Compositions and methods for enhancing virus replication

Abstract

Described herein is a method of enhancing virus replication in permissive cells that express a receptor to FGF2 protein. The method includes administering FGF2 protein or a functional variant thereof and the virus to the permissive cells. An oncolytic virus having a genome that includes an open reading frame that encodes FGF2 protein or a functional variant thereof is also described.

Claims

1. An isolated oncolytic virus particle having a genome comprising an open reading frame that encodes an FGF2 protein or a functional variant thereof, wherein said FGF2 protein or functional variant thereof further comprises an immunoglobulin signal peptide.

2. The isolated oncolytic virus particle according to claim 1, wherein the amino acid sequence of an immunoglobulin signal peptide comprises the sequence of SEQ ID NO: 1.

3. The isolated oncolytic virus particle according to claim 1, wherein the FGF2 protein comprises an amino acid sequence selected from SEQ ID NOs: 2-13.

4. The isolated oncolytic virus particle according to claim 1, wherein the genome further comprises an open reading frame that encodes a Type 1 interferon scavenger.

5. The isolated oncolytic virus particle according to claim 4, wherein the Type 1 interferon scavenger is a B18R protein.

6. The isolated oncolytic virus particle according to claim 5, wherein the B18R protein comprises an amino acid sequence according to SEQ ID NO: 15, 16, or 17.

7. The isolated oncolytic virus particle according to claim 1, wherein the oncolytic virus is a rhabdovirus, a vaccinia virus, or a herpes simplex virus-1.

8. The isolated oncolytic virus particle according to claim 7, wherein the rhabdovirus is vesicular stomatitis virus, VSV51, VSV INF-, Maraba virus, or MG1 virus.

9. The isolated oncolytic virus particle according to claim 1, wherein the FGF2 protein comprises an amino acid sequence according to SEQ ID NO: 13.

10. The isolated oncolytic virus particle according to claim 1, wherein the FGF2 protein comprises an amino acid sequence according to SEQ ID NO: 2.

11. The isolated oncolytic virus particle according to claim 5, wherein the B18R protein comprises an amino acid sequence according to SEQ ID NO: 15.

12. The isolated oncolytic virus particle according to claim 1, wherein: the FGF2 protein comprises an amino acid sequence according to SEQ ID NO: 2; the genome further comprises an open reading frame that encodes a B18R protein that comprises an amino acid sequence according to SEQ ID NO: 15; and the oncolytic virus is a rhabdovirus.

13. The isolated oncolytic virus particle according to claim 12, wherein the rhabdovirus is MG1 virus.

14. The isolated oncolytic virus particle according to claim 12, wherein the rhabdovirus is vesicular stomatitis virus.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) Embodiments of the present disclosure will now be described, by way of example only, with reference to the attached Figures.

(2) FIG. 1 is a graph illustrating VSV51 replication in different cell lines that were untreated, or administered with FGF1 or FGF2.

(3) FIG. 2 is a graph illustrating virus replication for untreated, FGF1-treated, and FGF2-treated 786-0 cells over time.

(4) FIG. 3 is a graph illustrating virus replication for untreated, FGF1-treated, and FGF2-treated 786-0 under different multiplicities of infection.

(5) FIG. 4 is a graph illustrating dose-dependent virus replication in 786-0 cells with varying FGF2 concentrations.

(6) FIG. 5 is a graph illustrating virus replication in untreated and FGF2-treated 786-0 cells with co-administration of FGF Receptor 1 inhibitor.

(7) FIG. 6 is a graph illustrating virus replication in untreated, FGF1-treated, and FGF2-treated 786-0 cells in the presence of interferon alpha-2b.

(8) FIG. 7 is a graph illustrating virus replication in untreated and FGF2-treated 786-0 cells with various viruses.

(9) FIG. 8 is a graph illustrating virus replication in untreated, FGF1-treated and FGF2-treated 786-0 tumor cells, where treatment was performed ex-vivo.

(10) FIG. 9 is a graph illustrating virus replication in untreated, FGF1-treated and FGF2-treated MiaPaca tumor cells, where treatment was performed ex-vivo.

(11) FIG. 10 is a graph illustrating virus replication in untreated and FGF2-treated MiaPaca tumor cells, where treatment was performed in-vivo.

(12) FIG. 11 is a graph illustrating virus replication in untreated and FGF2-treated OVCAR8 tumor cells, where treatment was performed in-vivo.

(13) FIG. 12 is a graph illustrating virus replication in untreated and FGF2-treated 786-0 tumor cells, where treatment was performed in-vivo.

(14) FIG. 13 is a graph illustrating VSV51 replication in cells administered both FGF2 protein and B18R protein.

(15) FIG. 14 is a graph illustrating VSV51 replication in cells administered both FGF2 protein and B18R protein.

(16) FIG. 15 is a graph illustrating MG1 virus replication in cells administered both FGF2 protein and B18R protein.

(17) FIG. 16 is a graph illustrating a herpes simplex virus replication in cells administered both FGF2 protein and B18R protein.

(18) FIG. 17 is a graph illustrating a herpes simplex virus replication in cells administered both FGF2 protein and B18R protein.

(19) FIG. 18 is a graph illustrating a poxvirus replication in cells administered both FGF2 protein and B18R protein.

(20) FIG. 19 shows bright-field images of 786-0 cells that were (A) untreated, (B) treated with MG1, and (C) treated with a recombinant MG1 virus expressing FGF2 protein.

(21) FIG. 20 is a graph showing virus titers from MG1 or MG1-FGF2 infected cells.

(22) FIG. 21 is a graph illustrating influenza virus titers in MRC5 cells treated with either FGF2 or leptin.

(23) FIG. 22 is a graph showing measles virus titers in cells treated with FGF2.

DETAILED DESCRIPTION

(24) Generally, the present disclosure provides a method of enhancing virus replication in permissive cells that express a receptor to fibroblast growth factor 2 (FGF2) protein. The permissive cell may express FGF Receptor 1, FGF Receptor 3, or both. The method includes administering FGF2 protein, or a functional variant thereof, and a viable virus to the permissive cells.

(25) The present disclosure also provides: the use of FGF2 protein, or a functional variant thereof, for enhancing virus production in the permissive cells that express a receptor to FGF2 protein; as well as FGF2 protein, or a functional variant thereof, for enhancing virus replication in the permissive cells that express a receptor to FGF2 protein. Both general and specific examples of the methods discussed herein would be understood to equally apply to: the use of the FGF2 protein or functional variant thereof for enhancing the virus replication in the permissive cells that express a receptor to FGF2 protein; as well as to the FGF2 protein or functional variant thereof for enhancing the virus replication in the permissive cells that express a receptor to FGF2 protein.

(26) FGF2 protein is also known as basic fibroblast growth factor, bFGF, and FGF-. The FGF2 protein, or the functional variant thereof, may be modified to additionally include an amino acid sequence of an immunoglobulin signal peptide (IgSP). The IgSP may be at the N-terminal end of the FGF2-protein, or functional variant thereof. Adding the IgSP sequence may enhance secretion of the FGF2 protein or functional variant, as described in S. Rogelj, R. A. Weinberg, P. Fanning and M. Klagsbrun: Basic Fibroblast Growth Factor (bFGF) Fused to a Signal Peptide Transforms Cells. Nature, 331(6152): 173-175 (1988).

(27) The amino acid sequence of IgSP may be: MKCSWVIFFLMAVVTGVNS (SEQ ID NO: 1).

(28) Specific examples of FGF2 protein include proteins having the following amino acid sequences:

(29) TABLE-US-00001 (SEQIDNO:2) ---MAAGSITTLPALPEDGGSG-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYR SRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:3) ---MAASGITSLPALPEDGG--AAFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRS RKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:4) MAAGAAGSITTLPALPDDGGGG-AFPPGHFKDPKRLYCKN GGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYR SRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS (SEQIDNO:5) ---MAAGSITTLPALSGDGGGGGAFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGIREKSDPNIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLALKYVTEECFFFERLESNNYNTYR SRKYSNWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:6) ---MAAGSITTLPALPEDGGSS-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYR SRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS (SEQIDNO:7) ---MAAGSITTLPSLPEDGGSG-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYR SRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS (SEQIDNO:8) ---MAAGSITSLPALPEDGG-G-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYR SRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

(30) SEQ ID NO: 2 corresponds to a 17.3 kDa isoform of the human FGF2 protein. SEQ ID NO: 3 corresponds to a 17.1 kDa isoform of the mouse FGF2 protein. SEQ ID NO: 4 corresponds to an 17.3 kDa isoform of the chicken (Gallus gallus) FGF2 protein. SEQ ID NO: 5 corresponds to an 17.3 kDa isoform of the short tailed possum (Monodelphis domestica) FGF2 protein. SEQ ID NO: 6 corresponds to an 17.3 kDa isoform of the sheep FGF2 protein. SEQ ID NO: 7 corresponds to an 17.3 kDa isoform of the bovine FGF2 protein. SEQ ID NO: 8 corresponds to an 17.1 kDa isoform of the rat FGF2 protein.

(31) Other examples of FGF2 protein include proteins having the following amino acid sequences:

(32) TABLE-US-00002 (SEQIDNO:9) -----------MPALPEDGGSG-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYR SRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:10) ----AAGSITTLPALPEDGGSG-AFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYR SRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:11) ---MAASGITSLPALPEDGG--AAFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYR SRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQIDNO:12) -----------MPALPEDGG--AAFPPGHFKDPKRLYCKN GGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYR SRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

(33) SEQ ID NOs: 9 and 10 correspond to two recombinant human FGF2 proteins. SEQ ID NO: 11 (Accession: # P15655) corresponds to a recombinant mouse FGF2 protein. SEQ ID NO: 12 corresponds to a recombinant mouse FGF2 protein.

(34) As may be seen in Examples 1 and 11, the mouse protein is able to enhance virus replication in both permissive mouse and permissive human cells, suggesting that corresponding FGF2 proteins from one species would be able to enhance virus replication in permissive cells of another species.

(35) The sequences listed in SEQ ID NOs: 2-12 share the common consensus sequence:

(36) TABLE-US-00003 (SEQIDNO:13) XXXXXXXXXXXXPXLXXDGGXXXAFPPGHFKDPKRLYCKN GGFFLRIXPDGRVDGXREKSDPXXKLQLQAEERGVVSIKG VXANRXLAMKEDGRLLAXKXXTXECFFFERLESNNYNTYR SRKYXXWYVALKRTGQYKXGXKTGPGQKAILFLPMSAKS
where each X represents a variable residue, and the options for each variable residue is listed in Table 1:

(37) TABLE-US-00004 TABLE 1 Variable residues for SEQ ID NO: 13 Position: May be: 1 present or absent, and, if present, may be M 2 present or absent, and, if present, may be A 3 present or absent, and, if present, may be A 4 present or absent, and, if present, may be M or G 5 present or absent, and, if present, may be A 6 present or absent, and, if present, may be A 7 present or absent, and, if present, may be G or S 8 present or absent, and, if present, may be S or G 9 present or absent, and, if present, may be I 10 present or absent, and, if present, may be T 11 present or absent, and, if present, may be T or S 12 L or M 14 A or S 16 P or S 17 E, D or G 21 present or absent, and, if present, may be S or G 22 present or absent, and, if present, may be G or S 23 present or absent, and, if present, may be G or A 48 H or N 56 V or I 63 H or N 64 I or V 82 C or S 86 Y or F 98 S or L 100 C or Y 101 V or A 103 E or D 125 S or T 126 S, D or N 139 L or P 141 S or P

(38) It is expected that administering a protein that includes an amino acid sequence according to SEQ ID NO: 13 would also enhance virus replication in permissive cells that expresses a receptor to FGF2 protein.

(39) One specific example of a human recombinant protein, which has been determined to enhance virus replication and, accordingly, may be used according to the present disclosure, is shown in SEQ ID NO: 14 (Accession: # P09038). The portion of the sequence corresponding to SEQ ID NO: 13 is shown in bold.

(40) TABLE-US-00005 (SEQIDNO:14) MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEA ALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLG DRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFK DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE ERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL FLPMSAKS

(41) As used herein, the term FGF2 protein includes any protein that includes a sequence according to any one of SEQ ID NOs: 2-13 and that is able to bind to a receptor for the FGF2 protein.

(42) As used herein, functional variants of FGF2 protein are proteins that include a sequence that is at least 90% identical to any one of SEQ ID NOs: 2-12 and that are able to bind to the FGF2 protein receptor. In some examples, the functional variant of FGF2 protein shares at least 95% sequence identity with any one of SEQ ID NOs: 2-12. In yet other examples, the functional variant of FGF2 protein shares at least 98% sequence identity with any one of SEQ ID NOs: 2-12. In particular examples, the functional variant of FGF2 protein shares at least 99% sequence identity with any one of SEQ ID NOs: 2-12.

(43) The percent identities between various exemplary sequences of FGF2 are shown in Table 2. FGF2 amino acid alignments for Homo sapiens (NCBI Reference Sequence: EAX05222.1), Pan troglodytes (NCBI Reference Sequence: NP 001103711.1), Mus musculus (NCBI Reference Sequence: NP 032032), Rat norvegicus (NCBI Reference Sequence: NP 062178.1), Ovis aries (NCBI Reference Sequence: NP 001009769.1), Bos taurus (NCBI Reference Sequence: NP 776481.1), and Gallus gallus (NCBI Reference Sequence: NP 990764.1) were performed using the compositional matrix adjustment method.

(44) TABLE-US-00006 TABLE 2 FGF2 protein alignment among multiple species Rat Gallus gallus Species norvegicus Homo sapiens Pan troglodytes Ovis aries Bos taurus (SEQ ID NO: 4) Mus musculus 98% 95% 95% 95% 95% 90% (SEQ ID NO: 3) (151/154) (147/155) (147/155) (147/155) (147/155) (139/154) Rat norvegicus 97% 97% 96% 97% 92% (SEQ ID NO: 8) (150/155) (150/155) (149/155) (150/155) (142/154) Homo sapiens 100% 98% 99% 92% (SEQ ID NO: 2) (155/155) (152/155) (154/155) (142/154) Pan troglodytes 98% 99% 92% (152/155) (154/155) (142/154) Ovis aries 99% 93% (SEQ ID NO: 6) (154/155) (143/154) Bos Taurus 94% (SEQ ID NO: 7) (144/154)

(45) The variant peptide sequences may include conservative or non-conservative amino acid substitutions. Conservative amino acid substitutions refer to the interchangeability of residues having functionally similar side chains. Conservative substitution tables providing functionally similar amino acids are well known in the art. Table 3 sets forth examples of six groups containing amino acids that are conservative substitutions for one another. Other conservative substitution charts are available in the art, and can be used in a similar manner.

(46) TABLE-US-00007 TABLE 3 Conservative Substitution Chart Conservative Substitution Groups 1 Alanine (A), Serine (S), Threonine (T) 2 Aspartic Acid (D), Glutamic Acid (E) 3 Asparagine (N), Glutamine (Q) 4 Arginine (R), Lysine (K) 5 Isoleucine (I), Leucine (L), Methionine (M), Valine (V) 6 Phenylalanine (F), Tyrosine (Y), Tryptophan (W)

(47) Enhanced virus replication when the FGF2 protein or functional variant thereof is administered to the permissive cells should be understood to refer to: (a) the production of a greater number of virus particles by the permissive cells in a given time, (b) an increase in rate of production of virus particles by the permissive cells at a given time, (c) a reduced multiplicity of infection (MOI) needed to produce the same number of virus particles, (d) a reduced MOI needed to produce virus particles at the same rate, or (e) any combination thereof, when compared to identical growth conditions without the FGF2 protein or functional variant thereof being administered to the permissive cell.

(48) For example, enhanced virus replication is seen when 786-0 cells are untreated or pretreated with 20 ng/mL of FGF2 for 24 hours before infection with vesicular stomatitis virus 51 (VSV51) at a MOI of 0.01. After 48 hours, cell associated supernatants indicated that the untreated control contained about 1E5 plaque forming units/mL (pfu/mL), while the permissive cells administered FGF2 protein showed enhanced virus replication since about 5E6 pfu/mL were measured.

(49) In another example, enhanced virus replication is seen in the increased rate of production of viral particles when 786-0 cells are pre-treated with 20 ng/ml of FGF2 protein 24 hours before infection with vesicular stomatitis virus 51 (VSV51) at a MOI of 0.01 and the number of infectious virus particles released by the cells is measured at various time points. After 6 hours, cell associated supernatants indicated that both untreated and FGF2 treated cells contained about 1E2 pfu/ml. After 24 hours, cell associated supernatants indicated that untreated control contained about 1e4 pfu/ml while the 786-0 cells administered FGF2 protein showed enhanced rate of virus replication since about 1e6 pfu/mL were measured. As illustrated in FIG. 2, the rate of production of VSV51 is increased in FGF2-treated 786-0 cells when compared to untreated 786-0 cells.

(50) In a further example, enhanced virus replication is seen when 786-0 cells are untreated or pretreated with 20 ng/mL of FGF2 for 24 hours before infection with vesicular stomatitis virus 51 (VSV51) at a MOI of 0.01 or 0.1. After 24 hours, cell associated supernatants indicated that the untreated control infection at a MOI of 0.1 contained about 1e4 plaque forming units/mL (pfu/mL), while the 786-0 cells administered FGF2 protein and infected with 10 fold less virus (MOI of 0.01) contained about 1e5 pfu/mL.

(51) A permissive cell or permissive host is a term of art that refers to cells or hosts that supports replication of viruses, irrespective of their efficiency to do so. In particular examples, permissive cells have receptors for the virus and an aberrant anti-viral response or an anti-viral response of reduced effectiveness. An anti-viral response of reduced effectiveness may refer to, for example, a lower or a delayed anti-viral response when compared to cells that do not support replication of viruses. One may readily determine whether a cell is permissive with respect to a virus by, for example, administering the virus to the cell and measuring the number of plaque forming units per mL of cell-associated supernatant. In some examples, the cell is considered a permissive cell with respect to that virus if there is greater than 1e4 pfu/mL.

(52) The permissive cells may be, for example, cancer cells, such as adenocarcinoma cells, pancreatic carcinoma cells, ovarian carcinoma cells, renal carcinoma cells, or colon carcinoma cells. Alternatively, the permissive cells may be activated fibroblast cells, such as activated human fetal fibroblast cells or cancer-associated fibroblast cells. Examples of activated human fetal fibroblast cells include WI38 and MRC5 cell.

(53) The virus may be, for example: an oncolytic virus; a live attenuated virus, for example a virus used for live attenuated virus vaccines; or a non-attenuated virus. Examples of viruses that may be used according to the present disclosure include: rhabdovirus (such as vesicular stomatitis virus, VSV51, VSV IFN-, maraba virus or MG1 virus), vaccinia virus, herpes simplex virus-1, reovirus, measles, Modified Vaccinia Ankara virus, Newcastle Disease virus, influenza virus, West Nile virus, dengue virus, HIV, rabies virus, hepatitis virus, or poliovirus.

(54) Vesicular stomatitis virus (VSV) is a member of the Rhabdovirus family and is classified in the Vesiculovirus Genus. VSV has been shown to be a potent oncolytic virus capable of inducing cytotoxicity in many types of human tumour cells in vitro and in vivo (WO 2001/19380).

(55) VSV51 is an engineered attenuated mutant of the natural wild-type isolate of VSV. The 51 mutation renders the virus sensitive to IFN signaling via a mutation of the Matrix (M) protein. An exemplary VSV51 is described in WO 2004/085658, which is incorporated herein by reference.

(56) VSV IFN- is an engineered VSV that includes a polynucleotide sequence encoding interferon-. An exemplary VSV that encodes interferon- is described in Jenks N, et al. Safety studies on intrahepatic or intratumoral injection of oncolytic vesicular stomatitis virus expressing interferon-beta in rodents and nonhuman primates. Hum Gene Ther. April 2010; 21(4):451-62, which is incorporated herein by reference.

(57) Maraba is another member of the Rhabdovirus family and is also classified in the Vesiculovirus Genus. Wild type-Maraba virus has also been shown to have a potent oncolytic effect on tumour cells in vitro and in vivo (WO 2009/016433).

(58) MG1 virus is an engineered maraba virus that includes a polynucleotide sequence encoding a mutated matrix (M) protein, a polynucleotide sequence encoding a mutated G protein, or both. An exemplary MG1 virus that encodes a mutated M protein and a mutated G protein is described in WO/2011/070440, which is incorporated herein by reference. This MG1 virus is attenuated in normal cells but hypervirulent in cancer cells.

(59) The permissive cells may be cultured cells. Administering the FGF2 protein or functional variant thereof to the permissive cells may include adding to the cell culture a composition that includes the FGF2 protein, or functional variant thereof, and a carrier or diluent. The FGF2 protein or functional variant thereof may be administered to the permissive cells before, after, at the same time, or any combination thereof, that the virus is administered to the permissive cells. When administered to permissive cells that are grown in cell culture, it is desirable to administer the FGF2 protein or functional variant thereof at a concentration greater than or equal to 1 ng/mL. In particular examples, the FGF2 protein or functional variant thereof is administered at a concentration of between 5 ng/mL and 100 ng/mL. In specific examples, the FGF2 protein or functional variant thereof is administered at a concentration of between 20 ng/mL and 50 ng/mL, though higher concentrations would also be expected to result in enhanced virus replication.

(60) Alternatively, or in addition, administering the FGF2 protein of the functional variant thereof to the permissive cells may include adding to the cell culture an oncolytic virus having a genome comprising an open reading frame that encodes the FGF2 protein or functional variant thereof. Permissive cells infected with the virus would produce the FGF2 protein or functional variant thereof. When administered to permissive cells that are grown in cell culture, it is desirable to administer the oncolytic virus at an MOI of at least 0.0005. In particular examples, the cells are more resistant to viral infection and the oncolytic virus is administered at an MOI greater than 0.001. In specific examples, the oncolytic virus is administered at an MOI between 0.01 and 0.1, though higher MOIs would also be expected to result in enhanced virus replication.

(61) The permissive cells may be cancer cells or tumor microenvironment cells in an animal, such as a human being. Administering the FGF2 protein or functional variant thereof and the virus to the permissive cells may include administering an oncolytic virus having a genome comprising an open reading frame that encodes the FGF2 protein or functional variant thereof. Permissive cells infected with the virus would produce the FGF2 protein or functional variant thereof.

(62) When administered to permissive cells that are cancer cells or tumor microenvironment cells in an animal, the amount of oncolytic virus administered to the animal may depend on the oncolytic virus being administered, the mode of administration, the size of the animal. For example, the effective dose for vaccinia virus is about 1e9 pfu/human; and the effective dose of a rhabdovirus about 1e11 pfu/human. It may be desirable to administer the oncolytic virus at quantity of a least 1e5 per animal. In particular examples, the oncolytic virus, and other virus of administered, is administered at a quantity between 1e7 and 1e13 pfu/human, though higher pfu's would also be expected to result in enhanced virus replication.

(63) The methods described herein may also include administering to the permissive cells a Type 1 interferon (IFN) scavenger, such as a soluble protein that binds IFN. One example of an IFN scavenger is the vaccinia virus B18R protein or functional variant thereof. In one example, the B18R protein has the following amino acid sequence, which corresponds to the B18R protein from the Western Reserve strain of vaccinia virus (NCBI Reference Seauence: YP_233082.1):

(64) TABLE-US-00008 (SEQIDNO:15) MTMKMMVHIYFVSLLLLLFHSYAIDIENEITEFFNKMRDT LPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSL LSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTS KFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYEL GTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYS QTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCK ILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLL IDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFE NVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

(65) In another example, the B18R protein has the following amino acid sequence, which corresponds to the B18R protein from the Copenhagen strain of vaccinia virus (GenBank Accession No: AAA48218.1) and:

(66) TABLE-US-00009 (SEQIDNO:16) MTMKMMVHIYFVSLSLLLLLFHSYAIDIENEITEFFNKMR DTLPAKDSKWLNPACMFGGTMNDMATLGEPFSAKCPPIED SLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANY TSKFSNRRYLCTVTTKNGDCVQGIVRSHIKKPPSCIPKTY ELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIK YSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSR CKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTS LLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLY FENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

(67) In yet another example, the B18R protein has the following amino acid sequence, which corresponds to the B18R protein from the Wyeth strain of vaccinia virus (GenBank Accession No: AAR18044.1):

(68) TABLE-US-00010 (SEQIDNO:17) MTMKMMVHIYFVSLSLLLLLFHSYAIDIENEITEFFNKMR DTLPAKDSKWLNPACMFGGTMNDMATLGEPFSAKCPPIED SLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANY TSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTY ELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIK YSQTGKKLIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSR CKILTVIPSQDHRFKLKRNCGYASN

(69) The B18R protein according to SEQ ID NO: 15 may be encoded by the following nucleotide sequence:

(70) TABLE-US-00011 (SEQIDNO:18) atgacgatgaaaatgatggtacatatatatttcgtatcat tattgttattgctattccacagttacgccatagacatcga aaatgaaatcacagaattcttcaataaaatgagagatact ctaccagctaaagactctaaatggttgaatccagcatgta tgttcggaggcacaatgaatgatatagccgctctaggaga gccattcagcgcaaagtgtcctcctattgaagacagtctt ttatcgcacagatataaagactatgtggttaaatgggaaa ggctagaaaaaaatagacggcgacaggtttctaataaacg tgttaaacatggtgatttatggatagccaactatacatct aaattcagtaaccgtaggtatttgtgcaccgtaactacaa agaatggtgactgtgttcagggtatagttagatctcatat tagaaaacctccttcatgcattccaaaaacatatgaacta ggtactcatgataagtatggcatagacttatactgtggaa ttctttacgcaaaacattataataatataacttggtataa agataataaggaaattaatatcgacgacattaagtattca caaacgggaaaggaattaattattcataatccagagttag aagatagcggaagatacgactgttacgttcattacgacga cgttagaatcaagaatgatatcgtagtatcaagatgtaaa atacttacggttataccgtcacaagaccacaggtttaaac taatactagatccaaaaatcaacgtaacgataggagaacc tgccaatataacatgcactgctgtgtcaacgtcattattg attgacgatgtactgattgaatgggaaaatccatccggat ggcttataggattcgattttgatgtatactctgttttaac tagtagaggcggtattaccgaggcgaccttgtactttgaa aatgttactgaagaatatataggtaatacatataaatgtc gtggacacaactattattttgaaaaaacccttacaactac agtagtattggagtaa.

(71) The B18R protein according to SEQ ID NO: 16 may be encoded by the following nucleotide sequence:

(72) TABLE-US-00012 (SEQIDNO:19) atgacgatgaaaatgatggtacatatatatttcgtatcat tatcattattgttattgctattccacagttacgccataga catcgaaaatgaaatcacagaattcttcaataaaatgaga gatactctaccagctaaagactctaaatggttgaatccag catgtatgttcggaggcacaatgaatgatatggccactct aggagagccattcagtgcaaagtgtcctcctattgaagac agtcttttatcgcacagatataaagactatgtggttaaat gggagaggctagaaaagaatagacggcgacaggtttctaa taaacgtgttaaacatggtgatttatggatagccaactat acatctaaattcagtaaccgtaggtatttgtgcaccgtaa ctacaaagaatggtgactgtgttcagggtatagttagatc tcatattaaaaaacctccttcatgcattccaaaaacatat gaactaggtactcatgataagtatggcatagacttatact gtggaattctttacgcaaaacattataataatataacttg gtataaagataataaggaaattaatatcgacgacattaag tattcacaaacgggaaaggaattaattattcataatccag agttagaagatagcggaagatacgactgttacgttcatta cgacgacgttagaatcaagaatgatatcgtagtatcaaga tgtaaaatacttacggttataccgtcacaagaccacaggt ttaaactaatactagatccgaaaatcaacgtaacgatagg agaacctgccaatataacatgcactgctgtgtcaacgtca ttattgattgacgatgtactgattgaatgggaaaatccat ccggatggcttataggattcgattttgatgtatactctgt tttaactagtagaggcggtatcaccgaggcgaccttgtac tttgaaaatgttactgaagaatatataggtaatacatata aatgtcgtggacacaactattattttgaaaaaacccttac aactacagtagtattggagtaa.

(73) The B18R protein according to SEQ ID NO: 17 may be encoded by the following nucleotide sequence:

(74) TABLE-US-00013 (SEQIDNO:20) atgacgatgaaaatgatggtacatatatatttcgtatcat tatcattattgttattgctattccacagttacgccataga catcgaaaatgaaatcacagaattcttcaataaaatgaga gatactctaccagctaaagactctaaatggttgaatccag catgtatgttcggaggcacaatgaatgatatagccgctct aggagagccattcagcgcaaagtgtcctcctattgaagac agtcttttatcgcacagatataaagactatgtggttaaat gggaaaggctagaaaagaatagacggcgacaggtttctaa taaacgtgttaaacatggtgatttatggatagccaactat acatctaaattcagtaaccgtaggtatttgtgcaccgtaa ctacaaagaatggtgactgtgttcagggtatagttagatc tcatattagaaaacctccttcatgcattccaaaaacatat gaactaggtactcatgataagtatggcatagacttatact gtggaattctttacgcaaaacattataataatataacttg gtataaagataataaggaaattaatatcgacgatattaag tattcacaaacgggaaagaaattaattattcataatccag agttagaagatagcggaagatacgactgttacgttcatta cgacgacgttagaatcaagaatgatatcgtagtatcaaga tgtaaaatacttacggttttaccgtcacaagaccacaggt ttaaactaaaaagaaattgcggatatgcgtcaaattaa.

(75) The IFN scavenger may be administered separately from the FGF2 protein or functional variant thereof, or may be administered at the same time as the FGF2 protein or functional variant thereof. One example of administration at the same time is administration of an oncolytic virus that expresses the IFN scavenger together with the FGF2 protein or functional variant thereof.

(76) The present disclosure also provides an isolated oncolytic virus particle having a genome comprising an open reading frame that encodes FGF2 protein or a functional variant thereof.

(77) The sequence of the FGF2 protein may include an amino acid sequence according to any one of SEQ ID NOs: 2-13. The sequence of the functional variant of the FGF2 protein may, in some examples, include an amino acid sequence that is at least 90% identical to any one of the sequences of SEQ ID NO: 2-12. In particular examples, the sequence of the functional variant of the FGF2 protein may include an amino acid sequence that is at least 95% identical to any one of the sequences of SEQ ID NO: 2-12. In other examples, the sequence of the functional variant of the FGF2 protein may include an amino acid sequence that is at least 98% identical to any one of the sequences of SEQ ID NO: 2-12. In still other examples, the sequence of the functional variant of the FGF2 protein may include an amino acid sequence that is at least 99% identical to any one of the sequences of SEQ ID NO: 2-12.

(78) In particular examples, the oncolytic virus particle has a genome that includes an open reading frame that encodes a protein having an amino acid sequence of at least one of SEQ ID NOs: 2-13.

(79) The FGF2 protein or functional variant thereof may be modified to further include an amino acid sequence of an immunoglobulin signal peptide, such as a peptide that includes the sequence of SEQ ID NO: 1.

(80) The genome of the isolated oncolytic virus may additionally include an open reading frame that encodes an IFN scavenger, such as B18R protein. In particular examples, the B18R protein includes an amino acid sequence according to SEQ ID NO: 15, 16 or 17. The B18R protein may be encoded by, and therefore the genome of the oncolytic virus may include, a DNA sequence according to SEQ ID NO: 18, 19 or 20.

(81) The isolated oncolytic virus particle may be, for example: rhabdovirus (such as vesicular stomatitis virus, VSV51, VSV IFN-, maraba virus or MG1 virus), vaccinia virus, or herpes simplex virus-1.

EXAMPLES

(82) MethodsPlaque Assay

(83) Virus titers were determined from 10.sup.1 to 10.sup.6 dilutions of cell-associated supernatants seeded onto confluent monolayers of Vero cells (Kidney African Green Monkey). At 1 hour post-infection, supernatants were removed and cells were overlayed with 1:1 ratio of 1% agarose:2DMEM+20% FBS. After 24 hours, cells were fixed for 45 minutes with 3:1 methanol-acetic acid solution. Then, overlayers were removed and fixed cells were stained with 0.2% crystal violet in 20% methanol. Plaques were counted, averaged and multiplied by the dilution factor to determine virus titer as pfu/ml.

Example 1. Enhanced Virus Replication with FGF2 Protein in Different Permissive Cells Lines

(84) Single doses of recombinant human fibroblast growth factor 1 (FGF1): 20 ng/mL and recombinant human FGF2: 20 ng/mL were administered to 786-0 cells (human renal-carcinoma), OVCAR8 cells (human ovarian carcinoma), and WI38 cells (human fetal lung fibroblasts) grown in Dubelco's Modified Eagle Medium (DMEM) containing 2-5% fetal bovine serum and 10 mM Hepes for 24 hours before virus infection. WI38 cells are activated fibroblasts, and a human diploid cell line derived from normal embryonic (3 months gestation) lung tissue.

(85) Single doses of mouse FGF1: 20 ng/mL and mouse FGF2: 20 ng/mL were added to wild-type CT26 cells (mouse colon carcinoma) 24 hours before virus infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. The amino acid sequence of the recombinant mouse FGF2 protein that was used is shown in SEQ ID NO: 11. Single doses of human FGF1 (20 ng/mL) and FGF2 (20 ng/mL) were also administered to GM38 cells (human normal lung fibroblasts) 24 hours before virus infection. As controls, untreated infected cells were also included for each cell line tested.

(86) FGF1/FGF2 treated or untreated cells were infected with VSV51 virus at an MOI (multiplicity of infection) of 0.01. After 24 hours, cell associated supernatants were collected and the number of infectious virus particles were quantified by plaque assay.

(87) FIG. 1 shows the results for untreated, FGF1-treated, and FGF2-treated VSV51-infected cells. The total number of plaque forming units (PFU)/mL obtained from FGF2-treated cells was at least 15 fold higher that untreated or FGF1-treated cells (786-0, OVCAR8, WI38, and CT26). In contrast, administration of FGF2 did not significantly affect virus replication in normal GM38 fibroblasts, which would not be considered to be permissive cells.

Example 2. Enhanced Virus Replication with FGF2 Protein Over Time

(88) Virus multi-step growth curves were generated in 786-0 cells pre-treated with single doses of human FGF1 (20 ng/ml) or human FGF2 (20 ng/ml). The amino acid sequence of the human FGF2 protein that was used is shown in SEQ ID NO: 9. Untreated infected cells were also included as negative control. After 24 hours, FGF1/FGF2 treated or untreated cells were infected with VSV51 virus at an MOI of 0.01.

(89) Cell associated supernatants containing released virions were collected at various time points (0, 6, 12, 24, 36, 48, and 66 hours post-infection) and the number of infectious virus particles were quantified by plaque assay. FIG. 2 shows the amount of plaque forming units released from untreated, FGF1-treated, and FGF2-treated cells over time.

Example 3. Enhanced Virus Replication at Varying Multiplicities of Infection

(90) A single dose of 20 ng/mL human FGF2 protein was administered to 786-0 cells 24 hours prior to virus infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. Control cells were left untreated, or were treated with 20 ng/ml of human FGF1. VSV51 was administered to the cells at MOIs of either 0.1 or 0.01.

(91) After 24 hours, cell associated supernatants were collected and the number of infectious virus particles were quantified by plaque assay. FIG. 3 shows that FGF2-enhancement of virus replication is independent of the MOIs used and takes place at MOIs as low as 0.01.

Example 4. Dose-Dependent Enhanced Virus Replication

(92) Varying amounts of FGF2 protein were administered to 786-0 cells 24 hours before infection with VSV51 at an MOI of 0.01, resulting in the permissive cells being exposed to FGF2 protein in a range from 20 ng/ml to 500 ng/ml. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9.

(93) After 24 hours, cell associated supernatants were collected and the number of infectious virus particles were quantified by plaque assay. FIG. 4 shows that enhanced VSV51 replication is seen at FGF2 concentrations as low as 20 ng/ml.

Example 5. Reduction of Enhanced Virus Replication with FGF Receptor 1 Inhibitor

(94) A single dose of FGF2 recombinant protein (20 ng/ml) and either 50 or 250 nM of FGF Receptor 1 inhibitor (PD173074) were co-administered to 786-0 cells 24 hours prior to virus infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. Control cells were left untreated, FGF2-treated, or FGF receptor inhibitor-treated. Untreated or treated cells were infected with VSV51 at MOI of 0.01.

(95) After 24 hours, cell associated supernatants were collected and the number of infectious virus particles were quantified by plaque assay. FIG. 5 shows that FGF Receptor 1 inhibitor (PD173074) reduces FGF2-induced enhancement of virus replication in 786-0 cells.

Example 6. FGF2 Overcomes Antiviral Responses

(96) FGF2 protein was administered to 786-0 cells at 20 ng/ml for 24 hours prior to infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. Controls included FGF1 (20 ng/mL)-treated or untreated cells. The following day increasing amounts of Intron A (IFN-), ranging from 0 to 50 U/ml, were added to the cells. Four hours post-Intron A administration, cells were infected with VSV51 (MOI: 0.01).

(97) After 24 hours, cell associated supernatants were collected and the number of infectious virus particles were quantified by plaque assay. FIG. 6 shows that even in the presence of Intron A, FGF2-treated cells exhibit higher virus titers (10 fold) compared to control (untreated and FGF1-treated) cells.

Example 7. Enhanced Virus Replication with Different Viruses

(98) Human FGF2 recombinant protein (20 ng/ml) was administered to 786-0 cells 24 hours prior to infection of the cells with various viruses. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. Untreated cells were used as controls during these experiments. VSV (MOI: 0.01), VSV51 (MOI: 0.01), MG1 (MOI: 0.01), JX594-GFP (VV-MOI: 0.01), Reovirus (REOV-MOI: 0.1), or HSV-1 (MOI: 0.05) was administered to the FGF2-treated or untreated cells.

(99) JX594 is a vaccinia poxvirus engineered by addition of the GM-CSF gene and deletion of the thymidine kinase gene, which limits viral replication to cells with high levels of thymidine kinase. JX594-GFP is a JX594 virus that encodes the green fluorescent protein as a reporter gene. MG1 virus is a double mutant strain of Maraba virus containing both G protein (Q242R) and M protein (L123W) mutations. VSV51 is a mutant strain of VSV containing a deletion of amino acid 51 of its M protein.

(100) After 24 hours, cell associated supernatants from cells infected with VSV, VSV51, and MG1 were collected and the number of infectious virus particles was quantified by plaque assay. In the case of cells infected with JX594-GFP, REOV, or HSV-1, cells and cell-associated supernatants were collected at 48 hours post-infection, and infectious virus particles were titrated by plaque assay.

(101) Titration of HSV-1 encoding GFP was performed following the end-point dilution method (TCTD.sub.50). Samples were serially diluted from 10.sup.1 to 10.sup.10 and inoculated onto confluent monolayers of Vero cells grown in 96 well plates. Samples were titrated in triplicate. Virus-induced cytopatic effect (CPE) was scored 48 hours after infection and the titer was calculated by determining the last dilution giving 50% of wells with cells displaying a CPE.

(102) Titration of REOV was performed in L929 cells (murine fibrosarcoma cell line110.sup.6) that were infected with serial dilutions of virus-containing samples in 35 mm dishes for 3 hours. Cells were then washed and overlaid with warm 1% (w/v) agar in culture medium and incubated for 3 days. Viral plaques were visualized by adding neutral red to 0.01% (w/v) final concentration.

(103) To titrate JX-594-GFP, 10-fold serial virus dilutions ranging from 10.sup.2 to 10.sup.7 were prepared and inoculated onto confluent monolayers of U2OS cells (Human osteosarcoma cell line). After 2 hours incubation at 37 C., inoculum was removed and cells were overlayed with 1:1 ratio of 3% carboxymethylcellulose:2DMEM+20% FBS. After 72 hours, cells were fixed and stained for 30 minutes with 0.1% crystal violet in 20% methanol. Plaques were counted, averaged and multiplied by the dilution factor to determine virus titer as pfu/ml.

(104) FIG. 7 shows the results for 786-0 cells treated with FGF2 and subsequently infected with VSV, VSV51, MG1, JX594-GFP, REOV, or HSV-1. Pre-treatment of cells with FGF2 resulted in enhanced virus replication for all the tested viruses.

Example 8. Enhanced Virus Replication Ex Vivo

(105) 786-0 or MiaPaca tumors were generated in severe combined immunodeficiency (SCID) mice. The tumors were harvested and processed for ex vivo infection as described in Diallo, J., Roy, D., Abdelbary, H., De Silva, N., Bell, J. C. Ex Vivo Infection of Live Tissue with Oncolytic Viruses. J. Vis. Exp. (52), e2854, doi:10.3791/2854 (2011).

(106) Human FGF2 protein (100 ng/ml) was added to the tumors 24 hours before virus administration. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. Control tissues were treated with 100 ng/ml of human FGF1 or left untreated. The tissues were infected with 1e5 pfu of VSV51-expressing GFP. After 48 hours, tissue-associated supernatants were harvested and released virus was titrated by plaque assay.

(107) FIG. 8 shows virus titers for 786-0 tumors that were untreated, FGF1-treated, or FGF2-treated, and infected with VSV51 ex vivo. FIG. 9 shows virus titers for MiaPaca tumors that were untreated, FGF1-treated, or FGF2-treated, and infected with VSV51 ex vivo. These figures show an enhancement of ex vivo virus production in tumors pre-treated with FGF2. Representative fluorescent pictures of the tumors show increased ex-vivo virus infection and transgene protein expression (GFP) in tumors pre-treated with FGF2.

Example 9. Enhanced Virus Replication In-Vivo

(108) FGF2 protein was administered to severe combined immunodeficiency (SCID) mice bearing MiaPaca, OVCAR8, or 786-0 subcutaneous tumors by intratumoral injection of 3 g of human FGF2 protein at 24 hours and at 4 hours before intravenous injection of 1e7 pfu/injection of VSV51. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. PBS was injected as a negative control.

(109) FIG. 10 shows titers of VSV51 virus in MiaPaca tumors measured 72 hours post-virus administration by homogenizing the tumors and performing a plaque assay. FIG. 11 shows the VSV51 titration for OVCAR8 tumor, and FIG. 12 shows VSV51 titration for 786-0 tumors. In all cases, injection of FGF2 resulted in enhanced virus replication in in-vivo tumors.

Example 10. Enhanced Virus Replication with Addition of B18R

(110) Recombinant FGF2 protein (20 ng/ml) and B18R (100 ng/ml) protein were co-administered to 786-0 cells and WI38 cells 24 hours and 4 hours before infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. The amino acid sequence of the B18R protein was as shown in SEQ ID NO: 15. Controls cells were untreated, single-B18R, or single-FGF2 treated. VSV51 (MOI 0.005) was administered to the treated cells.

(111) Twenty-four hours post infection, cell-associated supernatants were collected and the number of infectious virus particles was quantified by plaque assay (FIG. 13) and by GFP fluorescence (FIG. 14). As illustrated in FIGS. 13 and 14, titration results obtained from both 786-0 cells and WI38 fibroblasts show that addition of B18R to FGF2-treated cells further enhances VSV51 virus replication in comparison to the virus-only control, and to the single protein treatment controls.

(112) Recombinant FGF2 protein (20 ng/ml) and B18R (100 ng/ml) protein were co-administered to 786-0 cells 24 hours and 4 hours before infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. The amino acid sequence of the B18R protein was as shown in SEQ ID NO: 15. Controls cells were untreated, single-B18R, or single-FGF2 treated. Rhabdovirus MG1-eGFP (MOI 0.001) was administered to the treated cells.

(113) Forty-eight hours post infection, GFP pictures were taken and GFP fluorescence was quantified. As illustrated in FIG. 15 fluorescence quantification results show that addition of B18R to FGF2-treated cells further enhances MG1 virus replication in comparison to virus only control or either single protein treatment controls.

(114) Recombinant FGF2 protein (20 ng/ml) and B18R (100 ng/ml) protein were co-administered to 786-0 cells and MRC5 cells 24 hours and 4 hours before infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. The amino acid sequence of the B18R protein was as shown in SEQ ID NO: 15. Controls cells were untreated, single-B18R, or single-FGF2 treated. Herpes simple virus (HSV) N212 expressing eGFP (MOI 0.005 for MRC5 cells, MOI 0.01 for 786-0 cells) was administered to the treated cells.

(115) Forty-eight hours post infection, GFP fluorescence was quantified, cell-associated supernatants were collected and the number of infectious virus particles was quantified by plaque assay. As illustrated in FIGS. 16 and 17, titration results obtained from MRC-5 cells (FIG. 16) and relative fluorescent quantification obtained from 786-0 (FIG. 17) show that addition of B18R to FGF2-treated cells further enhances herpes simplex virus replication in comparison to virus only control or either single protein treatment controls.

(116) Recombinant FGF2 protein (20 ng/ml) and B18R (100 ng/ml) protein were co-administered to 786-0 cells 24 hours and 4 hours before infection. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9. The amino acid sequence of the B18R protein was as shown in SEQ ID NO: 15. Controls cells were untreated, single-B18R, or single-FGF2 treated. Poxvirus Wyeth thymidine kinase knock-out and expressing eGFP (MOI 0.001) was administered to the treated cells.

(117) Forty-eight hours post infection, GFP fluorescence was quantified. As illustrated in FIG. 18, fluorescence quantification results obtained in 786-0 cells show that addition of B18R to FGF2-treated cells further enhances Poxvirus replication in comparison to virus only control or either single protein treatment controls.

Example 11. Enhanced Virus Replication in Permissive Human Cells Using Mouse FGF2

(118) Mouse FGF2 recombinant protein (20 ng/ml) was administered to 786-0 cells 24 hours prior to infection of the cells with JX594 expressing GFP (MOI: 0.01). Untreated/uninfected cells, and untreated/infected cells, were used as control. After 36 hours of infection, pictures of the cells were taken using a fluorescent microscope.

(119) The relative pixel intensity of GFP expression in uninfected cells (background control), and JX594-GFP infected cells with and without mouse FGF2 protein pre-treatment was calculated using ImageJ software and results are summarized in Table 4. The amino acid sequence of the recombinant murine FGF2 protein that was used is shown in SEQ ID NO: 11. Pre-treatment of human cells with mFGF2 enhances virus replication as denoted by the increase in average relative GFP fluorescent intensity.

(120) TABLE-US-00014 TABLE 4 Average of pixel Relative pixel intensity Condition intensity* increase Untreated/Uninfected 5.70 1.00 Untreated/JX594-GFP 13.35 2.34 mFGF2/JX594-GFP 24.90 4.37

Example 12. Enhance Viral Replication with Recombinant Oncolytic Virus Expressing FGF2 Protein

(121) A recombinant MG1 expressing FGF2 protein was cloned and rescued as described previously (European Patent No. 2 064 229 A2, and Identification of Genetically Modified Maraba Virus as an Oncolytic Rhabdovirus. Brun et al, Mol. Ther. 2010) with the following modifications: FGF2 open reading frame (GenBank: M17599.1) was cloned at the gene junction between the G and the L protein into a modified LC-Kan vector encoding the viral complementary DNA sequence. To rescue MG1-FGF2 virus, A549 lung carcinoma cells were plated at 3.010.sup.5 cells/well in 6-well plates and were infected 24 hours later with vaccinia virus (MOI=10) expressing the T7 RNA polymerase. After 1.5 hour, vaccinia virus was removed and cells were co-transfected with LC-KAN Maraba encoding FGF2 (2 g), and pCl-Neo constructs encoding Maraba N (1 g), P (1.25 g), and L (0.25 g) genes using lipofectamine 2000 (5 l per well) as per manufacturer's instructions. After 24 hours, medium was replaced with DMEM containing 10% fetal bovine serum. Forty-eight hours post-transfection, medium was collected, filtered (0.2 m), and 1 ml was used to infect Vero cells. Recombinant virus underwent two rounds of plaque purification (on Vero cells), and was then scaled up, and titrated for further use.

(122) 786-0, PANC1 and OVCAR8 cells were infected with MG1 (MOI 0.01) or the recombinant MG1 expressing FGF2 protein (MOI 0.01) for 36 hours. Production of infectious virus particles was quantified by plaque assay in Vero cells. The sequence of the FGF2 expressed by the recombinant MG1 included the sequence of SEQ ID NO: 9. Bright field images were taken 20 hours after infection.

(123) FIG. 19 shows images of 786-0 cells that were (A) untreated, (B) treated with MG1, or (C) treated with MG1-FGF2. Treatment with the recombinant MG1-FGF2 virus that expresses FGF2 protein shows increased cell death when compared to the control cells.

(124) FIG. 20 shows graphs of virus titers from MG1 or MG1-FGF2 infected cells. 786-0, PANC1, OVCAR8 cells were infected with MG1 (MOI 0.01) or MG1-FGF2 (MOI 0.01) for 36 hours, and then production of infectious virus particles was quantified by plaque assay in Vero cells. Recombinant MG1-FGF2 virus that expresses FGF2 protein shows increased virus production when compared to the MG1 virus.

Example 13. Enhanced Viral Replication with Influenza Virus in MRC5 Cells Treated with FGF2

(125) MRC5 cells were treated with 100 ng/ml FGF2, 100 ng/ml leptin, or mock treated, in serum free media. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9.

(126) 48 hours later, cells were infected with the human H1N1 Influenza A strain FM/1/47 at MOI 0.05 or 0.1, as indicated, in the presence of 1 g/ml TPCK trypsin. 48 h (MOI 0.1) or 72 h (MOI 0.05) later, supernatants from triplicate wells were collected and pooled. Viral titers were obtained by ELISA for Influenza A nucleoprotein. The resulting titers are illustrated in FIG. 21.

Example 14. Enhanced Viral Replication with Measles Virus in WI38 Cells Treated with FGF2

(127) WI38 cells were treated with 100 ng/ml FGF2, or mock treated, in serum free media. The amino acid sequence of the recombinant human FGF2 protein that was used is shown in SEQ ID NO: 9.

(128) 24 hours later, cells were infected with Measles virus (Edmonston strain) at an MOI 0.1. 48 hours later, supernatants were collected and virus titration was performed by plaque assay in Vero cells. The resulting titers are illustrated in FIG. 22.

Example 15. FGF2 is Effective Across Species

(129) Recombinant human FGF2 protein (20 ng/ml) or murine FGF2 (20 ng/ml) protein were administered to MC38 cells (Mouse colon carcinoma) 24 hours before infection. The amino acid sequence of the recombinant human FGF2 protein was as shown in SEQ ID NO: 9. The amino acid sequence of the murine FGF2 protein was as shown in SEQ ID NO: 11. Controls cells were left untreated.

(130) VSV51 (MOI 0.1) was administered to the cells. Forty-eight hours post infection, cell-associated supernatants were collected and the number of infectious virus particles was quantified by plaque assay. As illustrated in Table 5, titration results obtained from MC38 cells show that addition of either human or murine FGF2 enhances virus replication in mouse cells. The data shown are averages of 3 independent experiments and their standard deviations.

(131) TABLE-US-00015 TABLE 5 Human and murine FGF2 proteins administered to mouse cells murine FGF2 human FGF2 Untreated/ treated/ treated/ VSV51 infected VSV 51 infected VSV 51 infected Virus titre 2.93e6 1.6e5 8.20e6 1.1e6 7.73e6 9.8e5 (pfu/mL)

(132) A single dose of 20 ng/ml murine FGF2 protein was administered to human 768-0 cells 24 hours prior to virus infection. The amino acid sequence of the recombinant murine FGF2 protein was as shown in SEQ ID NO: 11. Control cells were left untreated.

(133) Vaccinia virus encoding the green fluorescent protein (GFP) was administered to the cells at an MOI of 0.01. After 48 hours, infected cells were visualized in a fluorescent microscope and pictures were taken. Average fluorescence pixel intensity associated with expression of GFP (a method to quantify virus replication) was quantified using ImageJ software.

(134) As illustrated in Table 6, fluorescence results show murine FGF2-enhancement of virus replication in a human cell line.

(135) TABLE-US-00016 TABLE 6 Murine FGF2 protein administered to human 786-0 cells Untreated/ Untreated/ mFGF2 treated/ Uninfected JX594-GFP infected JX594-GFP infected Average of 5.70 13.35 24.90 pixel intensity Relative pixel 1 2.34 4.37 intensity increase

(136) In the preceding description, for purposes of explanation, numerous details are set forth in order to provide a thorough understanding of the examples. However, it will be apparent to one skilled in the art that these specific details are not required. The above-described examples are intended to be exemplary only. Alterations, modifications and variations can be effected to the particular examples by those of skill in the art without departing from the scope, which is defined solely by the claims appended hereto.