0.439 0.227 0.458 p (t-test) 1.5E4 1.1E5 9.8E6 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 173 144 189 128 201 116 sCr only Median 0.00552 0.0338 0.00552 0.0422 0.00599 0.0387 Average 0.0484 0.195 0.0462 0.212 0.0508 0.222 Stdev 0.240 0.428 0.233 0.444 0.228 0.465 p (t-test) 1.4E4 1.9E5 1.6E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 180 136 192 124 204 112 UO only Median 0.00751 0.0235 0.00751 0.0272 0.00751 0.0272 Average 0.0865 0.192 0.0847 0.207 0.0847 0.207 Stdev 0.318 0.400 0.314 0.413 0.314 0.413 p (t-test) 0.019 0.0080 0.0080 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 239 76 245 70 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.72 0.63 0.75 0.74 0.66 0.72 0.71 0.66 SE 0.029 0.030 0.038 0.029 0.029 0.039 0.031 0.031 0.039 p Value 1.7E14 3.4E13 4.9E4 0 2.2E16 3.8E5 2.7E13 7.6E12 3.8E5 nCohort Non- 173 180 239 189 192 245 201 204 245 persistent nCohort 144 136 76 128 124 70 116 112 70 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 84% 85% 83% 87% 87% 86% 86% 87% 86% Specificity 32% 32% 28% 33% 33% 28% 31% 31% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 70% 71% 67% 75% 74% 71% 74% 73% 71% Specificity 66% 66% 55% 67% 66% 56% 64% 63% 56% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 44% 43% 41% 48% 47% 43% 47% 46% 43% Specificity 90% 89% 80% 90% 89% 80% 87% 86% 80% OR Quartile 2 2.52 2.60 1.85 3.19 3.30 2.35 2.85 2.96 2.35 p Value 9.5E4 8.2E4 0.068 1.3E4 1.1E4 0.021 7.0E4 6.0E4 0.021 Lower limit of 1.46 1.49 0.955 1.76 1.80 1.14 1.56 1.59 1.14 95% CI Upper limit of 4.36 4.56 3.58 5.77 6.04 4.86 5.23 5.49 4.86 95% CI OR Quartile 3 4.66 4.57 2.52 6.00 5.49 3.17 5.03 4.60 3.17 p Value 2.5E10 5.6E10 8.5E4 2.5E12 2.6E11 8.8E5 3.8E10 3.2E9 8.8E5 Lower limit of 2.89 2.83 1.46 3.63 3.33 1.78 3.03 2.78 1.78 95% CI Upper limit of 7.50 7.38 4.33 9.91 9.05 5.65 8.33 7.63 5.65 95% CI OR Quartile 4 7.14 6.13 2.74 8.15 7.16 3.00 5.86 5.26 3.00 p Value 1.3E10 6.6E10 3.8E4 2.6E12 1.9E11 1.5E4 3.0E10 2.5E9 1.5E4 Lower limit of 3.92 3.45 1.57 4.53 4.03 1.70 3.38 3.05 1.70 95% CI Upper limit of 13.0 10.9 4.78 14.7 12.7 5.29 10.2 9.07 5.29 95% CI

TABLE-US-00211 TABLE 28.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00463 0.0317 0.00466 0.0384 0.00578 0.0369 Average 0.0464 0.185 0.0438 0.205 0.0485 0.214 Stdev 0.244 0.413 0.234 0.432 0.229 0.452 p (t-test) 2.6E4 2.7E5 2.1E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 169 148 184 133 197 120 sCr only Median 0.00552 0.0317 0.00552 0.0369 0.00599 0.0351 Average 0.0493 0.190 0.0469 0.206 0.0516 0.215 Stdev 0.243 0.423 0.235 0.438 0.231 0.458 p (t-test) 2.5E4 3.8E5 3.5E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 176 140 188 128 200 116 UO only Median 0.00717 0.0285 0.00722 0.0291 0.00722 0.0291 Average 0.0798 0.205 0.0791 0.212 0.0791 0.212 Stdev 0.312 0.402 0.311 0.409 0.311 0.409 p (t-test) 0.0045 0.0028 0.0028 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 234 81 237 78 237 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.72 0.71 0.66 0.74 0.73 0.66 0.72 0.70 0.66 SE 0.029 0.030 0.037 0.029 0.030 0.037 0.031 0.031 0.037 p Value 7.2E14 2.8E12 2.1E5 0 4.7E15 1.1E5 2.3E12 7.2E11 1.1E5 nCohort Non- 169 176 234 184 188 237 197 200 237 persistent nCohort 148 140 81 133 128 78 120 116 78 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 84% 84% 84% 86% 86% 85% 86% 85% 85% Specificity 33% 32% 28% 33% 32% 28% 31% 31% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 69% 69% 69% 73% 73% 71% 72% 72% 71% Specificity 66% 65% 56% 66% 65% 57% 63% 62% 57% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 43% 42% 42% 46% 45% 42% 45% 44% 42% Specificity 90% 89% 81% 90% 89% 81% 87% 86% 81% OR Quartile 2 2.49 2.37 2.05 3.17 2.94 2.17 2.78 2.62 2.17 p Value 9.7E4 0.0020 0.032 1.1E4 3.0E4 0.025 7.4E4 0.0015 0.025 Lower limit of 1.45 1.37 1.06 1.77 1.64 1.10 1.54 1.44 1.10 95% CI Upper limit of 4.29 4.11 3.97 5.68 5.27 4.27 5.04 4.75 4.27 95% CI OR Quartile 3 4.36 4.25 2.90 5.30 5.03 3.11 4.58 4.19 3.11 p Value 9.9E10 2.3E9 1.0E4 2.4E11 1.2E10 5.3E5 1.7E9 1.4E8 5.3E5 Lower limit of 2.72 2.65 1.69 3.25 3.08 1.79 2.79 2.56 1.79 95% CI Upper limit of 6.99 6.84 4.96 8.65 8.22 5.39 7.51 6.87 5.39 95% CI OR Quartile 4 6.63 5.68 3.04 7.36 6.59 3.04 5.38 4.82 3.04 p Value 5.6E10 3.0E9 7.1E5 2.2E11 1.0E10 7.8E5 1.7E9 1.3E8 7.8E5 Lower limit of 3.64 3.20 1.76 4.10 3.72 1.75 3.11 2.80 1.75 95% CI Upper limit of 12.0 10.1 5.26 13.2 11.7 5.29 9.30 8.29 5.29 95% CI

Example 29. Use of CC Motif Chemokine 23 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0205] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0206] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0207] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00212 TABLE 29.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00330 0.0226 0.00434 0.0230 0.00458 0.0289 Average 0.0467 0.150 0.0475 0.175 0.0486 0.192 Stdev 0.285 0.365 0.250 0.402 0.239 0.426 p (t-test) 0.0087 8.3E4 1.7E4 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 119 198 158 159 179 138 sCr only Median 0.00367 0.0249 0.00428 0.0259 0.00460 0.0351 Average 0.0479 0.156 0.0473 0.179 0.0487 0.199 Stdev 0.277 0.374 0.250 0.406 0.238 0.433 p (t-test) 0.0055 5.6E4 9.8E5 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 130 186 162 154 184 132 UO only Median 0.00834 0.0202 0.00834 0.0367 0.00834 0.0554 Average 0.0863 0.195 0.0833 0.236 0.0824 0.261 Stdev 0.317 0.404 0.308 0.442 0.304 0.464 p (t-test) 0.016 0.0018 5.1E4 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 241 74 256 59 263 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.60 0.69 0.71 0.63 0.71 0.72 0.66 SE 0.028 0.028 0.039 0.030 0.029 0.042 0.030 0.030 0.044 p Value 4.4E16 2.2E16 0.0089 2.1E10 1.2E12 0.0019 2.9E12 2.0E13 2.9E4 nCohort Non- 119 130 241 158 162 256 179 184 263 persistent nCohort 198 186 74 159 154 59 138 132 52 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 82% 83% 78% 82% 83% 76% 85% 86% 79% Specificity 36% 36% 26% 32% 33% 25% 32% 33% 26% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 64% 66% 61% 65% 67% 66% 67% 69% 69% Specificity 72% 72% 53% 65% 66% 54% 63% 64% 54% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 37% 38% 41% 39% 40% 47% 42% 43% 52% Specificity 95% 94% 80% 89% 90% 80% 88% 88% 80% OR Quartile 2 2.55 2.73 1.28 2.08 2.39 1.09 2.67 2.88 1.30 p Value 4.3E4 1.7E4 0.43 0.0063 0.0014 0.79 5.9E4 3.2E4 0.48 Lower limit of 1.51 1.62 0.688 1.23 1.40 0.564 1.53 1.62 0.632 95% CI Upper limit of 4.28 4.60 2.39 3.50 4.08 2.12 4.68 5.12 2.67 95% CI OR Quartile 3 4.56 4.98 1.76 3.35 3.93 2.24 3.54 3.88 2.60 p Value 1.9E9 1.2E10 0.037 2.7E7 9.5E9 0.0075 1.2E7 2.3E8 0.0033 Lower limit of 2.78 3.05 1.03 2.11 2.46 1.24 2.22 2.41 1.38 95% CI Upper limit of 7.48 8.12 2.99 5.31 6.27 4.06 5.65 6.24 4.92 95% CI OR Quartile 4 11.2 9.42 2.67 4.97 5.75 3.63 5.17 5.60 4.38 p Value 5.0E8 1.4E8 5.9E4 7.8E8 9.3E9 2.2E5 8.7E9 2.0E9 3.3E6 Lower limit of 4.71 4.34 1.53 2.77 3.16 2.00 2.96 3.19 2.35 95% CI Upper limit of 26.8 20.4 4.68 8.93 10.4 6.59 9.06 9.83 8.17 95% CI

TABLE-US-00213 TABLE 29.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00314 0.0220 0.00406 0.0249 0.00406 0.0317 Average 0.0484 0.146 0.0463 0.167 0.0462 0.182 Stdev 0.294 0.360 0.258 0.390 0.247 0.409 p (t-test) 0.015 0.0015 3.6E4 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 112 205 147 170 165 152 sCr only Median 0.00335 0.0249 0.00413 0.0272 0.00420 0.0341 Average 0.0485 0.153 0.0481 0.172 0.0484 0.184 Stdev 0.281 0.371 0.256 0.397 0.247 0.413 p (t-test) 0.0074 0.0012 3.9E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 126 190 154 162 169 147 UO only Median 0.00730 0.0215 0.00744 0.0285 0.00737 0.0326 Average 0.0880 0.169 0.0843 0.197 0.0833 0.212 Stdev 0.328 0.367 0.318 0.396 0.314 0.412 p (t-test) 0.055 0.011 0.0053 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 222 93 238 77 245 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.74 0.61 0.71 0.72 0.64 0.73 0.74 0.66 SE 0.028 0.027 0.036 0.029 0.028 0.038 0.028 0.028 0.039 p Value 2.2E16 0 0.0013 2.4E13 8.0E15 1.9E4 2.2E16 0 2.7E5 nCohort Non- 112 126 222 147 154 238 165 169 245 persistent nCohort 205 190 93 170 162 77 152 147 70 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 82% 83% 81% 82% 84% 79% 86% 86% 81% Specificity 38% 37% 27% 33% 34% 26% 35% 35% 27% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 63% 65% 63% 66% 67% 69% 68% 69% 71% Specificity 73% 73% 55% 68% 68% 56% 67% 67% 56% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 37% 38% 39% 39% 40% 44% 42% 42% 47% Specificity 96% 94% 81% 90% 90% 81% 90% 90% 81% OR Quartile 2 2.72 2.94 1.58 2.33 2.74 1.37 3.12 3.41 1.62 p Value 1.7E4 5.6E5 0.13 0.0015 2.2E4 0.32 5.8E5 2.3E5 0.16 Lower limit of 1.62 1.74 0.873 1.38 1.61 0.737 1.79 1.93 0.831 95% CI Upper limit of 4.59 4.96 2.86 3.93 4.69 2.55 5.43 6.01 3.14 95% CI OR Quartile 3 4.64 5.08 2.16 4.11 4.41 2.80 4.33 4.57 3.17 p Value 2.6E9 1.1E10 0.0025 3.7E9 7.3E10 2.2E4 1.0E9 3.5E10 8.8E5 Lower limit of 2.80 3.10 1.31 2.57 2.75 1.62 2.71 2.84 1.78 95% CI Upper limit of 7.69 8.33 3.55 6.57 7.06 4.83 6.94 7.35 5.65 95% CI OR Quartile 4 12.3 10.4 2.63 6.03 6.05 3.39 6.77 6.52 3.86 p Value 1.6E7 2.0E8 3.9E4 2.4E8 1.2E8 1.6E5 6.9E10 8.3E10 3.2E6 Lower limit of 4.82 4.58 1.54 3.21 3.26 1.95 3.69 3.58 2.19 95% CI Upper limit of 31.6 23.5 4.48 11.3 11.2 5.91 12.4 11.9 6.81 95% CI

TABLE-US-00214 TABLE 29.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00321 0.0217 0.00424 0.0232 0.00424 0.0285 Average 0.0488 0.145 0.0472 0.164 0.0478 0.174 Stdev 0.295 0.359 0.261 0.388 0.252 0.401 p (t-test) 0.016 0.0022 8.8E4 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 111 206 144 173 158 159 sCr only Median 0.00352 0.0235 0.00427 0.0259 0.00427 0.0293 Average 0.0493 0.152 0.0490 0.169 0.0500 0.177 Stdev 0.283 0.369 0.259 0.394 0.252 0.407 p (t-test) 0.0091 0.0018 8.9E4 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 124 192 151 165 163 153 UO only Median 0.00717 0.0212 0.00722 0.0235 0.00717 0.0260 Average 0.0910 0.155 0.0880 0.172 0.0869 0.182 Stdev 0.336 0.351 0.327 0.371 0.322 0.384 p (t-test) 0.12 0.050 0.029 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 212 103 225 90 232 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.61 0.70 0.71 0.62 0.72 0.72 0.64 SE 0.028 0.028 0.035 0.029 0.029 0.036 0.028 0.029 0.037 p Value 6.7E16 2.2E16 0.0019 3.1E12 4.3E13 5.8E4 8.4E15 3.6E14 1.3E4 nCohort Non- 111 124 212 144 151 225 158 163 232 persistent nCohort 206 192 103 173 165 90 159 153 83 Persistent Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 82% 83% 81% 82% 83% 80% 85% 85% 82% Specificity 38% 37% 28% 33% 34% 27% 35% 34% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 63% 65% 63% 65% 66% 67% 67% 67% 69% Specificity 73% 73% 56% 67% 68% 56% 66% 66% 56% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 36% 38% 37% 38% 39% 40% 40% 41% 42% Specificity 95% 94% 81% 90% 90% 81% 90% 90% 81% OR Quartile 2 2.78 2.84 1.60 2.29 2.50 1.49 3.00 2.96 1.73 p Value 1.3E4 9.0E5 0.11 0.0018 6.9E4 0.19 7.4E5 1.1E4 0.089 Lower limit of 1.65 1.68 0.902 1.36 1.47 0.821 1.74 1.71 0.921 95% CI Upper limit of 4.69 4.79 2.84 3.85 4.23 2.70 5.17 5.12 3.24 95% CI OR Quartile 3 4.52 4.83 2.19 3.79 4.05 2.59 3.96 4.05 2.84 p Value 4.7E9 3.9E10 0.0015 2.3E8 5.0E9 2.6E4 7.4E9 5.0E9 1.2E4 Lower limit of 2.73 2.95 1.35 2.37 2.54 1.55 2.48 2.53 1.67 95% CI Upper limit of 7.50 7.90 3.55 6.05 6.48 4.32 6.32 6.46 4.84 95% CI OR Quartile 4 12.1 10.0 2.44 5.73 5.75 2.82 5.98 5.85 3.12 p Value 2.0E7 3.2E8 8.9E4 5.9E8 3.0E8 1.5E4 7.4E9 6.6E9 4.4E5 Lower limit of 4.74 4.43 1.44 3.05 3.10 1.65 3.26 3.22 1.81 95% CI Upper limit of 31.1 22.7 4.12 10.8 10.7 4.83 11.0 10.6 5.38 95% CI

TABLE-US-00215 TABLE 29.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00314 0.0215 0.00420 0.0231 0.00424 0.0284 Average 0.0492 0.144 0.0475 0.164 0.0484 0.172 Stdev 0.296 0.358 0.262 0.387 0.254 0.399 p (t-test) 0.018 0.0024 0.0011 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 110 207 143 174 156 161 sCr only Median 0.00352 0.0235 0.00424 0.0249 0.00427 0.0289 Average 0.0493 0.152 0.0493 0.168 0.0503 0.176 Stdev 0.283 0.369 0.259 0.393 0.253 0.405 p (t-test) 0.0091 0.0020 0.0010 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 124 192 150 166 162 154 UO only Median 0.00710 0.0207 0.00717 0.0222 0.00717 0.0232 Average 0.0925 0.150 0.0897 0.163 0.0888 0.170 Stdev 0.339 0.345 0.330 0.363 0.326 0.373 p (t-test) 0.16 0.079 0.056 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 208 107 220 95 226 89 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.73 0.61 0.70 0.71 0.62 0.71 0.72 0.63 SE 0.028 0.028 0.034 0.029 0.029 0.035 0.029 0.029 0.036 p Value 6.7E16 2.2E16 0.0020 4.7E12 6.7E13 6.9E4 7.8E14 6.0E14 3.6E4 nCohort Non- 110 124 208 143 150 220 156 162 226 persistent nCohort Persistent 207 192 107 174 166 95 161 154 89 Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 82% 83% 81% 82% 83% 81% 84% 85% 82% Specificity 38% 37% 28% 34% 34% 28% 35% 35% 28% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 62% 65% 63% 64% 66% 66% 66% 67% 67% Specificity 73% 73% 56% 67% 67% 57% 66% 66% 57% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 36% 38% 36% 38% 39% 38% 40% 40% 39% Specificity 95% 94% 80% 90% 90% 80% 90% 90% 81% OR Quartile 2 2.84 2.84 1.72 2.33 2.54 1.64 2.88 3.01 1.76 p Value 9.5E5 9.0E5 0.062 0.0015 5.5E4 0.10 1.2E4 8.3E5 0.070 Lower limit of 1.68 1.68 0.972 1.38 1.50 0.908 1.68 1.74 0.954 95% CI Upper limit of 4.79 4.79 3.05 3.92 4.31 2.97 4.94 5.21 3.26 95% CI OR Quartile 3 4.41 4.83 2.15 3.69 3.94 2.59 3.75 3.93 2.70 p Value 8.5E9 3.9E10 0.0017 4.2E8 9.3E9 2.0E4 2.5E8 9.5E9 1.6E4 Lower limit of 2.66 2.95 1.34 2.31 2.47 1.57 2.35 2.46 1.61 95% CI Upper limit of 7.31 7.90 3.47 5.89 6.29 4.28 5.96 6.27 4.52 95% CI OR Quartile 4 11.9 10.0 2.24 5.63 5.65 2.51 5.77 5.75 2.68 p Value 2.4E7 3.2E8 0.0025 7.9E8 4.1E8 6.9E4 1.4E8 9.3E9 3.3E4 Lower limit of 4.66 4.43 1.33 3.00 3.04 1.48 3.15 3.16 1.57 95% CI Upper limit of 30.6 22.7 3.78 10.6 10.5 4.27 10.6 10.4 4.59 95% CI

TABLE-US-00216 TABLE 29.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00294 0.0212 0.00396 0.0222 0.00413 0.0259 Average 0.0503 0.142 0.0487 0.159 0.0498 0.166 Stdev 0.302 0.355 0.267 0.382 0.259 0.393 p (t-test) 0.024 0.0039 0.0022 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 106 211 138 179 150 167 sCr only Median 0.00330 0.0232 0.00396 0.0249 0.00413 0.0289 Average 0.0499 0.150 0.0498 0.164 0.0508 0.172 Stdev 0.287 0.366 0.263 0.389 0.256 0.401 p (t-test) 0.011 0.0028 0.0015 Min 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 3.28E9 Max 2.47 2.43 2.47 2.43 2.47 2.43 n (Patient) 121 195 146 170 158 158 UO only Median 0.00675 0.0215 0.00709 0.0232 0.00708 0.0249 Average 0.0858 0.158 0.0841 0.169 0.0836 0.175 Stdev 0.335 0.350 0.327 0.364 0.324 0.372 p (t-test) 0.070 0.038 0.028 Min 6.85E7 3.28E9 6.85E7 3.28E9 3.28E9 3.28E9 Max 2.47 1.82 2.47 1.82 2.47 1.82 n (Patient) 202 113 212 103 217 98 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.74 0.63 0.70 0.72 0.63 0.71 0.72 0.64 SE 0.028 0.028 0.033 0.029 0.028 0.034 0.029 0.028 0.035 p Value 0 0 1.5E4 2.8E12 3.9E14 1.1E4 2.3E13 3.6E15 3.8E5 nCohort Non- 106 121 202 138 146 212 150 158 217 persistent nCohort Persistent 211 195 113 179 170 103 167 158 98 Cutoff Quartile 2 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 0.00202 0.00200 0.00207 Sensitivity 82% 83% 82% 83% 84% 82% 84% 85% 83% Specificity 40% 38% 29% 35% 35% 28% 35% 35% 29% Cutoff Quartile 3 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 0.0104 Sensitivity 63% 65% 65% 64% 66% 67% 65% 68% 68% Specificity 75% 74% 58% 68% 69% 58% 67% 68% 58% Cutoff Quartile 4 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 0.0477 0.0468 0.0478 Sensitivity 36% 37% 35% 37% 38% 37% 38% 39% 38% Specificity 95% 94% 81% 90% 90% 81% 89% 89% 81% OR Quartile 2 3.09 3.01 1.92 2.55 2.72 1.75 2.96 3.22 1.91 p Value 2.7E5 3.8E5 0.025 4.5E4 2.1E4 0.060 7.1E5 3.0E5 0.035 Lower limit of 1.82 1.78 1.08 1.51 1.60 0.976 1.73 1.86 1.05 95% CI Upper limit of 5.23 5.09 3.39 4.29 4.62 3.12 5.06 5.58 3.47 95% CI OR Quartile 3 4.89 5.42 2.51 3.84 4.45 2.80 3.76 4.40 2.99 p Value 2.0E9 4.6E11 1.5E4 2.1E8 6.8E10 4.1E5 2.5E8 7.3E10 2.0E5 Lower limit of 2.91 3.28 1.56 2.40 2.77 1.71 2.36 2.75 1.81 95% CI Upper limit of 8.21 8.97 4.04 6.15 7.15 4.59 5.99 7.05 4.95 95% CI OR Quartile 4 11.1 9.53 2.29 5.17 5.27 2.44 5.20 5.36 2.53 p Value 5.2E7 6.3E8 0.0018 3.2E7 1.3E7 8.9E4 9.1E8 3.4E8 6.0E4 Lower limit of 4.35 4.21 1.36 2.75 2.84 1.44 2.84 2.95 1.49 95% CI Upper limit of 28.6 21.6 3.85 9.72 9.78 4.12 9.53 9.72 4.29 95% CI

Example 30. Use of CC Motif Chemokine 24 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0208] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 24 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0209] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0210] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00217 TABLE 30.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 9.06 33.1 10.0 32.0 11.0 31.8 Average 45.2 80.7 42.4 79.7 44.4 78.8 Stdev 111 153 104 152 110 151 p (t-test) 0.098 0.11 0.16 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 670 1150 670 1150 670 1150 n (Patient) 57 259 46 270 41 275 sCr only Median 11.9 35.0 11.5 36.2 10.0 37.4 Average 54.4 79.7 54.2 79.5 52.8 79.5 Stdev 147 146 149 145 152 144 p (t-test) 0.19 0.19 0.18 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 76 239 74 241 70 245 UO only Median 19.3 47.2 18.3 43.7 18.4 40.8 Average 52.4 109 49.3 104 44.3 103 Stdev 115 182 113 175 79.7 186 p (t-test) 8.4E4 8.6E4 3.2E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 670 1150 n (Patient) 193 121 172 142 155 159 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.62 0.66 0.64 0.63 0.66 0.63 0.65 0.64 SE 0.037 0.035 0.032 0.041 0.035 0.031 0.043 0.035 0.031 p Value 8.8E5 4.2E4 3.1E7 8.5E4 1.5E4 1.3E7 0.0027 1.7E5 8.6E6 nCohort Recovered 57 76 193 46 74 172 41 70 155 nCohort Non- 259 239 121 270 241 142 275 245 159 recovered Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 78% 79% 87% 77% 79% 85% 77% 79% 82% Specificity 40% 37% 33% 39% 38% 34% 39% 40% 33% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 54% 55% 65% 53% 56% 63% 53% 56% 60% Specificity 68% 66% 60% 67% 68% 61% 68% 70% 61% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 28% 28% 39% 27% 28% 36% 27% 28% 35% Specificity 88% 84% 83% 87% 85% 84% 85% 86% 85% OR Quartile 2 2.45 2.15 3.18 2.20 2.27 2.93 2.15 2.54 2.29 p Value 0.0037 0.0073 1.8E4 0.019 0.0043 1.7E4 0.029 0.0013 0.0021 Lower limit of 1.34 1.23 1.73 1.14 1.29 1.67 1.08 1.44 1.35 95% CI Upper limit of 4.50 3.76 5.83 4.25 3.98 5.14 4.28 4.48 3.89 95% CI OR Quartile 3 2.55 2.37 2.77 2.33 2.61 2.71 2.40 2.96 2.35 p Value 0.0026 0.0017 2.3E5 0.012 6.2E4 2.0E5 0.014 1.9E4 2.2E4 Lower limit of 1.39 1.39 1.73 1.20 1.51 1.71 1.19 1.67 1.49 95% CI Upper limit of 4.69 4.06 4.45 4.51 4.52 4.29 4.83 5.23 3.69 95% CI OR Quartile 4 2.75 2.08 3.20 2.47 2.25 2.88 2.11 2.35 2.89 p Value 0.018 0.035 1.5E5 0.049 0.023 9.2E5 0.11 0.021 1.3E4 Lower limit of 1.19 1.05 1.89 1.01 1.12 1.70 0.852 1.14 1.68 95% CI Upper limit of 6.35 4.09 5.41 6.07 4.53 4.90 5.22 4.86 4.97 95% CI

TABLE-US-00218 TABLE 30.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.5 38.0 12.2 33.1 12.2 33.1 Average 34.3 90.3 37.0 86.7 37.2 85.1 Stdev 77.1 164 81.7 161 85.6 158 p (t-test) 0.0020 0.0088 0.015 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 670 1150 670 1150 670 1150 n (Patient) 90 226 79 237 71 245 sCr only Median 13.6 38.0 12.9 38.4 11.7 39.2 Average 47.3 88.0 47.0 87.7 45.5 87.5 Stdev 125 154 127 154 129 152 p (t-test) 0.019 0.020 0.018 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 106 210 104 212 99 217 UO only Median 22.7 51.1 20.4 49.9 21.0 43.2 Average 52.2 119 50.8 111 46.6 110 Stdev 112 193 113 183 83.6 196 p (t-test) 1.2E4 3.3E4 1.4E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 670 1150 n (Patient) 211 103 193 121 177 137 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.64 0.67 0.63 0.64 0.66 0.63 0.66 0.64 SE 0.032 0.032 0.034 0.034 0.032 0.032 0.035 0.031 0.032 p Value 1.9E6 2.1E5 3.8E7 1.2E4 7.4E6 4.5E7 1.6E4 4.3E7 1.8E5 nCohort Recovered 90 106 211 79 104 193 71 99 177 nCohort Non- 226 210 103 237 212 121 245 217 137 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 80% 80% 86% 78% 81% 85% 78% 81% 82% Specificity 37% 36% 31% 35% 37% 32% 37% 38% 31% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 56% 57% 66% 54% 57% 64% 54% 58% 61% Specificity 66% 63% 58% 63% 64% 59% 65% 67% 58% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 31% 31% 43% 30% 31% 39% 29% 31% 37% Specificity 91% 87% 83% 90% 88% 83% 90% 89% 84% OR Quartile 2 2.27 2.30 2.83 2.00 2.40 2.64 2.09 2.67 2.12 p Value 0.0029 0.0018 0.0013 0.014 0.0011 0.0011 0.011 2.7E4 0.0066 Lower limit of 1.32 1.36 1.50 1.15 1.42 1.47 1.18 1.58 1.23 95% CI Upper limit of 3.88 3.89 5.34 3.49 4.06 4.75 3.70 4.54 3.66 95% CI OR Quartile 3 2.44 2.25 2.66 2.06 2.41 2.47 2.18 2.72 2.14 p Value 5.7E4 9.5E4 9.2E5 0.0069 3.8E4 1.5E4 0.0052 8.1E5 0.0010 Lower limit of 1.47 1.39 1.63 1.22 1.48 1.55 1.26 1.65 1.36 95% CI Upper limit of 4.06 3.63 4.35 3.48 3.91 3.95 3.78 4.47 3.37 95% CI OR Quartile 4 4.70 2.95 3.75 3.80 3.16 3.20 3.81 3.65 3.16 p Value 9.9E5 8.4E4 1.2E6 8.3E4 5.1E4 1.5E5 0.0015 2.3E4 2.3E5 Lower limit of 2.16 1.56 2.20 1.74 1.65 1.89 1.66 1.83 1.85 95% CI Upper limit of 10.2 5.55 6.39 8.30 6.06 5.41 8.70 7.27 5.37 95% CI

TABLE-US-00219 TABLE 30.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 17.2 39.4 15.8 37.8 12.9 38.2 Average 42.9 92.0 44.2 89.7 42.7 88.3 Stdev 85.0 169 87.6 167 89.9 164 p (t-test) 0.0040 0.0086 0.010 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 670 1150 670 1150 670 1150 n (Patient) 114 202 107 209 97 219 sCr only Median 17.6 40.2 16.4 40.3 14.3 41.4 Average 49.6 90.9 49.7 90.2 47.1 90.8 Stdev 119 160 120 159 122 157 p (t-test) 0.014 0.016 0.0100 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 127 189 124 192 119 197 UO only Median 20.4 54.9 20.3 51.1 20.3 49.9 Average 53.0 119 53.5 112 54.5 104 Stdev 114 192 117 185 120 176 p (t-test) 1.8E4 6.9E4 0.0033 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 213 101 203 111 189 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.63 0.68 0.63 0.63 0.67 0.64 0.65 0.65 SE 0.032 0.031 0.033 0.032 0.031 0.033 0.032 0.031 0.032 p Value 4.4E5 5.7E5 4.6E8 9.2E5 3.0E5 2.3E7 3.2E5 7.6E7 1.9E6 nCohort Recovered 114 127 213 107 124 203 97 119 189 nCohort Non- 202 189 101 209 192 111 219 197 125 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 80% 81% 86% 80% 81% 86% 80% 82% 85% Specificity 34% 34% 31% 36% 35% 31% 36% 36% 32% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 57% 58% 68% 56% 58% 67% 56% 59% 64% Specificity 62% 61% 59% 62% 62% 59% 64% 65% 59% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 32% 32% 43% 31% 32% 40% 31% 32% 38% Specificity 87% 85% 83% 86% 85% 83% 88% 87% 84% OR Quartile 2 2.11 2.18 2.73 2.26 2.30 2.67 2.25 2.53 2.59 p Value 0.0049 0.0032 0.0020 0.0023 0.0016 0.0015 0.0028 4.7E4 0.0012 Lower limit of 1.25 1.30 1.45 1.34 1.37 1.46 1.32 1.50 1.46 95% CI Upper limit of 3.54 3.65 5.15 3.81 3.86 4.90 3.81 4.26 4.62 95% CI OR Quartile 3 2.18 2.17 3.06 2.05 2.25 2.89 2.27 2.63 2.59 p Value 0.0011 9.5E4 1.2E5 0.0032 6.1E4 1.7E5 0.0011 5.9E5 6.6E5 Lower limit of 1.36 1.37 1.86 1.27 1.41 1.78 1.39 1.64 1.62 95% CI Upper limit of 3.49 3.43 5.05 3.29 3.56 4.69 3.72 4.21 4.12 95% CI OR Quartile 4 3.06 2.64 3.65 2.71 2.74 3.15 3.12 3.34 3.18 p Value 3.9E4 9.4E4 2.0E6 0.0016 7.2E4 1.9E5 8.6E4 1.3E4 1.7E5 Lower limit of 1.65 1.49 2.14 1.46 1.53 1.86 1.60 1.80 1.87 95% CI Upper limit of 5.68 4.70 6.21 5.03 4.92 5.34 6.10 6.19 5.38 95% CI

TABLE-US-00220 TABLE 30.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 17.9 40.3 16.9 38.2 15.9 39.4 Average 53.8 89.4 55.9 86.4 45.0 90.8 Stdev 124 159 128 156 91.0 168 p (t-test) 0.032 0.070 0.0073 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 670 1150 n (Patient) 134 182 125 191 114 202 sCr only Median 17.2 40.6 16.4 40.6 15.8 41.4 Average 51.7 92.3 51.8 91.8 49.7 92.7 Stdev 119 163 120 162 120 161 p (t-test) 0.014 0.016 0.0097 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 140 176 138 178 135 181 UO only Median 20.3 55.1 20.4 52.8 20.3 50.6 Average 57.4 111 58.4 104 54.5 106 Stdev 133 167 136 162 119 178 p (t-test) 0.0027 0.0082 0.0026 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 215 99 206 108 193 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.63 0.69 0.62 0.64 0.67 0.64 0.65 0.66 SE 0.031 0.031 0.033 0.031 0.031 0.033 0.031 0.031 0.032 p Value 2.9E5 1.6E5 1.0E8 9.7E5 1.1E5 3.1E7 7.4E6 8.2E7 6.9E7 nCohort Recovered 134 140 215 125 138 206 114 135 193 nCohort Non- 182 176 99 191 178 108 202 181 121 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 82% 82% 88% 82% 83% 86% 81% 83% 86% Specificity 34% 34% 31% 35% 35% 31% 36% 36% 32% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 58% 59% 70% 57% 59% 67% 57% 60% 64% Specificity 61% 61% 59% 61% 62% 59% 63% 63% 59% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 32% 32% 43% 31% 33% 41% 32% 34% 39% Specificity 85% 84% 83% 84% 85% 83% 87% 87% 83% OR Quartile 2 2.36 2.44 3.28 2.42 2.53 2.79 2.42 2.67 2.90 p Value 0.0012 8.0E4 5.0E4 8.4E4 5.0E4 0.0012 8.5E4 2.3E4 4.6E4 Lower limit of 1.40 1.45 1.68 1.44 1.50 1.50 1.44 1.58 1.60 95% CI Upper limit of 3.97 4.11 6.41 4.07 4.26 5.19 4.08 4.50 5.25 95% CI OR Quartile 3 2.20 2.30 3.32 2.06 2.31 2.85 2.31 2.52 2.62 p Value 7.0E4 3.2E4 3.6E6 0.0020 3.2E4 2.5E5 5.0E4 8.1E5 6.0E5 Lower limit of 1.39 1.46 2.00 1.30 1.46 1.75 1.44 1.59 1.64 95% CI Upper limit of 3.47 3.62 5.51 3.26 3.64 4.63 3.71 3.98 4.19 95% CI OR Quartile 4 2.73 2.57 3.82 2.35 2.69 3.36 3.06 3.30 3.20 p Value 5.1E4 8.4E4 9.2E7 0.0033 5.3E4 7.1E6 3.9E4 6.1E5 1.5E5 Lower limit of 1.55 1.48 2.24 1.33 1.54 1.98 1.65 1.84 1.89 95% CI Upper limit of 4.82 4.47 6.52 4.14 4.72 5.70 5.68 5.93 5.41 95% CI

TABLE-US-00221 TABLE 30.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 19.2 44.7 19.3 44.7 19.3 44.7 Average 58.6 97.0 59.3 95.2 59.3 95.2 Stdev 138 155 139 154 139 154 p (t-test) 0.022 0.031 0.031 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 187 129 184 132 184 132 sCr only Median 18.4 42.2 19.7 41.6 19.2 41.8 Average 52.9 96.0 53.8 94.3 53.0 94.8 Stdev 117 168 118 167 118 167 p (t-test) 0.0087 0.014 0.011 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 159 157 156 160 155 161 UO only Median 20.4 54.2 20.4 53.9 20.4 52.5 Average 58.5 106 59.0 104 59.0 102 Stdev 135 164 136 163 137 161 p (t-test) 0.0068 0.011 0.012 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 210 104 207 107 204 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.64 0.68 0.65 0.63 0.67 0.65 0.63 0.67 SE 0.032 0.031 0.033 0.032 0.031 0.033 0.032 0.031 0.033 p Value 4.0E7 1.0E5 7.1E8 2.2E6 6.0E5 2.6E7 2.2E6 2.7E5 1.6E7 nCohort Recovered 187 159 210 184 156 207 184 155 204 nCohort Non- 129 157 104 132 160 107 132 161 110 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 86% 83% 88% 85% 82% 87% 85% 82% 87% Specificity 33% 33% 31% 32% 32% 31% 32% 32% 32% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 65% 62% 68% 64% 61% 67% 64% 61% 67% Specificity 60% 62% 59% 60% 61% 59% 60% 61% 59% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 37% 35% 41% 36% 34% 40% 36% 35% 40% Specificity 83% 85% 83% 83% 85% 83% 83% 85% 83% OR Quartile 2 2.99 2.34 3.21 2.64 2.13 3.04 2.64 2.17 3.21 p Value 2.4E4 0.0017 4.4E4 7.9E4 0.0047 5.9E4 7.9E4 0.0038 3.1E4 Lower limit of 1.66 1.38 1.67 1.50 1.26 1.61 1.50 1.28 1.70 95% CI Upper limit of 5.36 3.98 6.15 4.66 3.60 5.73 4.66 3.66 6.04 95% CI OR Quartile 3 2.85 2.60 3.10 2.75 2.40 2.95 2.75 2.46 3.00 p Value 1.0E5 3.7E5 7.7E6 1.8E5 1.5E4 1.5E5 1.8E5 9.4E5 9.8E6 Lower limit of 1.79 1.65 1.89 1.73 1.53 1.81 1.73 1.57 1.84 95% CI Upper limit of 4.54 4.09 5.10 4.37 3.77 4.82 4.37 3.87 4.87 95% CI OR Quartile 4 2.98 3.03 3.41 2.82 2.88 3.19 2.82 3.06 3.22 p Value 4.6E5 6.4E5 5.9E6 1.1E4 1.4E4 1.6E5 1.1E4 6.5E5 1.4E5 Lower limit of 1.76 1.76 2.01 1.67 1.67 1.88 1.67 1.77 1.90 95% CI Upper limit of 5.04 5.23 5.79 4.76 4.96 5.41 4.76 5.30 5.45 95% CI

TABLE-US-00222 TABLE 30.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 375 245 375 364 374 Average 391 540 385 536 399 532 Stdev 281 543 298 536 310 533 p (t-test) 0.19 0.21 0.29 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1070 4690 1070 4690 1070 4690 n (Patient) 25 126 21 130 19 132 sCr only Median 330 374 287 375 304 374 Average 428 535 423 535 433 531 Stdev 402 536 408 534 422 530 p (t-test) 0.32 0.30 0.38 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 29 121 28 122 26 124 UO only Median 364 380 330 384 337 380 Average 494 528 499 519 456 563 Stdev 552 427 573 407 341 632 p (t-test) 0.69 0.81 0.19 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 1540 4690 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.58 0.54 0.59 0.59 0.55 0.58 0.59 0.54 SE 0.060 0.057 0.049 0.064 0.057 0.048 0.067 0.059 0.047 p Value 0.18 0.14 0.44 0.14 0.097 0.32 0.23 0.13 0.40 nCohort Recovered 25 29 91 21 28 84 19 26 77 nCohort Non- 126 121 59 130 122 66 132 124 73 recovered Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 76% 77% 76% 76% 77% 79% 77% 77% 77% Specificity 32% 34% 26% 33% 36% 29% 37% 38% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 52% 51% 53% 52% 52% 53% 51% 51% 52% Specificity 56% 55% 52% 57% 57% 52% 53% 54% 52% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 27% 26% 29% 26% 26% 26% 26% 26% 26% Specificity 84% 79% 77% 81% 79% 75% 79% 77% 75% OR Quartile 2 1.51 1.75 1.15 1.60 1.87 1.49 1.90 2.14 1.24 p Value 0.39 0.21 0.72 0.36 0.17 0.31 0.22 0.095 0.58 Lower limit of 0.591 0.729 0.539 0.592 0.773 0.697 0.689 0.875 0.590 95% CI Upper limit of 3.84 4.19 2.46 4.31 4.50 3.17 5.25 5.25 2.59 95% CI OR Quartile 3 1.36 1.29 1.18 1.42 1.42 1.24 1.15 1.20 1.17 p Value 0.49 0.54 0.62 0.46 0.40 0.51 0.78 0.67 0.62 Lower limit of 0.572 0.573 0.614 0.559 0.622 0.651 0.437 0.516 0.618 95% CI Upper limit of 3.22 2.92 2.28 3.59 3.26 2.37 3.00 2.81 2.23 95% CI OR Quartile 4 1.94 1.38 1.35 1.51 1.30 1.04 1.30 1.16 1.07 p Value 0.25 0.52 0.43 0.49 0.60 0.92 0.66 0.77 0.85 Lower limit of 0.621 0.515 0.640 0.473 0.485 0.496 0.404 0.428 0.514 95% CI Upper limit of 6.06 3.69 2.84 4.79 3.50 2.18 4.19 3.14 2.24 95% CI

TABLE-US-00223 TABLE 30.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 347 376 344 376 344 374 Average 454 537 458 533 471 527 Stdev 394 548 411 540 433 532 p (t-test) 0.38 0.44 0.59 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 40 111 36 115 32 119 sCr only Median 327 380 324 386 291 380 Average 434 548 431 549 436 544 Stdev 392 552 396 549 410 543 p (t-test) 0.21 0.20 0.26 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 44 107 43 108 40 111 UO only Median 350 394 332 396 337 392 Average 480 563 481 551 444 591 Stdev 530 452 548 426 329 663 p (t-test) 0.35 0.42 0.078 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 1540 4690 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.55 0.58 0.56 0.55 0.59 0.57 0.55 0.59 0.56 SE 0.052 0.050 0.050 0.054 0.050 0.049 0.056 0.051 0.048 p Value 0.35 0.097 0.23 0.32 0.073 0.13 0.37 0.073 0.24 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non- 111 107 50 115 108 57 119 111 65 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 76% 78% 78% 76% 78% 81% 76% 78% 77% Specificity 28% 32% 27% 28% 33% 29% 31% 35% 27% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 51% 52% 54% 51% 53% 56% 51% 52% 54% Specificity 52% 55% 52% 53% 56% 54% 53% 55% 53% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 27% 28% 34% 26% 28% 30% 25% 27% 29% Specificity 80% 82% 79% 78% 81% 77% 75% 80% 78% OR Quartile 2 1.18 1.61 1.31 1.20 1.69 1.71 1.48 1.95 1.24 p Value 0.69 0.23 0.51 0.68 0.19 0.19 0.37 0.098 0.58 Lower limit of 0.521 0.740 0.588 0.514 0.772 0.772 0.626 0.885 0.584 95% CI Upper limit of 2.67 3.52 2.92 2.78 3.70 3.79 3.49 4.31 2.62 95% CI OR Quartile 3 1.17 1.32 1.27 1.18 1.41 1.49 1.19 1.34 1.31 p Value 0.68 0.44 0.49 0.67 0.34 0.24 0.66 0.43 0.41 Lower limit of 0.566 0.652 0.644 0.556 0.694 0.767 0.545 0.647 0.687 95% CI Upper limit of 2.41 2.66 2.51 2.49 2.87 2.89 2.61 2.76 2.51 95% CI OR Quartile 4 1.48 1.75 1.94 1.24 1.68 1.46 1.01 1.48 1.43 p Value 0.38 0.21 0.087 0.64 0.24 0.32 0.98 0.38 0.34 Lower limit of 0.614 0.731 0.908 0.508 0.701 0.690 0.411 0.614 0.685 95% CI Upper limit of 3.57 4.20 4.13 3.01 4.04 3.08 2.49 3.57 3.00 95% CI

TABLE-US-00224 TABLE 30.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 369 374 327 380 327 376 Average 469 538 457 541 463 534 Stdev 383 565 394 555 414 543 p (t-test) 0.44 0.36 0.45 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 50 101 46 105 40 111 sCr only Median 327 380 311 392 298 394 Average 447 553 436 557 430 556 Stdev 386 568 389 563 395 556 p (t-test) 0.22 0.17 0.16 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 54 97 52 99 49 102 UO only Median 331 397 329 397 334 390 Average 474 572 477 559 493 527 Stdev 534 443 544 432 563 419 p (t-test) 0.26 0.34 0.68 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 4690 1880 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.53 0.57 0.58 0.55 0.59 0.58 0.55 0.60 0.54 SE 0.050 0.048 0.050 0.050 0.048 0.049 0.052 0.048 0.048 p Value 0.60 0.14 0.10 0.31 0.067 0.12 0.30 0.039 0.37 nCohort Recovered 50 54 98 46 52 94 40 49 86 nCohort Non- 101 97 52 105 99 56 111 102 64 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 74% 77% 79% 75% 78% 79% 77% 78% 77% Specificity 24% 30% 28% 26% 31% 28% 30% 33% 27% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 50% 53% 58% 52% 54% 59% 52% 54% 55% Specificity 50% 54% 54% 54% 56% 55% 55% 57% 53% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 27% 28% 33% 27% 28% 30% 26% 28% 28% Specificity 78% 80% 79% 78% 81% 78% 78% 82% 77% OR Quartile 2 0.911 1.44 1.42 1.07 1.56 1.40 1.40 1.76 1.19 p Value 0.82 0.35 0.39 0.86 0.25 0.40 0.41 0.14 0.65 Lower limit of 0.414 0.676 0.637 0.485 0.731 0.641 0.626 0.824 0.563 95% CI Upper limit of 2.00 3.05 3.15 2.37 3.31 3.06 3.14 3.77 2.52 95% CI OR Quartile 3 1.02 1.29 1.61 1.31 1.45 1.78 1.34 1.56 1.39 p Value 0.95 0.46 0.17 0.45 0.28 0.093 0.43 0.20 0.32 Lower limit of 0.518 0.660 0.815 0.653 0.740 0.909 0.647 0.785 0.725 95% CI Upper limit of 2.01 2.51 3.17 2.62 2.85 3.47 2.76 3.10 2.66 95% CI OR Quartile 4 1.29 1.51 1.78 1.31 1.66 1.52 1.22 1.77 1.29 p Value 0.53 0.31 0.13 0.52 0.23 0.28 0.65 0.19 0.50 Lower limit of 0.581 0.679 0.838 0.575 0.732 0.717 0.518 0.761 0.616 95% CI Upper limit of 2.88 3.35 3.79 2.98 3.75 3.20 2.86 4.10 2.71 95% CI

TABLE-US-00225 TABLE 30.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 381 371 330 378 330 375 Average 484 535 460 545 466 537 Stdev 385 578 384 569 400 555 p (t-test) 0.55 0.33 0.43 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 58 93 53 98 47 104 sCr only Median 347 376 330 378 324 386 Average 454 555 447 559 439 561 Stdev 380 581 379 579 382 573 p (t-test) 0.24 0.19 0.15 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 60 91 59 92 57 94 UO only Median 331 397 329 397 334 390 Average 481 555 477 557 491 531 Stdev 542 432 546 432 560 424 p (t-test) 0.39 0.35 0.63 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 4690 1880 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.51 0.56 0.57 0.55 0.57 0.57 0.55 0.58 0.54 SE 0.048 0.047 0.049 0.049 0.047 0.048 0.050 0.047 0.048 p Value 0.82 0.21 0.16 0.34 0.15 0.13 0.36 0.077 0.36 nCohort 58 60 96 53 59 92 47 57 86 Recovered nCohort Non- 93 91 54 98 92 58 104 94 64 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 75% 78% 78% 77% 78% 78% 77% 79% 77% Specificity 26% 30% 27% 28% 31% 27% 30% 32% 27% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 49% 52% 57% 52% 52% 59% 52% 53% 55% Specificity 48% 52% 54% 53% 53% 55% 53% 54% 53% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 25% 26% 30% 26% 27% 29% 25% 28% 28% Specificity 74% 77% 77% 75% 78% 77% 74% 79% 77% OR Quartile 2 1.06 1.52 1.30 1.29 1.58 1.29 1.41 1.71 1.19 p Value 0.88 0.27 0.51 0.51 0.23 0.51 0.38 0.16 0.65 Lower limit of 0.500 0.724 0.594 0.603 0.752 0.598 0.652 0.810 0.563 95% CI Upper limit of 2.25 3.20 2.85 2.75 3.32 2.79 3.07 3.60 2.52 95% CI OR Quartile 3 0.913 1.14 1.59 1.22 1.21 1.76 1.23 1.35 1.39 p Value 0.79 0.69 0.17 0.57 0.57 0.095 0.56 0.37 0.32 Lower limit of 0.474 0.595 0.813 0.622 0.628 0.906 0.616 0.700 0.725 95% CI Upper limit of 1.76 2.19 3.12 2.37 2.32 3.43 2.45 2.62 2.66 95% CI OR Quartile 4 0.942 1.18 1.42 1.05 1.32 1.40 0.972 1.43 1.29 p Value 0.88 0.67 0.37 0.89 0.48 0.37 0.94 0.37 0.50 Lower limit of 0.443 0.551 0.667 0.486 0.612 0.665 0.440 0.657 0.616 95% CI Upper limit of 2.00 2.51 3.01 2.28 2.85 2.96 2.15 3.13 2.71 95% CI

TABLE-US-00226 TABLE 30.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 364 386 348 392 348 392 Average 529 499 520 510 520 510 Stdev 611 368 610 376 610 376 p (t-test) 0.72 0.90 0.90 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1540 4690 1540 4690 1540 n (Patient) 81 70 80 71 80 71 sCr only Median 364 378 364 378 364 378 Average 456 563 455 561 455 561 Stdev 375 597 374 593 374 593 p (t-test) 0.20 0.21 0.21 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 67 84 65 86 65 86 UO only Median 328 428 328 428 328 428 Average 479 558 475 561 475 558 Stdev 555 405 553 413 559 408 p (t-test) 0.36 0.31 0.33 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 4690 1880 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.53 0.56 0.59 0.54 0.56 0.59 0.54 0.56 0.59 SE 0.047 0.047 0.049 0.047 0.047 0.048 0.047 0.047 0.048 p Value 0.59 0.20 0.059 0.43 0.21 0.062 0.43 0.21 0.058 nCohort 81 67 95 80 65 93 80 65 91 Recovered nCohort Non- 70 84 55 71 86 57 71 86 59 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 76% 79% 80% 76% 78% 79% 76% 78% 80% Specificity 26% 30% 28% 26% 29% 28% 26% 29% 29% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 53% 52% 60% 54% 52% 60% 54% 52% 59% Specificity 52% 52% 56% 52% 52% 56% 52% 52% 56% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 26% 27% 31% 27% 28% 32% 27% 28% 32% Specificity 75% 78% 78% 76% 78% 78% 76% 78% 79% OR Quartile 2 1.09 1.56 1.59 1.13 1.46 1.46 1.13 1.46 1.57 p Value 0.82 0.24 0.26 0.74 0.32 0.35 0.74 0.32 0.26 Lower limit of 0.521 0.746 0.716 0.540 0.696 0.666 0.540 0.696 0.718 95% CI Upper limit of 2.28 3.27 3.52 2.37 3.05 3.18 2.37 3.05 3.42 95% CI OR Quartile 3 1.21 1.20 1.89 1.27 1.20 1.87 1.27 1.20 1.86 p Value 0.56 0.57 0.064 0.46 0.57 0.066 0.46 0.57 0.067 Lower limit of 0.636 0.633 0.964 0.671 0.632 0.960 0.671 0.632 0.957 95% CI Upper limit of 2.29 2.29 3.72 2.41 2.29 3.66 2.41 2.29 3.61 95% CI OR Quartile 4 1.06 1.31 1.58 1.17 1.41 1.68 1.17 1.41 1.80 p Value 0.89 0.48 0.23 0.67 0.37 0.17 0.67 0.37 0.12 Lower limit of 0.506 0.618 0.745 0.562 0.662 0.799 0.562 0.662 0.855 95% CI Upper limit of 2.20 2.76 3.34 2.45 3.00 3.55 2.45 3.00 3.79 95% CI

Example 31. Use of CC Motif Chemokine 24 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0211] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 24 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0212] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0213] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00227 TABLE 31.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 12.9 40.4 12.2 40.4 12.5 39.7 Average 40.8 91.5 39.2 91.3 40.0 90.2 Stdev 87.7 166 88.2 165 89.4 164 p (t-test) 0.0035 0.0029 0.0044 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 670 1150 670 1150 670 1150 n (Patient) 107 209 103 213 100 216 sCr only Median 15.8 39.8 14.5 40.3 14.5 40.4 Average 51.4 88.2 51.4 87.7 51.2 87.7 Stdev 125 157 126 156 127 156 p (t-test) 0.029 0.031 0.031 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 125 190 123 192 122 193 UO only Median 20.4 51.1 18.4 51.1 18.4 50.6 Average 54.7 121 51.1 119 52.0 112 Stdev 117 193 117 184 120 178 p (t-test) 2.5E4 9.3E5 4.7E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 221 93 207 107 197 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.63 0.68 0.66 0.64 0.71 0.66 0.64 0.69 SE 0.031 0.031 0.034 0.031 0.031 0.032 0.031 0.031 0.032 p Value 1.5E6 2.5E5 9.7E8 1.7E7 1.3E5 8.3E11 4.8E7 7.2E6 1.3E9 nCohort 107 125 221 103 123 207 100 122 197 Recovered nCohort Non- 209 190 93 213 192 107 216 193 117 recovered Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 80% 81% 88% 81% 81% 90% 81% 81% 88% Specificity 36% 34% 31% 37% 35% 33% 37% 35% 33% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 59% 59% 69% 59% 60% 71% 58% 60% 68% Specificity 67% 64% 58% 69% 65% 61% 68% 66% 61% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 32% 32% 43% 32% 32% 43% 31% 32% 40% Specificity 88% 86% 82% 89% 85% 84% 89% 86% 84% OR Quartile 2 2.26 2.24 3.31 2.45 2.33 4.27 2.43 2.37 3.62 p Value 0.0023 0.0022 6.8E4 8.2E4 0.0014 3.6E5 9.6E4 0.0011 6.6E5 Lower limit of 1.34 1.34 1.66 1.45 1.39 2.15 1.44 1.41 1.92 95% CI Upper limit of 3.81 3.76 6.61 4.15 3.91 8.50 4.12 3.99 6.82 95% CI OR Quartile 3 2.94 2.61 3.04 3.21 2.78 3.81 2.98 2.87 3.37 p Value 1.5E5 5.5E5 2.2E5 4.5E6 2.0E5 1.8E7 1.9E5 1.2E5 8.4E7 Lower limit of 1.80 1.64 1.82 1.95 1.74 2.31 1.80 1.79 2.08 95% CI Upper limit of 4.80 4.16 5.08 5.29 4.44 6.30 4.90 4.60 5.46 95% CI OR Quartile 4 3.34 2.81 3.52 3.92 2.72 3.98 3.72 2.92 3.46 p Value 2.7E4 5.3E4 4.3E6 1.0E4 8.2E4 4.0E7 1.9E4 4.1E4 4.2E6 Lower limit of 1.74 1.57 2.06 1.97 1.51 2.33 1.87 1.61 2.04 95% CI Upper limit of 6.39 5.04 6.02 7.81 4.88 6.78 7.40 5.30 5.88 95% CI

TABLE-US-00228 TABLE 31.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.9 43.2 14.5 43.2 14.5 42.2 Average 38.1 101 37.6 101 37.1 100.0 Stdev 73.1 178 73.5 177 73.5 176 p (t-test) 1.3E4 1.3E4 1.5E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 670 1150 670 1150 670 1150 n (Patient) 135 181 133 183 129 187 sCr only Median 17.9 42.7 17.6 42.2 17.2 42.7 Average 46.2 99.1 46.2 98.8 46.0 98.6 Stdev 111 168 111 168 112 167 p (t-test) 0.0012 0.0014 0.0014 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 148 168 147 169 146 170 UO only Median 20.4 69.8 19.9 69.8 19.7 55.0 Average 53.3 127 51.1 127 51.6 117 Stdev 117 195 115 192 118 183 p (t-test) 4.9E5 1.9E5 1.5E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 225 89 219 95 206 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.65 0.70 0.67 0.65 0.71 0.67 0.66 0.69 SE 0.030 0.030 0.034 0.030 0.030 0.033 0.030 0.030 0.032 p Value 1.2E7 4.5E7 2.9E9 3.9E8 3.6E7 1.4E10 3.7E8 1.8E7 2.7E9 nCohort 135 148 225 133 147 219 129 146 206 Recovered nCohort Non- 181 168 89 183 169 95 187 170 108 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 82% 83% 89% 82% 83% 89% 82% 83% 87% Specificity 34% 34% 31% 35% 34% 32% 35% 34% 32% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 61% 61% 72% 61% 62% 73% 60% 62% 69% Specificity 64% 63% 59% 65% 63% 60% 65% 64% 60% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 34% 35% 47% 34% 34% 47% 34% 35% 44% Specificity 87% 86% 84% 88% 86% 84% 88% 86% 84% OR Quartile 2 2.32 2.45 3.49 2.40 2.49 3.91 2.41 2.53 3.10 p Value 0.0015 8.5E4 6.2E4 9.3E4 6.8E4 1.8E4 8.9E4 5.3E4 4.8E4 Lower limit of 1.38 1.45 1.71 1.43 1.47 1.91 1.43 1.50 1.64 95% CI Upper limit of 3.89 4.14 7.15 4.04 4.21 7.99 4.05 4.28 5.83 95% CI OR Quartile 3 2.81 2.68 3.63 2.98 2.76 3.95 2.85 2.83 3.44 p Value 1.2E5 2.2E5 2.1E6 4.0E6 1.4E5 3.0E7 1.0E5 8.1E6 1.0E6 Lower limit of 1.77 1.70 2.13 1.87 1.75 2.34 1.79 1.79 2.09 95% CI Upper limit of 4.46 4.23 6.19 4.75 4.35 6.68 4.54 4.48 5.64 95% CI OR Quartile 4 3.62 3.19 4.54 3.84 3.14 4.90 3.95 3.35 4.19 p Value 2.2E5 5.0E5 5.4E8 1.3E5 6.5E5 1.0E8 1.3E5 3.0E5 1.6E7 Lower limit of 2.00 1.82 2.63 2.10 1.79 2.84 2.13 1.90 2.45 95% CI Upper limit of 6.55 5.59 7.83 7.03 5.49 8.44 7.33 5.91 7.16 95% CI

TABLE-US-00229 TABLE 31.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.9 44.6 16.9 44.6 15.9 44.6 Average 49.3 97.8 49.6 96.9 49.2 96.2 Stdev 117 166 118 166 119 164 p (t-test) 0.0031 0.0040 0.0042 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 153 163 151 165 147 169 sCr only Median 17.2 44.7 16.9 44.6 16.4 44.7 Average 47.8 102 47.8 101 47.6 101 Stdev 112 171 112 170 113 170 p (t-test) 0.0010 0.0011 0.0011 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 160 156 159 157 158 158 UO only Median 23.0 58.3 22.9 56.7 21.0 54.5 Average 59.8 110 59.8 109 60.6 102 Stdev 137 163 138 162 141 155 p (t-test) 0.0062 0.0068 0.019 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 223 91 222 92 211 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.67 0.68 0.66 0.67 0.68 0.67 0.67 0.66 SE 0.030 0.030 0.035 0.030 0.030 0.035 0.030 0.030 0.034 p Value 8.2E8 3.1E8 4.0E7 1.1E7 2.5E8 3.1E7 3.3E8 1.2E8 1.1E6 nCohort 153 160 223 151 159 222 147 158 211 Recovered nCohort Non- 163 156 91 165 157 92 169 158 103 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 83% 84% 86% 83% 84% 86% 83% 84% 85% Specificity 33% 34% 30% 34% 34% 30% 35% 34% 30% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 63% 63% 68% 62% 64% 68% 62% 64% 67% Specificity 63% 63% 57% 64% 64% 58% 64% 64% 58% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 36% 36% 45% 35% 36% 45% 35% 36% 42% Specificity 86% 86% 83% 86% 86% 83% 86% 86% 83% OR Quartile 2 2.41 2.67 2.52 2.50 2.72 2.57 2.68 2.76 2.55 p Value 0.0011 3.6E4 0.0055 6.9E4 2.8E4 0.0046 2.7E4 2.2E4 0.0031 Lower limit of 1.42 1.56 1.31 1.47 1.58 1.34 1.58 1.61 1.37 95% CI Upper limit of 4.09 4.58 4.85 4.23 4.65 4.94 4.54 4.74 4.75 95% CI OR Quartile 3 2.90 2.97 2.88 2.90 3.06 2.96 2.91 3.14 2.84 p Value 5.1E6 3.0E6 5.6E5 5.0E6 1.8E6 3.6E5 4.9E6 1.0E6 3.5E5 Lower limit of 1.83 1.88 1.72 1.84 1.93 1.77 1.84 1.98 1.73 95% CI Upper limit of 4.57 4.70 4.82 4.58 4.83 4.95 4.60 4.97 4.65 95% CI OR Quartile 4 3.47 3.34 3.99 3.36 3.28 3.89 3.41 3.49 3.48 p Value 1.4E5 1.7E5 5.2E7 2.3E5 2.3E5 7.9E7 2.3E5 1.0E5 4.1E6 Lower limit of 1.98 1.93 2.32 1.91 1.89 2.27 1.93 2.00 2.05 95% CI Upper limit of 6.09 5.78 6.86 5.88 5.68 6.68 6.01 6.08 5.93 95% CI

TABLE-US-00230 TABLE 31.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.5 49.9 16.7 48.2 16.2 48.2 Average 53.9 97.2 54.5 95.6 54.2 94.9 Stdev 127 163 128 161 129 160 p (t-test) 0.0083 0.012 0.013 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 167 149 164 152 160 156 sCr only Median 16.9 49.9 16.7 49.5 16.5 49.9 Average 52.1 100 52.2 100 52.0 99.9 Stdev 123 167 123 166 124 166 p (t-test) 0.0033 0.0036 0.0036 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 171 145 170 146 169 147 UO only Median 20.7 64.0 21.0 58.3 21.0 54.7 Average 59.5 110 59.8 108 60.5 103 Stdev 138 161 138 161 140 156 p (t-test) 0.0057 0.0072 0.016 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 222 92 221 93 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.67 0.69 0.67 0.68 0.69 0.67 0.68 0.67 SE 0.030 0.030 0.034 0.030 0.030 0.034 0.030 0.030 0.034 p Value 8.1E9 1.0E8 1.3E8 3.3E8 8.2E9 4.6E8 1.1E8 3.8E9 5.5E7 nCohort 167 171 222 164 170 221 160 169 213 Recovered nCohort Non- 149 145 92 152 146 93 156 147 101 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 84% 84% 88% 84% 84% 87% 84% 84% 86% Specificity 33% 33% 31% 33% 33% 30% 34% 33% 31% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 66% 66% 71% 65% 66% 70% 65% 66% 67% Specificity 64% 63% 59% 64% 64% 58% 64% 64% 58% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 37% 37% 46% 36% 37% 45% 36% 37% 43% Specificity 86% 85% 83% 85% 85% 83% 86% 86% 83% OR Quartile 2 2.56 2.58 3.25 2.49 2.63 2.94 2.67 2.67 2.73 p Value 7.0E4 6.9E4 8.3E4 8.8E4 5.5E4 0.0016 3.6E4 4.4E4 0.0020 Lower limit of 1.49 1.49 1.63 1.46 1.52 1.50 1.56 1.54 1.45 95% CI Upper limit of 4.40 4.47 6.49 4.27 4.55 5.74 4.58 4.62 5.15 95% CI OR Quartile 3 3.43 3.26 3.40 3.32 3.34 3.26 3.32 3.43 2.87 p Value 1.9E7 5.6E7 4.3E6 3.4E7 3.2E7 7.8E6 3.4E7 1.8E7 3.2E5 Lower limit of 2.16 2.05 2.02 2.10 2.10 1.94 2.09 2.16 1.75 95% CI Upper limit of 5.45 5.17 5.73 5.27 5.31 5.46 5.26 5.46 4.72 95% CI OR Quartile 4 3.49 3.47 4.20 3.31 3.40 4.10 3.34 3.61 3.65 p Value 7.2E6 6.9E6 2.0E7 1.7E5 9.2E6 3.1E7 1.7E5 4.0E6 2.0E6 Lower limit of 2.02 2.02 2.44 1.92 1.98 2.39 1.93 2.09 2.14 95% CI Upper limit of 6.02 5.96 7.22 5.70 5.85 7.03 5.78 6.24 6.21 95% CI

TABLE-US-00231 TABLE 31.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 19.7 49.9 20.1 48.2 19.9 49.2 Average 60.2 99.3 60.8 97.7 60.8 97.3 Stdev 141 153 141 152 142 152 p (t-test) 0.022 0.030 0.032 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 202 114 200 116 199 117 sCr only Median 18.8 46.0 18.8 46.0 18.8 46.0 Average 53.6 103 53.6 103 53.6 103 Stdev 120 173 120 173 120 173 p (t-test) 0.0028 0.0028 0.0028 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 184 132 184 132 184 132 UO only Median 21.9 54.2 22.7 53.9 22.7 53.9 Average 61.1 103 61.4 102 61.7 101 Stdev 140 158 140 157 141 156 p (t-test) 0.019 0.023 0.028 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 216 98 215 99 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.66 0.67 0.66 0.66 0.67 0.66 0.66 0.67 SE 0.032 0.031 0.034 0.033 0.031 0.034 0.032 0.031 0.034 p Value 1.7E7 4.6E7 3.0E7 8.0E7 4.6E7 8.5E7 5.6E7 4.6E7 1.0E6 nCohort 202 184 216 200 184 215 199 184 213 Recovered nCohort Non- 114 132 98 116 132 99 117 132 101 recovered Cutoff Quartile 2 4.17 4.17 4.13 4.17 4.17 4.13 4.17 4.17 4.13 Sensitivity 87% 84% 88% 86% 84% 87% 86% 84% 87% Specificity 32% 32% 31% 32% 32% 31% 32% 32% 31% Cutoff Quartile 3 29.6 29.6 28.8 29.6 29.6 28.8 29.6 29.6 28.8 Sensitivity 68% 65% 68% 66% 65% 68% 67% 65% 67% Specificity 60% 61% 58% 60% 61% 58% 60% 61% 58% Cutoff Quartile 4 74.9 74.9 74.6 74.9 74.9 74.6 74.9 74.9 74.6 Sensitivity 39% 39% 42% 39% 39% 41% 38% 39% 41% Specificity 83% 85% 82% 83% 85% 82% 83% 85% 82% OR Quartile 2 3.06 2.43 3.22 2.87 2.43 2.93 2.92 2.43 3.04 p Value 3.9E4 0.0019 6.1E4 6.4E4 0.0019 0.0012 5.2E4 0.0019 8.1E4 Lower limit of 1.65 1.39 1.65 1.57 1.39 1.53 1.60 1.39 1.59 95% CI Upper limit of 5.68 4.26 6.29 5.27 4.26 5.62 5.36 4.26 5.83 95% CI OR Quartile 3 3.11 2.91 3.03 2.90 2.91 2.91 2.98 2.91 2.87 p Value 4.1E6 6.7E6 1.7E5 1.2E5 6.7E6 2.9E5 7.7E6 6.7E6 3.2E5 Lower limit of 1.92 1.83 1.83 1.80 1.83 1.76 1.85 1.83 1.75 95% CI Upper limit of 5.04 4.63 5.01 4.68 4.63 4.80 4.80 4.63 4.72 95% CI OR Quartile 4 3.22 3.51 3.37 3.09 3.51 3.29 3.03 3.51 3.15 p Value 1.3E5 4.0E6 7.8E6 2.5E5 4.0E6 1.1E5 3.4E5 4.0E6 2.2E5 Lower limit of 1.90 2.06 1.98 1.83 2.06 1.93 1.80 2.06 1.85 95% CI Upper limit of 5.45 5.98 5.74 5.23 5.98 5.60 5.12 5.98 5.35 95% CI

TABLE-US-00232 TABLE 31.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 386 344 380 368 376 Average 417 562 419 560 429 553 Stdev 315 579 318 576 321 573 p (t-test) 0.10 0.11 0.17 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1640 4690 1640 4690 1640 4690 n (Patient) 49 102 48 103 46 105 sCr only Median 327 386 327 386 330 380 Average 437 555 437 555 441 552 Stdev 379 569 379 569 382 567 p (t-test) 0.18 0.18 0.21 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 52 98 52 98 51 99 UO only Median 368 384 371 376 364 392 Average 505 514 485 549 487 540 Stdev 546 404 538 440 550 428 p (t-test) 0.92 0.47 0.53 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1880 4690 1880 4690 1880 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.57 0.53 0.57 0.57 0.56 0.55 0.57 0.56 SE 0.049 0.048 0.052 0.049 0.048 0.050 0.050 0.049 0.048 p Value 0.15 0.13 0.54 0.16 0.13 0.25 0.29 0.16 0.25 nCohort 49 52 104 48 52 97 46 51 91 Recovered nCohort Non- 102 98 46 103 98 53 105 99 59 recovered Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 75% 77% 78% 76% 77% 79% 75% 77% 78% Specificity 27% 29% 27% 27% 29% 28% 26% 29% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 53% 53% 52% 52% 53% 51% 51% 53% 53% Specificity 55% 56% 51% 54% 56% 51% 52% 55% 52% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 29% 29% 30% 29% 29% 32% 29% 28% 31% Specificity 84% 81% 77% 83% 81% 78% 83% 80% 78% OR Quartile 2 1.11 1.32 1.33 1.16 1.32 1.47 1.07 1.38 1.34 p Value 0.79 0.47 0.50 0.71 0.47 0.34 0.86 0.41 0.46 Lower limit of 0.511 0.618 0.582 0.531 0.618 0.663 0.485 0.643 0.621 95% CI Upper limit of 2.42 2.83 3.02 2.53 2.83 3.27 2.37 2.95 2.89 95% CI OR Quartile 3 1.38 1.43 1.13 1.30 1.43 1.06 1.16 1.35 1.18 p Value 0.36 0.30 0.72 0.45 0.30 0.86 0.68 0.39 0.62 Lower limit of 0.697 0.725 0.566 0.655 0.725 0.543 0.577 0.684 0.614 95% CI Upper limit of 2.74 2.80 2.27 2.59 2.80 2.07 2.31 2.65 2.28 95% CI OR Quartile 4 2.14 1.68 1.46 2.05 1.68 1.71 1.90 1.62 1.56 p Value 0.087 0.21 0.34 0.10 0.21 0.16 0.15 0.25 0.24 Lower limit of 0.895 0.742 0.671 0.861 0.742 0.805 0.794 0.714 0.741 95% CI Upper limit of 5.09 3.80 3.17 4.90 3.80 3.63 4.54 3.66 3.28 95% CI

TABLE-US-00233 TABLE 31.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 331 392 331 392 348 380 Average 453 561 453 561 461 553 Stdev 367 594 367 594 369 590 p (t-test) 0.20 0.20 0.28 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 64 87 64 87 62 89 sCr only Median 330 394 330 394 331 392 Average 446 570 446 570 449 566 Stdev 368 599 368 599 370 596 p (t-test) 0.14 0.14 0.16 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 67 84 67 84 66 85 UO only Median 337 396 337 396 337 396 Average 493 543 487 554 496 529 Stdev 544 404 542 413 557 403 p (t-test) 0.58 0.45 0.70 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1700 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.55 0.57 0.56 0.55 0.57 0.57 0.53 0.56 0.55 SE 0.047 0.047 0.052 0.047 0.047 0.051 0.048 0.047 0.049 p Value 0.29 0.15 0.23 0.29 0.15 0.16 0.46 0.18 0.34 nCohort 64 67 105 64 67 103 62 66 95 Recovered nCohort Non- 87 84 45 87 84 47 89 85 55 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 75% 76% 80% 75% 76% 81% 74% 76% 76% Specificity 25% 27% 28% 25% 27% 28% 24% 27% 26% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 54% 55% 56% 54% 55% 55% 53% 54% 55% Specificity 55% 55% 52% 55% 55% 52% 53% 55% 53% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 29% 30% 33% 29% 30% 34% 28% 29% 31% Specificity 80% 81% 78% 80% 81% 79% 79% 80% 78% OR Quartile 2 0.985 1.18 1.53 0.985 1.18 1.65 0.916 1.22 1.15 p Value 0.97 0.67 0.33 0.97 0.67 0.24 0.82 0.60 0.72 Lower limit of 0.468 0.562 0.655 0.468 0.562 0.711 0.432 0.583 0.533 95% CI Upper limit of 2.07 2.46 3.56 2.07 2.46 3.85 1.94 2.55 2.50 95% CI OR Quartile 3 1.42 1.49 1.38 1.42 1.49 1.36 1.27 1.42 1.33 p Value 0.29 0.22 0.37 0.29 0.22 0.38 0.47 0.29 0.40 Lower limit of 0.742 0.783 0.682 0.742 0.783 0.682 0.665 0.742 0.685 95% CI Upper limit of 2.71 2.85 2.77 2.71 2.85 2.73 2.44 2.70 2.60 95% CI OR Quartile 4 1.58 1.76 1.78 1.58 1.76 1.90 1.47 1.70 1.58 p Value 0.24 0.15 0.14 0.24 0.15 0.10 0.32 0.17 0.23 Lower limit of 0.736 0.819 0.823 0.736 0.819 0.884 0.684 0.790 0.745 95% CI Upper limit of 3.40 3.78 3.86 3.40 3.78 4.09 3.17 3.65 3.34 95% CI

TABLE-US-00234 TABLE 31.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 332 386 348 380 348 380 Average 461 566 467 559 460 563 Stdev 373 612 372 611 363 610 p (t-test) 0.21 0.27 0.22 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 73 78 72 79 70 81 sCr only Median 331 392 331 392 331 392 Average 448 580 448 580 448 580 Stdev 366 616 366 616 366 616 p (t-test) 0.11 0.11 0.11 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 74 77 74 77 74 77 UO only Median 332 396 330 397 334 394 Average 500 526 487 554 496 528 Stdev 550 385 546 401 555 405 p (t-test) 0.78 0.45 0.71 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1700 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.55 0.57 0.56 0.54 0.57 0.58 0.54 0.57 0.54 SE 0.047 0.047 0.052 0.047 0.047 0.051 0.047 0.047 0.049 p Value 0.29 0.13 0.28 0.42 0.13 0.11 0.41 0.13 0.37 nCohort 73 74 105 72 74 103 70 74 96 Recovered nCohort Non- 78 77 45 79 77 47 81 77 54 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 77% 78% 80% 76% 78% 81% 75% 78% 76% Specificity 27% 28% 28% 26% 28% 28% 26% 28% 26% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 54% 55% 58% 53% 55% 60% 53% 55% 56% Specificity 53% 54% 53% 53% 54% 54% 53% 54% 53% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 27% 29% 29% 27% 29% 32% 27% 29% 30% Specificity 77% 78% 76% 76% 78% 78% 77% 78% 77% OR Quartile 2 1.26 1.40 1.53 1.13 1.40 1.65 1.06 1.40 1.11 p Value 0.54 0.37 0.33 0.74 0.37 0.24 0.89 0.37 0.79 Lower limit of 0.602 0.668 0.655 0.543 0.668 0.711 0.506 0.668 0.513 95% CI Upper limit of 2.63 2.93 3.56 2.36 2.93 3.85 2.20 2.93 2.40 95% CI OR Quartile 3 1.34 1.41 1.56 1.27 1.41 1.76 1.27 1.41 1.42 p Value 0.37 0.29 0.21 0.47 0.29 0.11 0.47 0.29 0.31 Lower limit of 0.706 0.744 0.773 0.669 0.744 0.872 0.668 0.744 0.725 95% CI Upper limit of 2.54 2.68 3.16 2.41 2.68 3.54 2.41 2.68 2.77 95% CI OR Quartile 4 1.21 1.45 1.30 1.17 1.45 1.63 1.26 1.45 1.42 p Value 0.61 0.33 0.51 0.67 0.33 0.21 0.54 0.33 0.37 Lower limit of 0.580 0.690 0.593 0.560 0.690 0.756 0.599 0.690 0.667 95% CI Upper limit of 2.54 3.05 2.85 2.45 3.05 3.52 2.64 3.05 3.01 95% CI

TABLE-US-00235 TABLE 31.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 348 392 364 386 364 386 Average 456 575 461 568 455 571 Stdev 368 621 368 620 359 619 p (t-test) 0.15 0.20 0.16 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 76 75 75 76 73 78 sCr only Median 330 397 330 397 330 397 Average 439 594 439 594 439 594 Stdev 363 623 363 623 363 623 p (t-test) 0.063 0.063 0.063 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 77 74 77 74 77 74 UO only Median 329 412 329 412 332 396 Average 487 550 487 550 493 532 Stdev 551 398 551 398 555 407 p (t-test) 0.47 0.47 0.65 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1700 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.59 0.58 0.55 0.59 0.58 0.55 0.59 0.55 SE 0.047 0.046 0.050 0.047 0.046 0.050 0.047 0.046 0.049 p Value 0.22 0.052 0.11 0.33 0.052 0.11 0.32 0.052 0.31 nCohort Recovered 76 77 100 75 77 100 73 77 95 nCohort Non- 75 74 50 76 74 50 78 74 55 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 77% 80% 80% 76% 80% 80% 76% 80% 76% Specificity 28% 30% 28% 27% 30% 28% 26% 30% 26% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 53% 55% 60% 53% 55% 60% 53% 55% 56% Specificity 53% 55% 55% 52% 55% 55% 52% 55% 54% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 28% 30% 30% 28% 30% 30% 28% 30% 29% Specificity 78% 79% 77% 77% 79% 77% 78% 79% 77% OR Quartile 2 1.30 1.68 1.56 1.17 1.68 1.56 1.09 1.68 1.15 p Value 0.48 0.18 0.29 0.67 0.18 0.29 0.81 0.18 0.72 Lower limit of 0.623 0.793 0.686 0.561 0.793 0.686 0.524 0.793 0.533 95% CI Upper limit of 2.73 3.54 3.53 2.45 3.54 3.53 2.28 3.54 2.50 95% CI OR Quartile 3 1.27 1.49 1.83 1.20 1.49 1.83 1.20 1.49 1.50 p Value 0.46 0.22 0.085 0.57 0.22 0.085 0.57 0.22 0.24 Lower limit of 0.670 0.785 0.920 0.636 0.785 0.920 0.635 0.785 0.767 95% CI Upper limit of 2.41 2.83 3.65 2.28 2.83 3.65 2.28 2.83 2.92 95% CI OR Quartile 4 1.35 1.61 1.43 1.30 1.61 1.43 1.40 1.61 1.36 p Value 0.43 0.21 0.35 0.48 0.21 0.35 0.37 0.21 0.42 Lower limit of 0.645 0.768 0.669 0.623 0.768 0.669 0.666 0.768 0.642 95% CI Upper limit of 2.82 3.39 3.08 2.73 3.39 3.08 2.94 3.39 2.89 95% CI

TABLE-US-00236 TABLE 31.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 332 397 334 396 332 397 Average 509 525 514 518 505 529 Stdev 590 377 591 378 589 386 p (t-test) 0.85 0.96 0.78 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1540 4690 1540 4690 1540 n (Patient) 89 62 88 63 87 64 sCr only Median 332 397 332 397 332 397 Average 451 586 451 586 451 586 Stdev 373 625 373 625 373 625 p (t-test) 0.11 0.11 0.11 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 79 72 79 72 79 72 UO only Median 326 448 326 448 326 448 Average 489 544 489 544 485 548 Stdev 565 368 565 368 564 379 p (t-test) 0.53 0.53 0.47 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1510 4690 1510 4690 1510 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.58 0.59 0.55 0.58 0.59 0.56 0.58 0.59 SE 0.048 0.047 0.050 0.048 0.047 0.050 0.048 0.047 0.049 p Value 0.22 0.096 0.068 0.34 0.096 0.068 0.23 0.096 0.072 nCohort Recovered 89 79 98 88 79 98 87 79 96 nCohort Non- 62 72 52 63 72 52 64 72 54 recovered Cutoff Quartile 2 218 218 217 218 218 217 218 218 217 Sensitivity 77% 79% 81% 76% 79% 81% 77% 79% 80% Specificity 27% 29% 29% 26% 29% 29% 26% 29% 28% Cutoff Quartile 3 373 373 372 373 373 372 373 373 372 Sensitivity 56% 56% 62% 56% 56% 62% 56% 56% 61% Specificity 54% 54% 56% 53% 54% 56% 54% 54% 56% Cutoff Quartile 4 674 674 661 674 674 661 674 674 661 Sensitivity 27% 29% 31% 27% 29% 31% 28% 29% 31% Specificity 76% 78% 78% 76% 78% 78% 77% 78% 78% OR Quartile 2 1.27 1.56 1.68 1.13 1.56 1.68 1.17 1.56 1.53 p Value 0.54 0.24 0.21 0.75 0.24 0.21 0.67 0.24 0.30 Lower limit of 0.594 0.739 0.742 0.535 0.739 0.742 0.555 0.739 0.689 95% CI Upper limit of 2.70 3.30 3.80 2.40 3.30 3.80 2.48 3.30 3.40 95% CI OR Quartile 3 1.52 1.49 2.05 1.43 1.49 2.05 1.51 1.49 2.02 p Value 0.21 0.22 0.041 0.28 0.22 0.041 0.21 0.22 0.043 Lower limit of 0.790 0.786 1.03 0.748 0.786 1.03 0.789 0.786 1.02 95% CI Upper limit of 2.91 2.84 4.07 2.74 2.84 4.07 2.89 2.84 3.99 95% CI OR Quartile 4 1.22 1.50 1.54 1.18 1.50 1.54 1.31 1.50 1.64 p Value 0.59 0.28 0.27 0.66 0.28 0.27 0.47 0.28 0.20 Lower limit of 0.582 0.717 0.721 0.562 0.717 0.721 0.626 0.717 0.774 95% CI Upper limit of 2.57 3.14 3.27 2.47 3.14 3.27 2.75 3.14 3.48 95% CI

Example 32. Use of CC Motif Chemokine 24 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0214] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 24 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0215] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0216] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00237 TABLE 32.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 19.2 54.8 19.9 72.5 23.1 73.8 Average 53.8 112 53.2 123 61.3 112 Stdev 120 180 116 191 136 168 p (t-test) 7.2E4 8.7E5 0.0070 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1140 1150 n (Patient) 204 112 220 96 235 81 sCr only Median 19.4 50.8 20.7 54.5 23.1 54.5 Average 58.7 102 59.1 108 66.1 95.1 Stdev 140 153 137 162 153 121 p (t-test) 0.012 0.0062 0.12 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1150 1140 1150 1140 1150 679 n (Patient) 207 108 222 93 234 81 UO only Median 25.9 97.0 26.1 105 25.9 109 Average 66.2 129 66.0 135 65.9 138 Stdev 138 191 137 197 137 199 p (t-test) 0.011 0.0069 0.0050 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 274 40 277 37 278 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.68 0.72 0.72 0.69 0.73 0.69 0.68 0.74 SE 0.032 0.033 0.048 0.033 0.034 0.049 0.036 0.036 0.049 p Value 3.1E9 4.3E8 5.3E6 4.3E11 1.9E8 2.8E6 7.3E8 1.1E6 1.2E6 nCohort Non- 204 207 274 220 222 277 235 234 278 persistent nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 86% 86% 92% 90% 89% 95% 89% 89% 94% Specificity 31% 31% 28% 31% 31% 28% 30% 30% 28% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 68% 67% 75% 71% 69% 76% 69% 68% 78% Specificity 60% 58% 54% 59% 58% 53% 57% 56% 54% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 43% 43% 57% 47% 44% 59% 47% 44% 61% Specificity 85% 84% 80% 85% 83% 79% 83% 82% 79% OR Quartile 2 2.68 2.77 4.73 3.93 3.74 6.74 3.39 3.41 6.51 p Value 0.0014 0.0013 0.012 1.7E4 3.0E4 0.0099 0.0013 0.0013 0.011 Lower limit of 1.46 1.49 1.42 1.92 1.83 1.58 1.61 1.62 1.53 95% CI Upper limit of 4.92 5.16 15.8 8.03 7.65 28.7 7.17 7.21 27.8 95% CI OR Quartile 3 3.14 2.81 3.47 3.51 3.01 3.57 2.92 2.69 4.04 p Value 3.8E6 3.0E5 0.0012 1.8E6 2.6E5 0.0015 9.3E5 2.7E4 8.5E4 Lower limit of 1.93 1.73 1.63 2.09 1.80 1.62 1.71 1.58 1.78 95% CI Upper limit of 5.10 4.58 7.38 5.88 5.02 7.84 5.00 4.59 9.18 95% CI OR Quartile 4 4.19 3.91 5.27 4.83 3.82 5.66 4.18 3.55 6.09 p Value 1.6E7 5.2E7 2.6E6 1.3E8 1.1E6 2.2E6 3.7E7 6.0E6 1.2E6 Lower limit of 2.45 2.30 2.64 2.81 2.23 2.76 2.41 2.05 2.93 95% CI Upper limit of 7.15 6.67 10.5 8.30 6.54 11.6 7.26 6.15 12.7 95% CI

TABLE-US-00238 TABLE 32.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 16.9 54.6 18.0 63.7 20.4 59.3 Average 52.1 106 51.2 116 59.6 107 Stdev 123 169 119 179 139 157 p (t-test) 0.0012 1.5E4 0.0077 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1140 1150 n (Patient) 185 131 203 113 218 98 sCr only Median 18.3 50.9 18.4 54.6 20.4 50.9 Average 59.3 95.6 58.3 102 66.3 89.6 Stdev 146 144 141 151 158 113 p (t-test) 0.031 0.011 0.19 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1150 1140 1150 1140 1150 679 n (Patient) 191 124 205 110 217 98 UO only Median 24.4 78.9 24.4 82.3 24.4 86.0 Average 62.8 124 62.5 129 62.3 131 Stdev 135 182 134 187 134 188 p (t-test) 0.0040 0.0021 0.0016 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 255 59 259 55 260 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.69 0.73 0.70 0.70 0.70 0.68 0.71 SE 0.030 0.031 0.041 0.031 0.032 0.042 0.033 0.034 0.042 p Value 2.8E11 6.6E9 1.9E6 1.8E13 1.7E10 1.0E6 1.4E9 1.3E7 5.6E7 nCohort Non- 185 191 255 203 205 259 218 217 260 persistent nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 86% 86% 90% 90% 90% 91% 90% 90% 91% Specificity 33% 32% 29% 33% 33% 29% 32% 32% 28% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 68% 67% 71% 72% 70% 73% 70% 68% 74% Specificity 63% 61% 55% 62% 60% 55% 59% 58% 55% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 40% 40% 51% 44% 42% 53% 45% 42% 54% Specificity 86% 84% 81% 86% 84% 81% 84% 82% 81% OR Quartile 2 3.09 3.03 3.54 4.67 4.47 4.00 4.08 4.10 3.90 p Value 1.6E4 2.6E4 0.0052 1.1E5 2.0E5 0.0046 1.1E4 1.1E4 0.0054 Lower limit of 1.72 1.67 1.46 2.35 2.25 1.53 2.00 2.01 1.49 95% CI Upper limit of 5.54 5.48 8.60 9.28 8.88 10.4 8.32 8.38 10.2 95% CI OR Quartile 3 3.56 3.13 3.01 4.14 3.57 3.24 3.45 2.99 3.49 p Value 1.4E7 2.3E6 4.5E4 2.2E8 4.6E7 3.4E4 2.0E6 2.0E5 1.9E4 Lower limit of 2.22 1.95 1.63 2.52 2.18 1.70 2.07 1.81 1.81 95% CI Upper limit of 5.72 5.03 5.56 6.81 5.86 6.15 5.75 4.95 6.73 95% CI OR Quartile 4 4.16 3.51 4.35 4.76 3.75 4.66 4.26 3.39 4.87 p Value 2.6E7 3.6E6 1.4E6 1.5E8 1.1E6 8.5E7 1.3E7 7.1E6 5.0E7 Lower limit of 2.42 2.06 2.39 2.77 2.20 2.53 2.49 1.99 2.63 95% CI Upper limit of 7.14 5.96 7.91 8.18 6.37 8.60 7.29 5.77 9.03 95% CI

TABLE-US-00239 TABLE 32.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 18.2 50.6 18.3 54.6 20.7 50.9 Average 52.1 102 50.2 110 59.8 101 Stdev 123 167 118 175 141 153 p (t-test) 0.0026 3.1E4 0.017 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1140 1150 n (Patient) 174 142 189 127 204 112 sCr only Median 19.2 48.2 19.7 50.6 22.7 48.2 Average 58.8 93.6 59.1 96.8 68.0 84.3 Stdev 146 145 144 146 161 110 p (t-test) 0.036 0.026 0.35 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1150 1140 1150 1140 1150 679 n (Patient) 181 134 194 121 207 108 UO only Median 24.4 73.5 24.9 73.6 24.9 73.6 Average 62.2 117 62.0 122 62.0 122 Stdev 135 177 134 182 134 182 p (t-test) 0.0063 0.0035 0.0035 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 245 69 250 64 250 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.65 0.67 0.70 0.67 0.67 0.67 0.65 0.67 SE 0.031 0.032 0.039 0.031 0.032 0.040 0.033 0.033 0.040 p Value 4.2E8 1.1E6 1.3E5 1.2E10 5.1E8 1.5E5 1.2E7 8.7E6 1.5E5 nCohort Non- 174 181 245 189 194 250 204 207 250 persistent nCohort Persistent 142 134 69 127 121 64 112 108 64 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 82% 82% 86% 85% 85% 86% 85% 85% 86% Specificity 30% 30% 28% 32% 31% 28% 30% 30% 28% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 64% 63% 68% 68% 66% 69% 67% 65% 69% Specificity 61% 60% 55% 62% 60% 55% 59% 57% 55% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 39% 38% 46% 42% 40% 47% 41% 39% 47% Specificity 86% 85% 81% 86% 84% 80% 84% 82% 80% OR Quartile 2 1.95 2.00 2.31 2.64 2.62 2.38 2.44 2.52 2.38 p Value 0.014 0.012 0.024 9.4E4 0.0012 0.025 0.0034 0.0029 0.025 Lower limit of 1.15 1.16 1.12 1.49 1.46 1.11 1.34 1.37 1.11 95% CI Upper limit of 3.33 3.44 4.78 4.70 4.71 5.07 4.43 4.62 5.07 95% CI OR Quartile 3 2.85 2.57 2.62 3.41 2.90 2.67 2.96 2.49 2.67 p Value 7.8E6 6.0E5 8.3E4 3.9E7 1.0E5 1.0E3 1.1E5 2.0E4 1.0E3 Lower limit of 1.80 1.62 1.49 2.12 1.81 1.49 1.82 1.54 1.49 95% CI Upper limit of 4.51 4.07 4.62 5.47 4.66 4.78 4.79 4.03 4.78 95% CI OR Quartile 4 3.95 3.36 3.64 4.49 3.46 3.62 3.61 2.92 3.62 p Value 8.7E7 8.4E6 8.8E6 6.2E8 4.4E6 1.5E5 2.0E6 6.3E5 1.5E5 Lower limit of 2.29 1.97 2.06 2.61 2.04 2.02 2.13 1.73 2.02 95% CI Upper limit of 6.83 5.72 6.44 7.73 5.87 6.48 6.13 4.94 6.48 95% CI

TABLE-US-00240 TABLE 32.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 18.2 49.9 18.2 54.6 19.7 50.9 Average 52.4 100 50.3 110 59.0 101 Stdev 123 167 119 174 141 152 p (t-test) 0.0035 3.6E4 0.015 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1140 1150 n (Patient) 172 144 188 128 200 116 sCr only Median 18.4 48.2 18.4 50.9 20.4 49.9 Average 58.8 93.0 56.9 99.2 65.2 88.8 Stdev 146 144 142 149 160 116 p (t-test) 0.039 0.012 0.17 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1150 1140 1150 1140 1150 679 n (Patient) 179 136 191 124 203 112 UO only Median 23.8 71.6 24.1 73.6 24.1 73.6 Average 62.3 111 61.9 117 61.9 117 Stdev 137 169 135 175 135 175 p (t-test) 0.011 0.0053 0.0053 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 238 76 244 70 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.67 0.66 0.67 0.70 0.68 0.68 0.68 0.66 0.68 SE 0.031 0.031 0.037 0.031 0.031 0.038 0.032 0.033 0.038 p Value 6.9E8 5.4E7 3.6E6 1.1E10 6.6E9 2.2E6 2.2E8 6.5E7 2.2E6 nCohort Non- 172 179 238 188 191 244 200 203 244 persistent nCohort Persistent 144 136 76 128 124 70 116 112 70 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 82% 82% 87% 85% 85% 87% 85% 86% 87% Specificity 31% 31% 29% 32% 32% 29% 31% 31% 29% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 64% 64% 68% 68% 67% 70% 67% 66% 70% Specificity 62% 60% 56% 62% 61% 56% 60% 59% 56% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 38% 38% 46% 41% 40% 47% 41% 40% 47% Specificity 86% 85% 82% 86% 85% 81% 84% 83% 81% OR Quartile 2 2.02 2.07 2.69 2.69 2.76 2.73 2.62 2.70 2.73 p Value 0.0098 0.0087 0.0071 7.6E4 6.6E4 0.0090 0.0015 0.0013 0.0090 Lower limit of 1.19 1.20 1.31 1.51 1.54 1.28 1.44 1.47 1.28 95% CI Upper limit of 3.45 3.56 5.55 4.78 4.96 5.79 4.75 4.95 5.79 95% CI OR Quartile 3 2.84 2.70 2.74 3.50 3.13 2.94 3.08 2.76 2.94 p Value 8.0E6 2.4E5 3.0E4 2.3E7 2.3E6 2.1E4 4.4E6 3.5E5 2.1E4 Lower limit of 1.80 1.70 1.59 2.18 1.95 1.66 1.91 1.71 1.66 95% CI Upper limit of 4.49 4.28 4.74 5.62 5.03 5.20 4.98 4.46 5.20 95% CI OR Quartile 4 3.81 3.49 3.76 4.40 3.77 3.84 3.85 3.34 3.84 p Value 1.6E6 5.0E6 3.1E6 8.9E8 1.1E6 3.5E6 6.9E7 7.5E6 3.5E6 Lower limit of 2.21 2.04 2.16 2.56 2.21 2.17 2.26 1.97 2.17 95% CI Upper limit of 6.58 5.96 6.57 7.58 6.44 6.78 6.55 5.66 6.78 95% CI

TABLE-US-00241 TABLE 32.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 18.2 49.9 18.3 54.5 19.7 50.9 Average 52.8 98.7 50.9 107 59.5 98.5 Stdev 125 165 120 172 143 150 p (t-test) 0.0053 7.7E4 0.021 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1140 1150 n (Patient) 168 148 183 133 196 120 sCr only Median 18.4 48.2 18.4 50.9 20.4 49.9 Average 59.4 91.3 57.4 97.1 65.8 86.9 Stdev 148 142 144 147 161 114 p (t-test) 0.054 0.018 0.22 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1150 1140 1150 1140 1150 679 n (Patient) 175 140 187 128 199 116 UO only Median 23.7 55.1 23.8 62.5 23.8 62.5 Average 62.5 108 62.3 110 62.3 110 Stdev 138 165 137 168 137 168 p (t-test) 0.017 0.012 0.012 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 233 81 236 78 236 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.662 0.65 0.67 0.69 0.67 0.67 0.68 0.65 0.67 SE 0.031 0.031 0.037 0.031 0.031 0.037 0.032 0.033 0.037 p Value 1.3E7 1.6E6 4.5E6 6.4E10 2.7E8 2.4E6 2.6E8 2.2E6 2.4E6 nCohort Non- 168 175 233 183 187 236 196 199 236 persistent nCohort Persistent 148 140 81 133 128 78 120 116 78 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 82% 81% 86% 85% 84% 87% 86% 84% 87% Specificity 31% 30% 29% 32% 32% 29% 32% 31% 29% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 64% 64% 68% 67% 66% 69% 67% 66% 69% Specificity 62% 61% 56% 62% 61% 56% 60% 59% 56% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 38% 38% 44% 41% 40% 45% 41% 40% 45% Specificity 86% 85% 82% 86% 85% 81% 85% 83% 81% OR Quartile 2 2.01 1.90 2.62 2.69 2.49 2.81 2.80 2.41 2.81 p Value 0.0099 0.018 0.0066 6.4E4 0.0017 0.0050 6.8E4 0.0033 0.0050 Lower limit of 1.18 1.12 1.31 1.52 1.41 1.37 1.55 1.34 1.37 95% CI Upper limit of 3.41 3.25 5.26 4.74 4.39 5.78 5.08 4.32 5.78 95% CI OR Quartile 3 2.83 2.68 2.72 3.34 3.09 2.91 3.03 2.71 2.91 p Value 8.3E6 2.5E5 2.4E4 4.6E7 2.6E6 1.3E4 5.0E6 4.0E5 1.3E4 Lower limit of 1.79 1.69 1.59 2.09 1.93 1.68 1.88 1.68 1.68 95% CI Upper limit of 4.47 4.24 4.63 5.34 4.94 5.01 4.87 4.36 5.01 95% CI OR Quartile 4 3.84 3.49 3.53 4.32 3.76 3.55 3.82 3.31 3.55 p Value 1.7E6 5.4E6 6.6E6 1.5E7 1.2E6 7.2E6 8.2E7 8.8E6 7.2E6 Lower limit of 2.21 2.04 2.04 2.50 2.20 2.04 2.24 1.95 2.04 95% CI Upper limit of 6.66 5.98 6.12 7.46 6.42 6.18 6.50 5.60 6.18 95% CI

TABLE-US-00242 TABLE 32.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 372 376 348 396 373 356 Average 482 573 466 624 527 483 Stdev 382 682 376 722 557 359 p (t-test) 0.30 0.080 0.64 Min 46.8 63.9 46.8 66.1 46.8 66.1 Max 1880 4690 1880 4690 4690 1700 n (Patient) 96 55 104 47 111 40 sCr only Median 368 384 364 392 372 356 Average 473 582 476 598 521 496 Stdev 380 679 385 717 557 381 p (t-test) 0.21 0.18 0.79 Min 46.8 63.9 46.8 63.9 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 94 56 103 47 108 42 UO only Median 364 392 364 392 350 394 Average 518 435 518 435 517 441 Stdev 531 260 531 260 529 265 p (t-test) 0.50 0.50 0.55 Min 46.8 66.1 46.8 66.1 46.8 66.1 Max 4690 1050 4690 1050 4690 1050 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.52 0.54 0.51 0.57 0.55 0.51 0.52 0.52 0.51 SE 0.049 0.049 0.071 0.051 0.051 0.071 0.054 0.053 0.073 p Value 0.61 0.42 0.94 0.15 0.33 0.94 0.74 0.69 0.89 nCohort Non- 96 94 131 104 103 131 111 108 132 persistent nCohort Persistent 55 56 19 47 47 19 40 42 18 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 76% 77% 84% 83% 81% 84% 82% 81% 83% Specificity 26% 27% 27% 29% 28% 27% 28% 28% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 51% 52% 58% 55% 53% 58% 50% 50% 61% Specificity 50% 51% 51% 52% 51% 51% 50% 50% 52% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 27% 29% 16% 30% 28% 16% 22% 24% 17% Specificity 76% 77% 73% 77% 76% 73% 74% 74% 73% OR Quartile 2 1.14 1.20 1.94 1.98 1.65 1.94 1.83 1.63 1.80 p Value 0.74 0.65 0.31 0.13 0.24 0.31 0.20 0.27 0.37 Lower limit of 0.526 0.554 0.534 0.827 0.711 0.534 0.732 0.680 0.492 95% CI Upper limit of 2.46 2.59 7.08 4.72 3.85 7.08 4.56 3.93 6.61 95% CI OR Quartile 3 1.04 1.12 1.44 1.34 1.20 1.44 0.982 1.00 1.67 p Value 0.91 0.74 0.46 0.41 0.60 0.46 0.96 1.0 0.32 Lower limit of 0.534 0.578 0.544 0.669 0.604 0.544 0.477 0.490 0.610 95% CI Upper limit of 2.01 2.17 3.81 2.67 2.40 3.81 2.02 2.04 4.57 95% CI OR Quartile 4 1.19 1.31 0.514 1.41 1.19 0.514 0.821 0.893 0.554 p Value 0.65 0.48 0.31 0.38 0.66 0.31 0.65 0.79 0.37 Lower limit of 0.559 0.618 0.141 0.652 0.546 0.141 0.349 0.389 0.151 95% CI Upper limit of 2.54 2.77 1.87 3.07 2.61 1.87 1.93 2.05 2.03 95% CI

TABLE-US-00243 TABLE 32.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 348 396 348 396 373 356 Average 451 605 448 626 514 518 Stdev 359 662 353 689 557 409 p (t-test) 0.068 0.037 0.96 Min 46.8 63.9 46.8 63.9 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 88 63 94 57 101 50 sCr only Median 331 397 330 397 364 392 Average 442 616 437 639 497 547 Stdev 354 668 348 690 555 422 p (t-test) 0.040 0.019 0.58 Min 46.8 63.9 46.8 63.9 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 88 62 93 57 99 51 UO only Median 364 392 364 392 350 394 Average 508 505 508 505 507 512 Stdev 531 374 531 374 529 380 p (t-test) 0.97 0.97 0.96 Min 46.8 66.1 46.8 66.1 46.8 66.1 Max 4690 1510 4690 1510 4690 1510 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.58 0.54 0.58 0.60 0.54 0.53 0.56 0.54 SE 0.048 0.048 0.062 0.048 0.048 0.062 0.050 0.050 0.063 p Value 0.12 0.077 0.57 0.091 0.041 0.57 0.53 0.22 0.53 nCohort Non- 88 88 123 94 93 123 101 99 124 persistent nCohort Persistent 63 62 27 57 57 27 50 51 26 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 79% 79% 81% 81% 81% 81% 80% 80% 81% Specificity 28% 28% 27% 29% 29% 27% 28% 28% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 54% 55% 56% 54% 56% 56% 50% 53% 58% Specificity 52% 53% 51% 52% 54% 51% 50% 52% 52% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 30% 31% 26% 32% 32% 26% 26% 27% 27% Specificity 78% 78% 75% 79% 78% 75% 75% 76% 75% OR Quartile 2 1.53 1.50 1.61 1.69 1.71 1.61 1.53 1.62 1.52 p Value 0.28 0.30 0.37 0.20 0.19 0.37 0.31 0.25 0.43 Lower limit of 0.709 0.695 0.565 0.761 0.772 0.565 0.677 0.714 0.531 95% CI Upper limit of 3.28 3.22 4.61 3.73 3.79 4.61 3.48 3.66 4.37 95% CI OR Quartile 3 1.28 1.39 1.31 1.30 1.49 1.31 0.980 1.20 1.45 p Value 0.45 0.32 0.52 0.44 0.24 0.52 0.95 0.61 0.39 Lower limit of 0.671 0.725 0.568 0.671 0.767 0.568 0.498 0.608 0.619 95% CI Upper limit of 2.46 2.67 3.03 2.51 2.89 3.03 1.93 2.35 3.42 95% CI OR Quartile 4 1.57 1.60 1.04 1.71 1.68 1.04 1.07 1.18 1.11 p Value 0.23 0.21 0.94 0.16 0.17 0.94 0.87 0.67 0.84 Lower limit of 0.748 0.765 0.401 0.810 0.799 0.401 0.491 0.549 0.424 95% CI Upper limit of 3.29 3.37 2.69 3.60 3.55 2.69 2.32 2.55 2.88 95% CI

TABLE-US-00244 TABLE 32.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 332 394 331 396 348 392 Average 451 594 448 605 505 531 Stdev 361 644 358 655 572 397 p (t-test) 0.086 0.062 0.76 Min 46.8 50.8 46.8 50.8 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 83 68 86 65 94 57 sCr only Median 331 394 331 394 332 392 Average 443 599 444 608 494 547 Stdev 357 647 353 662 567 413 p (t-test) 0.063 0.051 0.54 Min 46.8 50.8 46.8 50.8 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 82 68 86 64 93 57 UO only Median 332 396 332 396 331 397 Average 498 540 498 540 496 547 Stdev 538 383 538 383 536 386 p (t-test) 0.66 0.66 0.61 Min 46.8 66.1 46.8 66.1 46.8 66.1 Max 4690 1510 4690 1510 4690 1510 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.58 0.57 0.58 0.58 0.57 0.56 0.57 0.57 SE 0.047 0.047 0.057 0.047 0.047 0.057 0.049 0.049 0.057 p Value 0.15 0.11 0.22 0.11 0.11 0.22 0.23 0.15 0.20 nCohort Non- 83 82 115 86 86 115 94 93 116 persistent nCohort Persistent 68 68 35 65 64 35 57 57 34 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 78% 78% 83% 78% 78% 83% 81% 81% 82% Specificity 28% 28% 28% 28% 28% 28% 29% 29% 28% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 54% 54% 60% 55% 55% 60% 54% 54% 62% Specificity 53% 54% 53% 53% 53% 53% 52% 53% 53% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 31% 31% 31% 31% 30% 31% 28% 28% 32% Specificity 80% 79% 77% 79% 78% 77% 77% 76% 77% OR Quartile 2 1.35 1.38 1.86 1.41 1.38 1.86 1.69 1.71 1.78 p Value 0.43 0.40 0.21 0.37 0.40 0.21 0.20 0.19 0.25 Lower limit of 0.641 0.651 0.707 0.662 0.648 0.707 0.761 0.772 0.673 95% CI Upper limit of 2.86 2.91 4.91 3.00 2.95 4.91 3.73 3.79 4.70 95% CI OR Quartile 3 1.35 1.38 1.69 1.43 1.39 1.69 1.30 1.33 1.85 p Value 0.36 0.33 0.18 0.28 0.32 0.18 0.44 0.40 0.12 Lower limit of 0.708 0.725 0.785 0.747 0.725 0.785 0.671 0.685 0.848 95% CI Upper limit of 2.56 2.63 3.66 2.73 2.66 3.66 2.51 2.57 4.05 95% CI OR Quartile 4 1.73 1.71 1.49 1.68 1.49 1.49 1.28 1.26 1.58 p Value 0.15 0.16 0.35 0.17 0.29 0.35 0.52 0.55 0.29 Lower limit of 0.827 0.814 0.649 0.801 0.711 0.649 0.604 0.595 0.682 95% CI Upper limit of 3.64 3.59 3.44 3.52 3.12 3.44 2.70 2.67 3.64 95% CI

TABLE-US-00245 TABLE 32.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 332 394 330 397 330 397 Average 455 585 447 603 498 541 Stdev 363 638 360 650 576 398 p (t-test) 0.12 0.063 0.61 Min 50.8 46.8 46.8 50.8 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 81 70 85 66 91 60 sCr only Median 330 396 329 397 329 397 Average 442 598 440 608 492 547 Stdev 359 642 356 652 576 403 p (t-test) 0.064 0.045 0.52 Min 46.8 50.8 46.8 50.8 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 81 69 84 66 90 60 UO only Median 332 396 331 397 330 397 Average 503 520 499 531 497 537 Stdev 549 369 548 365 546 368 p (t-test) 0.86 0.73 0.68 Min 50.8 46.8 46.8 66.1 46.8 66.1 Max 4690 1510 4690 1510 4690 1510 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.58 0.55 0.58 0.59 0.57 0.58 0.58 0.58 SE 0.047 0.047 0.054 0.047 0.047 0.054 0.048 0.048 0.054 p Value 0.22 0.092 0.30 0.095 0.067 0.18 0.12 0.083 0.16 nCohort Non- 81 81 109 85 84 110 91 90 111 persistent nCohort Persistent 70 69 41 66 66 40 60 60 39 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 77% 78% 80% 79% 79% 82% 82% 82% 82% Specificity 27% 28% 28% 28% 29% 28% 30% 30% 28% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 54% 55% 59% 56% 56% 60% 57% 57% 62% Specificity 53% 54% 53% 54% 55% 54% 54% 54% 54% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 30% 30% 29% 30% 30% 30% 28% 28% 31% Specificity 79% 79% 76% 79% 79% 76% 77% 77% 77% OR Quartile 2 1.26 1.43 1.57 1.46 1.49 1.85 1.88 1.91 1.77 p Value 0.54 0.35 0.32 0.33 0.31 0.19 0.12 0.11 0.22 Lower limit of 0.599 0.675 0.650 0.686 0.697 0.741 0.850 0.863 0.708 95% CI Upper limit of 2.64 3.02 3.77 3.11 3.17 4.62 4.16 4.22 4.43 95% CI OR Quartile 3 1.34 1.46 1.61 1.50 1.54 1.74 1.53 1.56 1.88 p Value 0.37 0.25 0.20 0.22 0.19 0.14 0.21 0.18 0.096 Lower limit of 0.707 0.765 0.777 0.788 0.807 0.832 0.792 0.809 0.893 95% CI Upper limit of 2.55 2.78 3.32 2.87 2.95 3.62 2.94 3.02 3.97 95% CI OR Quartile 4 1.61 1.65 1.32 1.62 1.59 1.38 1.32 1.30 1.45 p Value 0.21 0.19 0.50 0.20 0.22 0.43 0.47 0.49 0.37 Lower limit of 0.770 0.785 0.591 0.773 0.761 0.618 0.626 0.617 0.647 95% CI Upper limit of 3.38 3.46 2.95 3.39 3.34 3.10 2.77 2.73 3.26 95% CI

TABLE-US-00246 TABLE 32.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 331 396 330 397 329 397 Average 451 584 448 593 496 542 Stdev 360 630 357 640 581 399 p (t-test) 0.11 0.082 0.59 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 4690 1700 n (Patient) 78 73 81 70 88 63 sCr only Median 330 396 329 397 329 397 Average 446 590 443 599 496 539 Stdev 361 636 358 646 581 401 p (t-test) 0.086 0.063 0.61 Min 46.8 50.8 46.8 50.8 46.8 63.9 Max 1880 4690 1880 4690 4690 1700 n (Patient) 79 71 82 68 88 62 UO only Median 334 394 334 394 332 396 Average 506 513 506 513 504 518 Stdev 551 366 551 366 549 370 p (t-test) 0.93 0.93 0.88 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1510 4690 1510 4690 1510 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.57 0.55 0.57 0.58 0.55 0.58 0.57 0.55 SE 0.047 0.047 0.053 0.047 0.047 0.053 0.048 0.048 0.054 p Value 0.19 0.13 0.35 0.14 0.095 0.35 0.11 0.12 0.33 nCohort Non- 78 79 108 81 82 108 88 88 109 persistent nCohort Persistent 73 71 42 70 68 42 63 62 41 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 77% 77% 81% 77% 78% 81% 81% 81% 80% Specificity 27% 28% 28% 27% 28% 28% 30% 30% 28% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 55% 55% 57% 56% 56% 57% 57% 56% 59% Specificity 54% 54% 53% 54% 55% 53% 55% 55% 53% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 30% 30% 29% 30% 29% 29% 29% 27% 29% Specificity 79% 78% 76% 79% 78% 76% 77% 76% 76% OR Quartile 2 1.21 1.33 1.63 1.26 1.38 1.63 1.78 1.75 1.57 p Value 0.61 0.46 0.27 0.54 0.40 0.27 0.15 0.16 0.32 Lower limit of 0.580 0.631 0.680 0.599 0.651 0.680 0.819 0.802 0.650 95% CI Upper limit of 2.54 2.79 3.93 2.64 2.91 3.93 3.88 3.81 3.77 95% CI OR Quartile 3 1.41 1.46 1.49 1.50 1.54 1.49 1.60 1.56 1.61 p Value 0.29 0.25 0.28 0.22 0.19 0.28 0.16 0.19 0.20 Lower limit of 0.745 0.765 0.726 0.786 0.807 0.726 0.834 0.809 0.777 95% CI Upper limit of 2.68 2.77 3.06 2.85 2.94 3.06 3.07 2.99 3.32 95% CI OR Quartile 4 1.67 1.53 1.26 1.61 1.48 1.26 1.36 1.21 1.32 p Value 0.18 0.26 0.57 0.21 0.30 0.57 0.42 0.62 0.50 Lower limit of 0.795 0.731 0.566 0.770 0.708 0.566 0.649 0.574 0.591 95% CI Upper limit of 3.51 3.21 2.81 3.38 3.10 2.81 2.85 2.53 2.95 95% CI

Example 33. Use of CC Motif Chemokine 24 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0217] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CC motif chemokine 24 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0218] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0219] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00247 TABLE 33.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 15.2 39.8 19.3 42.2 19.8 44.7 Average 54.0 86.4 51.3 97.0 52.6 102 Stdev 132 153 117 168 115 175 p (t-test) 0.056 0.0054 0.0026 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 118 198 157 159 178 138 sCr only Median 17.6 38.9 19.3 42.0 20.4 46.0 Average 54.6 86.7 50.8 97.3 53.1 102 Stdev 127 157 116 169 114 178 p (t-test) 0.054 0.0046 0.0033 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 129 186 161 154 183 132 UO only Median 22.9 73.9 24.4 89.6 25.6 97.6 Average 57.8 127 59.3 138 60.8 142 Stdev 131 181 130 191 131 197 p (t-test) 3.2E4 1.7E4 2.6E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 240 74 255 59 262 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.62 0.70 0.64 0.64 0.71 0.65 0.65 0.71 SE 0.032 0.032 0.037 0.031 0.031 0.040 0.031 0.032 0.043 p Value 5.0E5 1.9E4 4.1E8 1.2E5 6.5E6 1.2E7 1.1E6 4.2E6 6.4E7 nCohort Non- 118 129 240 157 161 255 178 183 262 persistent nCohort Persistent 198 186 74 159 154 59 138 132 52 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 80% 81% 89% 81% 82% 90% 83% 83% 90% Specificity 34% 33% 30% 31% 32% 29% 31% 31% 28% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 58% 59% 72% 60% 60% 73% 62% 62% 71% Specificity 64% 62% 57% 60% 60% 55% 60% 58% 54% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 31% 32% 49% 35% 35% 54% 37% 36% 56% Specificity 86% 84% 82% 85% 84% 82% 84% 83% 81% OR Quartile 2 2.09 2.08 3.47 1.95 2.09 3.54 2.30 2.26 3.70 p Value 0.0052 0.0053 0.0019 0.012 0.0063 0.0052 0.0030 0.0039 0.0076 Lower limit of 1.25 1.24 1.58 1.16 1.23 1.46 1.33 1.30 1.42 95% CI Upper limit of 3.51 3.49 7.59 3.29 3.53 8.60 3.97 3.94 9.67 95% CI OR Quartile 3 2.42 2.31 3.30 2.21 2.25 3.32 2.43 2.31 2.92 p Value 2.3E4 3.6E4 3.6E5 5.3E4 4.2E4 1.6E4 1.3E4 3.5E4 0.0012 Lower limit of 1.51 1.46 1.87 1.41 1.43 1.78 1.54 1.46 1.53 95% CI Upper limit of 3.86 3.66 5.81 3.47 3.53 6.21 3.84 3.65 5.58 95% CI OR Quartile 4 2.71 2.53 4.34 2.93 2.94 5.25 3.14 2.80 5.35 p Value 0.0010 0.0013 3.2E7 1.1E4 9.1E5 6.9E8 2.4E5 1.2E4 1.7E7 Lower limit of 1.49 1.43 2.47 1.70 1.71 2.87 1.85 1.66 2.85 95% CI Upper limit of 4.91 4.47 7.62 5.05 5.04 9.58 5.34 4.73 10.0 95% CI

TABLE-US-00248 TABLE 33.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 14.3 40.4 17.9 42.7 17.9 44.7 Average 47.1 89.0 47.9 97.0 49.1 101 Stdev 125 155 115 166 114 171 p (t-test) 0.015 0.0028 0.0014 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 111 205 146 170 164 152 sCr only Median 15.8 39.7 18.3 42.7 17.9 44.7 Average 48.6 90.0 45.9 99.7 47.6 103 Stdev 119 159 109 170 110 174 p (t-test) 0.014 9.9E4 6.6E4 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 125 190 153 162 168 147 UO only Median 19.9 55.1 23.0 74.0 23.8 74.7 Average 57.2 114 59.1 121 60.7 121 Stdev 135 165 134 173 135 176 p (t-test) 0.0015 0.0013 0.0023 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 221 93 237 77 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.63 0.70 0.65 0.66 0.70 0.67 0.67 0.69 SE 0.031 0.031 0.034 0.031 0.031 0.037 0.030 0.031 0.038 p Value 1.6E6 2.1E5 4.1E9 6.2E7 3.8E7 6.0E8 5.1E8 3.5E8 4.0E7 nCohort Non- 111 125 221 146 153 237 164 168 244 persistent nCohort Persistent 205 190 93 170 162 77 152 147 70 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 80% 81% 88% 82% 83% 88% 84% 84% 89% Specificity 35% 34% 31% 33% 33% 30% 33% 33% 29% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 59% 59% 72% 61% 61% 73% 63% 64% 71% Specificity 67% 64% 59% 62% 61% 57% 62% 62% 56% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 32% 32% 46% 35% 35% 49% 37% 37% 50% Specificity 88% 86% 84% 86% 86% 83% 86% 85% 82% OR Quartile 2 2.23 2.24 3.31 2.20 2.39 3.17 2.49 2.70 3.18 p Value 0.0025 0.0022 6.8E4 0.0030 0.0012 0.0026 8.8E4 4.0E4 0.0039 Lower limit of 1.33 1.34 1.66 1.31 1.41 1.50 1.46 1.56 1.45 95% CI Upper limit of 3.76 3.76 6.61 3.70 4.06 6.70 4.27 4.67 6.98 95% CI OR Quartile 3 2.88 2.61 3.75 2.54 2.50 3.59 2.82 2.88 3.20 p Value 1.8E5 5.5E5 8.6E7 5.7E5 7.3E5 8.8E6 8.5E6 6.1E6 7.7E5 Lower limit of 1.78 1.64 2.22 1.61 1.59 2.04 1.79 1.82 1.80 95% CI Upper limit of 4.67 4.16 6.35 4.01 3.94 6.31 4.45 4.56 5.70 95% CI OR Quartile 4 3.58 2.81 4.42 3.35 3.23 4.66 3.58 3.32 4.55 p Value 1.2E4 5.3E4 7.7E8 3.0E5 3.4E5 7.0E8 5.7E6 1.4E5 2.0E7 Lower limit of 1.87 1.57 2.57 1.90 1.86 2.66 2.06 1.93 2.57 95% CI Upper limit of 6.85 5.04 7.60 5.91 5.63 8.15 6.20 5.71 8.05 95% CI

TABLE-US-00249 TABLE 33.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 13.6 40.3 16.9 43.2 16.9 44.6 Average 47.4 88.7 47.8 96.2 49.6 98.7 Stdev 125 155 116 164 116 168 p (t-test) 0.017 0.0032 0.0027 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 110 206 143 173 157 159 sCr only Median 14.5 39.7 17.2 43.2 17.2 44.6 Average 48.7 89.5 45.9 98.8 48.0 101 Stdev 120 159 110 169 111 172 p (t-test) 0.015 0.0012 0.0013 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 123 192 150 165 162 153 UO only Median 20.3 54.7 22.9 64.0 23.7 69.8 Average 58.5 106 60.1 109 61.7 109 Stdev 138 159 138 163 138 164 p (t-test) 0.0064 0.0069 0.012 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 211 103 224 90 231 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.64 0.68 0.66 0.66 0.68 0.66 0.66 0.67 SE 0.031 0.031 0.033 0.030 0.030 0.035 0.030 0.030 0.036 p Value 1.9E6 1.4E5 9.0E8 2.5E7 1.7E7 2.3E7 6.2E8 6.7E8 1.6E6 nCohort Non- 110 123 211 143 150 224 157 162 231 persistent nCohort Persistent 206 192 103 173 165 90 159 153 83 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 81% 81% 85% 82% 83% 86% 83% 84% 86% Specificity 35% 35% 30% 34% 34% 29% 33% 33% 29% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 59% 59% 69% 61% 61% 70% 63% 63% 69% Specificity 66% 64% 59% 63% 62% 58% 63% 62% 57% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 32% 32% 43% 35% 35% 46% 36% 36% 46% Specificity 88% 86% 83% 87% 86% 83% 86% 85% 82% OR Quartile 2 2.28 2.33 2.55 2.31 2.52 2.47 2.42 2.56 2.42 p Value 0.0019 0.0014 0.0031 0.0016 6.1E4 0.0066 0.0011 6.3E4 0.010 Lower limit of 1.35 1.39 1.37 1.37 1.49 1.29 1.42 1.49 1.23 95% CI Upper limit of 3.84 3.91 4.75 3.90 4.28 4.76 4.12 4.39 4.75 95% CI OR Quartile 3 2.81 2.62 3.22 2.62 2.57 3.23 2.89 2.87 2.87 p Value 2.8E5 5.3E5 4.3E6 3.5E5 4.6E5 1.1E5 5.1E6 6.3E6 1.0E4 Lower limit of 1.73 1.64 1.96 1.66 1.63 1.91 1.83 1.82 1.69 95% CI Upper limit of 4.55 4.19 5.31 4.14 4.06 5.44 4.57 4.53 4.89 95% CI OR Quartile 4 3.52 2.97 3.75 3.47 3.33 4.10 3.43 3.23 3.91 p Value 1.4E4 3.3E4 1.2E6 2.3E5 2.6E5 3.4E7 1.4E5 2.5E5 1.1E6 Lower limit of 1.84 1.64 2.20 1.95 1.90 2.38 1.97 1.87 2.26 95% CI Upper limit of 6.73 5.39 6.39 6.16 5.84 7.04 5.97 5.57 6.77 95% CI

TABLE-US-00250 TABLE 33.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 14.3 40.2 16.4 42.7 15.9 44.6 Average 47.8 88.2 47.9 95.9 49.6 98.1 Stdev 126 155 117 164 117 167 p (t-test) 0.019 0.0036 0.0032 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 109 207 142 174 155 161 sCr only Median 14.5 39.7 16.9 42.7 16.9 44.6 Average 48.7 89.5 45.9 98.4 48.1 100 Stdev 120 159 111 168 112 171 p (t-test) 0.015 0.0014 0.0014 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 123 192 149 166 161 154 UO only Median 19.9 54.5 20.4 55.1 22.7 55.1 Average 58.7 104 60.2 106 62.0 105 Stdev 139 157 139 159 140 159 p (t-test) 0.0091 0.010 0.019 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 207 107 219 95 225 89 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.64 0.67 0.66 0.66 0.68 0.67 0.67 0.68 SE 0.031 0.031 0.033 0.030 0.030 0.034 0.030 0.030 0.035 p Value 4.8E6 1.4E5 1.4E7 2.2E7 1.5E7 1.1E7 3.4E8 5.9E8 5.9E7 nCohort Non- 109 123 207 142 149 219 155 161 225 persistent nCohort Persistent 207 192 107 174 166 95 161 154 89 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 80% 81% 85% 82% 83% 86% 83% 84% 87% Specificity 35% 35% 30% 34% 34% 30% 34% 34% 30% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 58% 59% 68% 61% 61% 69% 63% 64% 69% Specificity 66% 64% 59% 63% 62% 58% 64% 63% 57% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 32% 32% 42% 34% 35% 44% 35% 36% 44% Specificity 88% 86% 84% 87% 86% 83% 86% 85% 82% OR Quartile 2 2.17 2.33 2.49 2.36 2.56 2.72 2.51 2.60 2.72 p Value 0.0037 0.0014 0.0033 0.0013 4.8E4 0.0026 7.0E4 5.0E4 0.0035 Lower limit of 1.29 1.39 1.35 1.40 1.51 1.42 1.47 1.52 1.39 95% CI Upper limit of 3.65 3.91 4.57 3.97 4.35 5.22 4.26 4.46 5.33 95% CI OR Quartile 3 2.74 2.62 3.14 2.70 2.65 3.20 3.06 2.95 2.93 p Value 4.4E5 5.3E5 5.2E6 2.1E5 2.8E5 8.7E6 1.8E6 3.8E6 5.1E5 Lower limit of 1.69 1.64 1.92 1.71 1.68 1.92 1.93 1.86 1.74 95% CI Upper limit of 4.44 4.19 5.14 4.26 4.17 5.35 4.83 4.66 4.92 95% CI OR Quartile 4 3.46 2.97 3.69 3.41 3.27 3.90 3.31 3.17 3.61 p Value 1.8E4 3.3E4 1.5E6 3.0E5 3.4E5 7.0E7 2.3E5 3.3E5 3.3E6 Lower limit of 1.81 1.64 2.17 1.92 1.87 2.28 1.90 1.84 2.10 95% CI Upper limit of 6.61 5.39 6.28 6.06 5.74 6.67 5.77 5.47 6.19 95% CI

TABLE-US-00251 TABLE 33.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 14.3 39.2 14.5 43.2 15.8 44.6 Average 48.8 87.0 48.1 94.4 50.2 95.8 Stdev 128 153 119 162 119 164 p (t-test) 0.029 0.0052 0.0055 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 105 211 137 179 149 167 sCr only Median 14.5 39.2 15.8 42.7 15.9 44.6 Average 49.2 88.6 46.1 97.0 48.3 98.7 Stdev 122 158 112 166 113 169 p (t-test) 0.020 0.0020 0.0021 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1070 1150 1070 1150 1070 1150 n (Patient) 120 195 145 170 157 158 UO only Median 19.9 50.6 20.4 54.5 21.9 52.8 Average 59.5 100 61.3 101 63.2 98.3 Stdev 141 154 142 154 143 154 p (t-test) 0.018 0.026 0.050 Min 0.00127 0.00127 0.00127 0.00127 0.00127 0.00127 Max 1140 1150 1140 1150 1140 1150 n (Patient) 201 113 211 103 216 98 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.64 0.67 0.66 0.66 0.67 0.67 0.67 0.66 SE 0.032 0.031 0.033 0.030 0.030 0.034 0.030 0.030 0.034 p Value 8.0E6 1.6E5 2.9E7 8.7E8 9.6E8 3.2E7 2.4E8 3.9E8 1.7E6 nCohort Non- 105 120 201 137 145 211 149 157 216 persistent nCohort Persistent 211 195 113 179 170 103 167 158 98 Cutoff Quartile 2 4.17 4.15 4.13 4.17 4.15 4.13 4.17 4.15 4.13 Sensitivity 81% 82% 85% 83% 84% 86% 84% 84% 87% Specificity 36% 36% 31% 35% 35% 31% 35% 34% 31% Cutoff Quartile 3 29.6 29.3 28.8 29.6 29.3 28.8 29.6 29.3 28.8 Sensitivity 58% 59% 67% 61% 61% 68% 63% 63% 67% Specificity 66% 64% 60% 64% 63% 59% 64% 63% 58% Cutoff Quartile 4 74.9 74.4 74.6 74.9 74.4 74.6 74.9 74.4 74.6 Sensitivity 31% 32% 41% 34% 35% 42% 35% 35% 41% Specificity 88% 86% 84% 87% 86% 83% 86% 85% 82% OR Quartile 2 2.35 2.47 2.52 2.57 2.75 2.83 2.78 2.79 2.88 p Value 0.0014 6.6E4 0.0024 3.9E4 1.8E4 0.0013 1.7E4 1.9E4 0.0015 Lower limit of 1.39 1.47 1.39 1.53 1.62 1.50 1.63 1.63 1.50 95% CI Upper limit of 3.97 4.15 4.57 4.34 4.67 5.34 4.73 4.78 5.52 95% CI OR Quartile 3 2.63 2.57 3.04 2.80 2.66 3.02 3.07 2.94 2.83 p Value 1.0E4 8.0E5 6.5E6 1.2E5 2.8E5 1.3E5 1.7E6 3.8E6 4.7E5 Lower limit of 1.61 1.61 1.88 1.76 1.68 1.84 1.94 1.86 1.72 95% CI Upper limit of 4.28 4.12 4.94 4.43 4.19 4.97 4.86 4.65 4.68 95% CI OR Quartile 4 3.22 2.82 3.50 3.42 3.32 3.48 3.24 3.20 3.13 p Value 4.2E4 6.3E4 3.6E6 3.7E5 3.4E5 4.1E6 3.9E5 3.4E5 2.6E5 Lower limit of 1.68 1.56 2.06 1.91 1.88 2.05 1.85 1.85 1.84 95% CI Upper limit of 6.17 5.12 5.93 6.13 5.86 5.93 5.68 5.54 5.33 95% CI

TABLE-US-00252 TABLE 33.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 347 380 364 378 373 355 Average 446 549 470 559 487 552 Stdev 374 566 370 620 381 644 p (t-test) 0.24 0.29 0.44 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 50 101 75 76 85 66 sCr only Median 327 386 371 374 376 332 Average 437 555 481 545 491 544 Stdev 379 569 387 610 393 642 p (t-test) 0.18 0.45 0.54 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 52 98 73 77 86 64 UO only Median 334 397 331 412 330 428 Average 504 520 504 524 509 503 Stdev 545 370 537 354 539 287 p (t-test) 0.87 0.84 0.96 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1050 n (Patient) 112 38 120 30 125 25 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.55 0.57 0.55 0.53 0.52 0.57 0.51 0.51 0.57 SE 0.049 0.048 0.055 0.047 0.047 0.060 0.048 0.048 0.065 p Value 0.27 0.13 0.37 0.58 0.72 0.25 0.88 0.86 0.29 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 75% 77% 79% 74% 74% 83% 74% 77% 84% Specificity 26% 29% 27% 24% 25% 28% 25% 27% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 52% 53% 58% 53% 51% 63% 50% 48% 68% Specificity 54% 56% 53% 52% 51% 53% 49% 49% 54% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 29% 29% 34% 30% 29% 33% 27% 25% 32% Specificity 82% 81% 78% 80% 78% 77% 76% 74% 76% OR Quartile 2 1.07 1.32 1.37 0.884 0.933 1.90 0.946 1.19 1.96 p Value 0.87 0.47 0.48 0.74 0.85 0.23 0.88 0.65 0.25 Lower limit of 0.491 0.618 0.566 0.424 0.446 0.670 0.451 0.563 0.628 95% CI Upper limit of 2.32 2.83 3.32 1.85 1.95 5.37 1.98 2.52 6.13 95% CI OR Quartile 3 1.30 1.43 1.53 1.20 1.05 1.97 0.977 0.897 2.45 p Value 0.45 0.30 0.26 0.57 0.87 0.11 0.94 0.74 0.053 Lower limit of 0.657 0.725 0.728 0.636 0.556 0.865 0.513 0.469 0.987 95% CI Upper limit of 2.56 2.80 3.22 2.28 2.00 4.50 1.86 1.71 6.10 95% CI OR Quartile 4 1.83 1.68 1.81 1.74 1.42 1.64 1.22 0.970 1.49 p Value 0.16 0.21 0.15 0.15 0.35 0.26 0.60 0.94 0.40 Lower limit of 0.792 0.742 0.810 0.822 0.678 0.689 0.583 0.460 0.585 95% CI Upper limit of 4.25 3.80 4.04 3.67 3.00 3.92 2.55 2.04 3.80 95% CI

TABLE-US-00253 TABLE 33.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 386 368 376 373 355 Average 443 550 468 556 473 561 Stdev 377 563 366 610 364 635 p (t-test) 0.23 0.29 0.29 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 49 102 70 81 79 72 sCr only Median 324 392 348 378 371 374 Average 434 555 453 567 458 576 Stdev 382 566 362 613 360 639 p (t-test) 0.17 0.18 0.16 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 51 99 70 80 79 71 UO only Median 364 392 337 396 334 397 Average 493 540 494 548 500 535 Stdev 540 421 533 420 535 393 p (t-test) 0.60 0.57 0.72 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1510 n (Patient) 103 47 111 39 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.58 0.54 0.53 0.55 0.56 0.52 0.54 0.56 SE 0.049 0.048 0.051 0.047 0.047 0.054 0.047 0.047 0.057 p Value 0.22 0.097 0.39 0.58 0.32 0.28 0.69 0.36 0.33 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort Persistent 102 99 47 81 80 39 72 71 34 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 75% 77% 77% 74% 75% 79% 75% 76% 79% Specificity 27% 29% 26% 24% 26% 27% 25% 27% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 53% 54% 53% 52% 52% 56% 50% 51% 59% Specificity 55% 57% 51% 51% 53% 52% 49% 51% 53% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 28% 28% 34% 30% 30% 33% 28% 28% 32% Specificity 82% 80% 79% 80% 80% 77% 77% 77% 77% OR Quartile 2 1.11 1.38 1.16 0.916 1.04 1.44 1.02 1.15 1.41 p Value 0.79 0.41 0.71 0.82 0.92 0.42 0.96 0.71 0.47 Lower limit of 0.511 0.643 0.520 0.438 0.497 0.594 0.487 0.549 0.556 95% CI Upper limit of 2.42 2.95 2.60 1.92 2.17 3.47 2.12 2.41 3.56 95% CI OR Quartile 3 1.38 1.52 1.20 1.14 1.24 1.42 0.975 1.05 1.58 p Value 0.36 0.23 0.60 0.69 0.51 0.35 0.94 0.87 0.24 Lower limit of 0.697 0.769 0.604 0.601 0.652 0.679 0.515 0.556 0.731 95% CI Upper limit of 2.74 3.00 2.40 2.16 2.36 2.95 1.85 2.00 3.44 95% CI OR Quartile 4 1.77 1.62 1.90 1.68 1.71 1.72 1.30 1.33 1.58 p Value 0.19 0.25 0.10 0.18 0.16 0.18 0.48 0.45 0.29 Lower limit of 0.761 0.714 0.884 0.791 0.805 0.772 0.624 0.636 0.682 95% CI Upper limit of 4.10 3.66 4.09 3.58 3.65 3.83 2.72 2.78 3.64 95% CI

TABLE-US-00254 TABLE 33.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 386 364 378 364 378 Average 443 550 465 557 463 567 Stdev 377 563 368 606 368 620 p (t-test) 0.23 0.27 0.22 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 49 102 69 82 75 76 sCr only Median 324 392 332 380 332 380 Average 434 555 450 568 450 578 Stdev 382 566 364 610 364 624 p (t-test) 0.17 0.16 0.13 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 51 99 69 81 75 75 UO only Median 334 394 332 396 331 397 Average 491 538 495 538 501 527 Stdev 551 408 544 403 546 376 p (t-test) 0.59 0.63 0.78 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1510 n (Patient) 98 52 105 45 110 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.58 0.55 0.53 0.55 0.56 0.54 0.56 0.56 SE 0.049 0.048 0.050 0.047 0.047 0.052 0.047 0.047 0.054 p Value 0.22 0.097 0.28 0.49 0.26 0.25 0.38 0.18 0.30 nCohort Non- 49 51 98 69 69 105 75 75 110 persistent nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 75% 77% 77% 74% 75% 80% 76% 77% 80% Specificity 27% 29% 27% 25% 26% 28% 27% 28% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 53% 54% 56% 52% 53% 58% 53% 53% 60% Specificity 55% 57% 53% 52% 54% 53% 52% 53% 54% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 28% 28% 33% 29% 30% 31% 28% 28% 30% Specificity 82% 80% 79% 80% 80% 77% 77% 77% 76% OR Quartile 2 1.11 1.38 1.20 0.950 1.08 1.53 1.17 1.33 1.50 p Value 0.79 0.41 0.64 0.89 0.84 0.33 0.67 0.45 0.37 Lower limit of 0.511 0.643 0.549 0.454 0.515 0.655 0.561 0.634 0.621 95% CI Upper limit of 2.42 2.95 2.64 1.99 2.25 3.56 2.45 2.78 3.62 95% CI OR Quartile 3 1.38 1.52 1.43 1.20 1.31 1.56 1.20 1.31 1.74 p Value 0.36 0.23 0.30 0.57 0.41 0.21 0.57 0.41 0.14 Lower limit of 0.697 0.769 0.725 0.634 0.687 0.773 0.636 0.688 0.832 95% CI Upper limit of 2.74 3.00 2.80 2.28 2.49 3.16 2.28 2.48 3.62 95% CI OR Quartile 4 1.77 1.62 1.78 1.63 1.65 1.52 1.30 1.33 1.38 p Value 0.19 0.25 0.13 0.21 0.19 0.29 0.48 0.45 0.43 Lower limit of 0.761 0.714 0.838 0.764 0.777 0.700 0.623 0.634 0.618 95% CI Upper limit of 4.10 3.66 3.79 3.46 3.52 3.32 2.73 2.78 3.10 95% CI

TABLE-US-00255 TABLE 33.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 386 348 380 348 380 Average 443 550 465 557 463 566 Stdev 377 563 370 602 370 616 p (t-test) 0.23 0.27 0.22 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 49 102 68 83 74 77 sCr only Median 324 392 331 386 331 386 Average 434 555 449 567 449 577 Stdev 382 566 366 606 366 620 p (t-test) 0.17 0.16 0.13 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 51 99 68 82 74 76 UO only Median 330 397 329 412 328 428 Average 483 551 486 550 493 541 Stdev 554 408 551 399 552 375 p (t-test) 0.43 0.47 0.60 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1510 n (Patient) 95 55 100 50 105 45 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.56 0.58 0.57 0.54 0.56 0.58 0.55 0.57 0.58 SE 0.049 0.048 0.049 0.047 0.047 0.050 0.047 0.047 0.052 p Value 0.22 0.097 0.13 0.45 0.22 0.11 0.34 0.16 0.14 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 75% 77% 78% 75% 76% 80% 77% 78% 80% Specificity 27% 29% 27% 25% 26% 28% 27% 28% 28% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 53% 54% 58% 53% 54% 60% 53% 54% 62% Specificity 55% 57% 55% 53% 54% 55% 53% 54% 55% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 28% 28% 33% 29% 29% 32% 27% 28% 31% Specificity 82% 80% 79% 79% 79% 78% 77% 77% 77% OR Quartile 2 1.11 1.38 1.35 0.984 1.12 1.56 1.21 1.38 1.53 p Value 0.79 0.41 0.45 0.97 0.77 0.29 0.61 0.40 0.33 Lower limit of 0.511 0.643 0.617 0.470 0.534 0.686 0.582 0.657 0.655 95% CI Upper limit of 2.42 2.95 2.95 2.06 2.33 3.53 2.53 2.88 3.56 95% CI OR Quartile 3 1.38 1.52 1.68 1.27 1.38 1.83 1.27 1.38 2.03 p Value 0.36 0.23 0.13 0.47 0.33 0.085 0.47 0.33 0.052 Lower limit of 0.697 0.769 0.860 0.668 0.725 0.920 0.670 0.725 0.994 95% CI Upper limit of 2.74 3.00 3.29 2.41 2.63 3.65 2.40 2.62 4.15 95% CI OR Quartile 4 1.77 1.62 1.82 1.57 1.60 1.67 1.26 1.28 1.52 p Value 0.19 0.25 0.12 0.24 0.23 0.19 0.54 0.51 0.29 Lower limit of 0.761 0.714 0.863 0.737 0.749 0.781 0.601 0.611 0.700 95% CI Upper limit of 4.10 3.66 3.86 3.34 3.40 3.57 2.63 2.68 3.32 95% CI

TABLE-US-00256 TABLE 33.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 330 386 330 394 331 392 Average 432 553 442 570 447 574 Stdev 374 561 357 599 358 611 p (t-test) 0.18 0.13 0.13 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 47 104 65 86 70 81 sCr only Median 327 386 331 386 331 386 Average 436 553 450 564 449 573 Stdev 386 564 371 599 371 612 p (t-test) 0.19 0.18 0.14 Min 46.8 50.8 46.8 50.8 46.8 50.8 Max 1880 4690 1880 4690 1880 4690 n (Patient) 50 100 66 84 72 78 UO only Median 329 412 328 428 328 428 Average 484 545 484 548 495 533 Stdev 563 399 558 400 561 378 p (t-test) 0.48 0.46 0.67 Min 50.8 46.8 50.8 46.8 50.8 46.8 Max 4690 1700 4690 1700 4690 1510 n (Patient) 92 58 95 55 99 51 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.57 0.58 0.58 0.56 0.56 0.58 0.56 0.57 0.57 SE 0.049 0.049 0.048 0.047 0.047 0.049 0.047 0.047 0.050 p Value 0.14 0.10 0.11 0.18 0.20 0.10 0.20 0.14 0.18 nCohort Non- 47 50 92 65 66 95 70 72 99 persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 218 217 217 218 217 217 218 217 217 Sensitivity 76% 77% 79% 76% 76% 80% 77% 78% 78% Specificity 28% 30% 28% 26% 27% 28% 27% 29% 27% Cutoff Quartile 3 373 372 372 373 372 372 373 372 372 Sensitivity 53% 53% 59% 55% 54% 60% 54% 54% 61% Specificity 55% 56% 55% 55% 55% 56% 54% 54% 56% Cutoff Quartile 4 674 661 661 674 661 661 674 661 661 Sensitivity 29% 28% 31% 30% 29% 31% 28% 27% 29% Specificity 83% 80% 78% 82% 79% 78% 79% 76% 77% OR Quartile 2 1.21 1.43 1.51 1.10 1.20 1.59 1.22 1.48 1.36 p Value 0.64 0.35 0.30 0.81 0.63 0.26 0.60 0.30 0.45 Lower limit of 0.553 0.669 0.692 0.523 0.573 0.716 0.582 0.705 0.612 95% CI Upper limit of 2.64 3.08 3.30 2.30 2.51 3.52 2.54 3.10 3.04 95% CI OR Quartile 3 1.39 1.44 1.76 1.50 1.38 1.89 1.41 1.38 1.94 p Value 0.35 0.30 0.095 0.22 0.32 0.064 0.29 0.33 0.059 Lower limit of 0.696 0.725 0.906 0.783 0.725 0.964 0.743 0.725 0.974 95% CI Upper limit of 2.78 2.84 3.43 2.86 2.64 3.72 2.68 2.62 3.85 95% CI OR Quartile 4 1.98 1.56 1.62 1.91 1.49 1.58 1.45 1.19 1.38 p Value 0.13 0.29 0.20 0.10 0.31 0.23 0.33 0.64 0.41 Lower limit of 0.827 0.686 0.769 0.880 0.697 0.745 0.688 0.569 0.643 95% CI Upper limit of 4.72 3.53 3.41 4.16 3.17 3.34 3.07 2.50 2.95 95% CI

[0220] While the invention has been described and exemplified in sufficient detail for those skilled in this art to make and use it, various alternatives, modifications, and improvements should be apparent without departing from the spirit and scope of the invention. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Modifications therein and other uses will occur to those skilled in the art. These modifications are encompassed within the spirit of the invention and are defined by the scope of the claims.

[0221] It will be readily apparent to a person skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention.

[0222] All patents and publications mentioned in the specification are indicative of the levels of those of ordinary skill in the art to which the invention pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.

[0223] The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms comprising, consisting essentially of and consisting of may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.

[0224] Other embodiments are set forth within the following claims.