METHOD OF INDUCING AN IMMUNE RESPONSE AGAINST HUMAN IMMUNODEFICIENCY VIRUS BY CO-LOCALIZED ADMINISTRATION OF VACCINE COMPONENTS

20200093917 ยท 2020-03-26

    Inventors

    Cpc classification

    International classification

    Abstract

    Methods of inducing an immune response against human immunodeficiency virus (HIV) are described. In particular, methods of inducing an immune response against HIV by co-locally administering an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV antigen, e.g., Env antigen are described. The isolated HIV Env polypeptide and adenovirus vector can be administered in a single composition or in separate compositions, in which the composition or compositions do not contain an adjuvant.

    Claims

    1. A method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject, the method comprising co-locally administering to the subject: a. an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide; and b. an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are co-locally administered in a single composition or in separate compositions, and wherein the composition or compositions do not comprise adjuvant.

    2. The method of claim 1, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are administered co-locally for boosting immunization after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen.

    3. The method of claim 1, wherein the adenovirus vector is an adenovirus 26 (rAd26) vector.

    4. The method of claim 1, further comprising administering an immunogenically effective amount of a second adenovirus vector encoding a second HIV Env antigen together with the immunogenically effective amount of the adenovirus vector.

    5. The method of claim 4, wherein the second adenovirus vector is an adenovirus 26 (rAd26) vector.

    6. The method of claim 1, wherein the co-localized administration is by intramuscular injection to a single muscle.

    7. A method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject, the method comprising co-locally administering to the subject: a. an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide; and b. an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are co-locally administered in a single composition or in separate compositions, and wherein the composition or compositions do not comprise adjuvant that is or comprises any one of aluminum phosphate, aluminum hydroxide, aluminum sulfate, aluminum oxide, calcium phosphate, liposomes, oil-in-water emulsion (e.g. MF59), water-in-oil emulsion, paraffin oil, toxoids, saponins or fractions thereof (e.g. Quil A, QS21, Matrix-M, Iscomatrix, and ISCOM), IL-1, IL-2, IL-12, MoGM-CSF, lipid A or analogs or derivatives thereof (e.g. monophosphoryl lipid A (MPL), 3-de-O-acylated MPL (3D-MPL), GLA, SLA, PHAD, RC529, etc), CpG, or imidazoquinolines (e.g. imiquimod, R848), or any combination thereof.

    8. The method of claim 7, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are administered co-locally for boosting immunization after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen.

    9. The method of claim 7, wherein the adenovirus vector is an adenovirus 26 (rAd26) vector.

    10. The method of claim 7, further comprising administering an immunogenically effective amount of a second adenovirus vector encoding a second HIV Env antigen together with the immunogenically effective amount of the adenovirus vector.

    11. The method of claim 10, wherein the second adenovirus vector is an adenovirus 26 (rAd26) vector.

    12. The method of claim 7, wherein the co-localized administration is by intramuscular injection to a single muscle.

    13. The method of claim 7, wherein the composition or compositions do not comprise any adjuvant.

    14. The method of claim 1, further comprising administering an immunogenically effective amount of one or more adenovirus vectors encoding further HIV antigens to which an immune response is induced in the subject.

    15. The method of claim 1, wherein the immune response comprises a T-helper 1 (Th1) biased immune response.

    16. The method of claim 7, further comprising administering an immunogenically effective amount of one or more adenovirus vectors encoding further HIV antigens to which an immune response is induced in the subject.

    17. The method of claim 7, wherein the immune response comprises a T-helper 1 (Th1) biased immune response.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0023] The foregoing summary, as well as the following detailed description of the invention, will be better understood when read in conjunction with the appended figures. It should be understood that the invention is not limited to the precise embodiments shown in the figures.

    [0024] FIG. 1 shows clade C gp140 ELISA titers in serum at day 56 of the study described in Example 1; experimental groups are indicated below the graph; squares and circles represent individual animals and lines show geometric mean titers; animals in alum+ same-site injection- (i.e., alum-positive, same-site injection-negative) group are indistinguishable from the alum same-site injection+ (i.e., alum-negative, same-site injection-positive) group with regards to the induction of a clade C gp140-specific antibody response; ULOQ=upper limit of quantification, LLOQ=lower limit of quantification, LOB=Limit of Blanc, n.s.=not significant;

    [0025] FIG. 2 shows clade C gp140 ELISA titers in serum at day 56 of the study described in Example 2 at two different dose levels of clade C gp140 recombinant protein; experimental groups are indicated below the graph; filled circles represent individual animals and lines show geometric mean titers; the black triangles indicate the different dose levels of clade C gp140 recombinant protein, with the high dose being 12.5 g and the low dose being 1.25 g; animals in alum same-site injection+ (i.e., alum-negative, same-site injection-positive) group show increased clade C gp140 ELISA titers compared to that of animals in alum+ same-site injection- (i.e., alum-positive, same-site injection-negative) group; ULOQ=upper limit of quantification, LLOQ=lower limit of quantification, LOB=Limit of Blanc;

    [0026] FIG. 3 shows the ratio of IFN to IL-5 in the splenocytes of mice re-stimulated in vitro with Clade C gp140 protein as described in Example 2; the black triangles indicate the different dose levels of clade C gp140 recombinant protein, with the high dose being 12.5 g and the low dose being 1.25 g; a high IFN/IL-5 ratio is indicative of a relative T-helper 1 (Th1) biased immune response; animals in the alum same-site injection+ (i.e., alum-negative, same-site injection-positive) group show a higher IFN/IL-5 ratio as compared to that of the animals in the alum+ same-site injection- group; and

    [0027] FIG. 4 shows results from an IFN Enzyme-Linked Immunospot (ELISpot) Assay on splenocytes obtained at day 56 of the study described in Example 2 using global potential T-cell epitope (PTE) peptide pools with Gag, Pol and Env, respectively; the black triangles indicate the different dose levels of clade C gp140 recombinant protein, with the high dose being 12.5 g and the low dose being 1.25 g; the results are shown as mean spot-forming units (SFU) per 10.sup.6 splenocytes; SFU values are similar or even higher in animals in the alum same-site injection+ (i.e., alum-negative, same-site injection positive) group compared to animals in the alum+ same-site injection (i.e., alum-positive, same-site injection-negative) group, indicative of an intact cellular immune response; symbols represent the values for individual animals; horizontal lines indicate group geometric mean values and the dotted line represents the limit of detection (LOD).

    DETAILED DESCRIPTION OF THE INVENTION

    [0028] Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the present invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.

    [0029] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set in the specification. All patents, published patent applications and publications cited herein are incorporated by reference as if set forth fully herein. It must be noted that as used herein and in the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise.

    [0030] Unless otherwise stated, any numerical value, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term about. Thus, a numerical value typically includes 10% of the recited value. For example, a dosage of 100 g includes 90 g to 110 g. As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.

    [0031] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps. When used herein the term comprising can be substituted with the term containing or including or sometimes when used herein with the term having.

    [0032] When used herein consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim. Any of the aforementioned terms of comprising, containing, including, and having, whenever used herein in the context of an aspect or embodiment of the invention can be replaced with the term consisting of or consisting essentially of to vary scopes of the disclosure.

    [0033] As used herein, the conjunctive term and/or between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by and/or, a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term and/or as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term and/or.

    [0034] As used herein, subject means any animal, preferably a mammal, most preferably a human, to whom will be or has been administered immunogenic components and/or compositions according to the invention. The term mammal as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, non-human primates (NHPs) such as monkeys or apes, and humans, etc., more preferably a human.

    [0035] The invention relates to methods of inducing an immune response against human immunodeficiency virus (HIV) in a subject. According to embodiments of the invention, the method comprises co-locally administering to the subject: [0036] (a) an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide; and [0037] (b) an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen,
    wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are co-locally administered in a single composition or in separate compositions, and wherein the composition or compositions do not comprise adjuvant.

    [0038] As used herein, the terms co-locally administering, co-localized administration, and co-local administration refer to administration of multiple vaccine components or compositions to a subject at the same or substantially the same location of the subject, such as to the same muscle or same site, e.g., skin, of the subject. The same location means the same or approximately same site. For example, in the case of parenteral administration (e.g., intramuscular injection), co-local administration means administration at the same or substantially the same site on the body of the subject, such as to the same site (e.g., by the same device, for instance a syringe or multi-chamber syringe) or, when using more than device (e.g., two syringes) within about 10 cm, and more preferably within about 5 cm or less, 2 cm or less, or 1 cm or less, or any distance in between in the same location (e.g., muscle). Co-local administration can be achieved by pre-mixing the vaccine components (e.g., isolated polypeptide and adenovirus vector) prior to administration, using two syringes, a multi-chamber syringe, or transdermal patch or other needleless device. For example, the vaccine components or compositions can be pre-mixed and administered in a single formulation, the vaccine components can be in a single composition, or the vaccine components or compositions can be administered in two separate formulations by a multi-chamber syringe. When using two or more syringes, co-localized administration should occur at substantially the same time, e.g., within one hour, such as within 1 minute, 5 minutes, 10 minutes, 15 minutes, 30 minutes, or one hour. Co-local administration is distinguished from contralateral administration and co-lateral administration, wherein multiple vaccine components or composition are co-administered to two separate sites of a subject, e.g., in two separate locations on the same side of the body, for instance two separate locations on the right arm (co-lateral administration) or two separate locations on opposite sides of the body, for instance two different arms (contralateral administration).

    [0039] WO 2011/106705 discloses that a combination of a nucleic acid vaccine encoding an antigen of interest and protein vaccine that comprises the antigen, when co-administered at the same time, e.g. at the same site, results in an enhanced immune response in comparison to a prime/boost strategy wherein a DNA priming vaccine is followed by administration of a protein boosting vaccine; it thus discloses that co-injection of protein and DNA into the same muscle is immunogenic, however does not disclose that this is more immunogenic than co-administration at the same time into different muscles, so at best would suggest that DNA and protein co-local administration is an equivalent to co-administration at different sites. Moreover, all examples in WO 2011/106705 include at least one adjuvant (e.g. IL-12 encoded by the DNA vaccinations; and e.g. WO 2011/106705 example 3 demonstrates that the adjuvant IDRI EM005 is needed to induce potent Env-specific antibody titers (FIG. 10)). In contrast, the present inventors surprisingly describe herein that co-local administration of HIV Env protein and adenovirus vector encoding HIV Env is more immunogenic than co-administration (i.e. at the same time) into different sites, and moreover that co-local administration is surprisingly so effective that adjuvant is no longer needed for an effective immunization.

    [0040] According to embodiments of the invention, composition(s) comprising the isolated HIV Env protein and adenovirus vector do not comprise an adjuvant. The terms adjuvant and immune stimulant are used interchangeably herein, and are defined as one or more substances that are added to or included in a composition with an immunogenic component (e.g., isolated polypeptide and/or adenovirus vector) for the specific purpose of stimulating or enhancing an immune response to the immunogenic component (e.g., isolated polypeptide and/or adenovirus vector). In this context, an adjuvant is a substance that is known to be safe and well-tolerated, and which has known efficacy for the specific purpose of enhancing or stimulating an immune response to an HIV antigen, e.g., an isolated HIV envelope polypeptide and/or adenovirus vector expressing an HIV antigen, particularly an HIV Env antigen, administered in the methods of the invention.

    [0041] According to embodiments of the invention, adjuvants that can be omitted from (i.e. are not present in) the composition(s) to be administered to a subject according to the methods described herein include, but are not limited to, aluminum-based adjuvants, such as aluminum salts including aluminum phosphate (e.g., AdjuPhos), aluminum hydroxide, aluminum sulfate, aluminum oxide; calcium phosphate; liposomes; oil-in-water emulsion (e.g. MF59); water-in-oil emulsion (e.g. TiterMax); paraffin oil; toxoids; saponins or fractions thereof (e.g. Quil A, QS21, Matrix-M, Iscomatrix, and ISCOM); cytokines (e.g. IL-1, IL-2, IL-12, MoGM-CSF); lipid A or analogs or derivatives thereof (e.g. monophosphoryl lipid A (MPL), 3-de-O-acylated MPL (3D-MPL), GLA, SLA, PHAD, RC529, etc.), immunostimulatory nucleic acids (e.g., CpG oligodeoxynucleotides); imidazoquinolines (e.g. imiquimod, R848); Toll-like Receptor (TLR) agonists (e.g., TLR2, TLR3, TLR4, TLR5, TLR7, TLR8, TLR9, etc. agonists); AS01; AS02; AS03; AS04; AS15; AS25; polymer adjuvants (e.g., CRL-1005, Carbopol, adjuplex), GERBU, TERamide, PSC97B, Adjumer, PG-026, GSK-I, GcMAF, B-alethine, MPC-026, Betafectin, Adjuplex, army liposome formulation (ALF) (e.g., ALFA, ALFQ); and any combination thereof. In certain embodiments, the compositions do not include any adjuvant.

    [0042] According to embodiments of the invention, the methods described herein can be used to induce an immune response against one or more clades of human immunodeficiency virus (HIV). HIV is a member of the genus Lentivirinae, which is part of the family of Retroviridae. Two species of HIV infect humans: HIV-1 and HIV-2. HIV-1 is the most common strain of HIV virus, and is known to be more pathogenic than HIV-2. As used herein, the terms human immunodeficiency virus and HIV refer, but are not limited to, HIV-1 and HIV-2, preferably HIV-1. HIV is categorized into multiple clades with a high degree of genetic divergence. As used herein, the term HIV clade or HIV subtype refers to related human immunodeficiency viruses classified according to their degree of genetic similarity. There are currently three groups of HIV-1 isolates: M, N and O. Group M (major strains) consists of at least ten clades, A through J. Group 0 (outer strains) can consist of a similar number of clades. Group N is a new HIV-1 isolate that has not been categorized in either group M or O. In certain embodiments, the methods of the invention generate an immune response against multiple clades of HIV-1, preferably including at least clades A, B and/or C.

    HIV Antigens

    [0043] As used herein, the terms HIV antigenic polypeptide, HIV antigenic protein, HIV antigen, and HIV immunogen refer to a polypeptide capable of inducing an immune response, e.g., a humoral and/or cellular mediated response, against HIV in a subject. The antigenic polypeptide or antigen can be a protein of the HIV, a fragment or epitope thereof, or a combination of multiple HIV proteins or portions thereof that can induce an immune response or produce an immunity, e.g., protective immunity, against the HIV in a subject.

    [0044] An HIV antigen can be any HIV-1 or HIV-2 antigen or fragment thereof. Examples of HIV antigens include, but are not limited to gag, pol, and env gene products, which encode structural proteins and essential enzymes. In particular, gag, pol, and env gene products are synthesized as polyproteins, which are further processed into multiple other protein products. The primary protein product of the gag gene is the viral structural protein gag polyprotein, which is further processed into MA, CA, SP1, NC, SP2, and P6 protein products. The pol gene encodes viral enzymes (Pol, polymerase), and the primary protein product is further processed into RT, RNase H, IN, and PR protein products. The env gene encodes structural proteins, specifically glycoproteins of the virion envelope. The primary protein product of the env gene is gp160, which is further processed into gp120 and gp41. Other examples of HIV antigens include gene regulatory proteins Tat and Rev; accessory proteins Nef, Vpr, Vif and Vpu; capsid proteins, nucleocapsid proteins, and p24 viral protein. Preferably, HIV antigens are HIV Gag, Pol, or Env antigens, or any portion or combination thereof, more preferably an HIV-1 Gag, Pol, or Env antigen, or any portion or combination thereof.

    [0045] HIV antigens can also be mosaic HIV antigens. As used herein, mosaic antigen refers to a recombinant protein assembled from fragments of natural sequences. Mosaic antigens resemble natural antigens, but are optimized to maximize the coverage of potential T-cell epitopes found in the natural sequences, which improves the breadth and coverage of the immune response. Mosaic HIV antigens for use with the invention can be mosaic Gag, Pol, and/or Env antigens, preferably mosaic HIV-1 Gag, Pol, and/or Env antigens in which the sequences of gag, pol, and env gene products can be derived from one or more clades. For example, a mosaic HIV Env antigen specifically refers to a mosaic antigen comprising multiple epitopes derived from Env polyprotein sequences from one or more clades of HIV. Examples of mosaic HIV Gag, Pol and/or Env antigens that can be used in the invention include those described in, e.g., US20120076812; Barouch et al., Nat Med 2010, 16:319-323; and Barouch et al., Cell 155:1-9, 2013, all of which are incorporated herein by reference in their entirety. In particular, examples of mosaic HIV antigens suitable for use in the invention include, but are not limited to, mosaic HIV Env antigens with epitopes derived from the sequences of env gene products, such as those shown in SEQ ID NOs: 1-3; and mosaic Gag-Pol antigens with epitopes derived from the sequences of gag and pol gene products, such as those shown in SEQ ID NOs: 4 and 5, and combinations thereof.

    [0046] According to embodiments of the invention, an adenovirus vector can encode any HIV Env antigen known in the art in view of the present disclosure.

    [0047] In one embodiment, an HIV Env antigen encoded by an adenovirus vector, e.g., rAd26 vector, for use in the invention comprises the amino acid sequence of SEQ ID NO: 1.

    [0048] In yet another embodiment, an HIV Env antigen encoded by an adenovirus vector, e.g., rAd26 vector, for use in the invention comprises the amino acid sequence of SEQ ID NO: 3.

    [0049] In some embodiments, an adenovirus vector encoding an HIV Env antigen further encodes one or more additional HIV antigens. For example, an adenovirus vector can encode one or more additional Env antigens, or one or more other HIV antigens, such as HIV Gag and/or Pol antigens. Such additional HIV antigens can be encoded on the same adenovirus vector as the HIV Env antigen, or on one or more separate adenovirus vectors.

    [0050] In other embodiments, an adenovirus vector encoding an HIV Env antigen is administered in combination with one or more additional adenovirus vectors (e.g., 1, 2, 3, 4, or more additional adenovirus vectors) encoding one or more additional HIV antigens, e.g., one or more additional HIV Env, Gag, and/or Pol antigens. Examples of other adenovirus vectors suitable for use in the methods of the invention include adenovirus vector encoding Gag-Pol antigens, such as those comprising the amino acid sequences of SEQ ID NO: 4 and/or SEQ ID NO: 5.

    HIV Envelope Polypeptide

    [0051] As used herein, each of the terms envelope protein, Env protein, envelope polypeptide, and Env refers to a protein that is expressed on the envelope of an HIV virion and enables an HIV to target and attach to the plasma membrane of HIV infected cells, or a fragment or derivative thereof that can induce an immune response or produce an immunity against the HIV in a subject. The HIV env gene encodes the precursor protein gp160, which is proteolytically cleaved into the two mature envelope glycoproteins, gp120 and gp41. The cleavage reaction is mediated by a host cell protease, furin, at a sequence highly conserved in retroviral envelope glycoprotein precursors. More specifically, gp160 trimerizes to (gp160).sub.3 and then undergoes cleavage into the two noncovalently associated gp120 and gp41. Viral entry is subsequently mediated by a trimer of gp120/gp41 heterodimers. Gp120 is the receptor binding fragment, and binds to the CD4 receptor on a target cell that has such a receptor, such as, e.g., a T-helper cell. Gp41, which is non-covalently bound to gp120, is the fusion fragment and provides the second step by which HIV enters the cell. Gp41 is originally buried within the viral envelope, but when gp120 binds to a CD4 receptor, gp120 changes its conformation causing gp41 to become exposed, where it can assist in fusion with the host cell. Gp140 is the uncleaved ectodomain of trimeric gp160, i.e., (gp160).sub.3, that has been used as a surrogate for the native state of the cleaved, viral spike.

    [0052] According to embodiments of the invention, an HIV envelope polypeptide can be a gp160, gp140, gp120, gp41 protein, combinations, fusions, truncations or derivatives thereof. For example, an HIV envelope polypeptide can include a gp120 protein noncovalently associated with a gp41 protein. It can also include a stabilized trimeric gp140 protein that can have or can be modified to include a trimerization domain that stabilizes trimers of gp140. Examples of trimerization domains include, but are not limited to, the T4-fibritin foldon trimerization domain; the coiled-coil trimerization domain derived from GCN4; and the catalytic subunit of E. coli aspartate transcarbamoylase as a trimer tag. An HIV envelope polypeptide can also be a truncated HIV envelope protein including, but not limited to, envelope proteins comprising a C-terminal truncation in the ectodomain (i.e. the domain that extends into the extracellular space), a truncation in the gp41, such as a truncation in the transmembrane domain of gp41, or a truncation in the cytoplasmic domain of gp41. An HIV envelope polypeptide can further be a derivative of a naturally occurring HIV envelope protein having sequence mutations, e.g., in the furin cleavage sites, and/or so-called SOSIP mutations.

    [0053] HIV envelope polypeptide can be produced and isolated using any method known in the art in view of the present disclosure. For example, an HIV envelope polypeptide can be expressed from a host cell, preferably a recombinant host cell optimized for production of the envelope polypeptide. A leader/signal sequence can be operably linked to the N-terminus of the envelope polypeptide for maximal protein expression. The leader/signal sequence is usually cleaved from the nascent polypeptide during transport into the lumen of the endoplasmic reticulum. Any leader/signal sequence suitable for a host cell of interest can be used.

    [0054] In some embodiments, the isolated HIV envelope polypeptide is a stabilized trimeric gp140 polypeptide, such as those described in Nkolola et al 2010, J. Virology 84(7): 3270-3279; Kovacs et al, PNAS 2012, 109(30):12111-6, WO 2010/042942 and WO 2014/107744, all of which are incorporated by reference in their entirety.

    [0055] In some embodiments, an HIV Env polypeptide is a clade C gp140 protein, for instance Clade C gp140 polypeptide having the amino acid sequence of SEQ ID NO: 6.

    [0056] In some embodiments, an HIV Env polypeptide is a mosaic Env polypeptide comprising multiple epitopes derived from one or more Env sequences of one or more HIV clades, for instance mosaic gp140 polypeptide having the amino acid sequence of SEQ ID NO: 7.

    [0057] In other embodiments, one or more (e.g., two) HIV Env polypeptides, such as two gp140 polypeptides are administered together. For example, a clade C gp140 polypeptide having the amino acid sequence of SEQ ID NO: 6 and a mosaic gp140 polypeptide having the amino acid sequence of SEQ ID NO: 7 can be administered in combination.

    Adenovirus Vectors

    [0058] An adenovirus according to the invention belongs to the family of the Adenoviridae, and preferably is one that belongs to the genus Mastadenovirus. It can be a human adenovirus, but also an adenovirus that infects other species, including but not limited to a bovine adenovirus (e.g. bovine adenovirus 3, BAdV3), a canine adenovirus (e.g. CAdV2), a porcine adenovirus (e.g. PAdV3 or 5), or a simian adenovirus (which includes a monkey adenovirus and an ape adenovirus, such as a chimpanzee adenovirus or a gorilla adenovirus). Preferably, the adenovirus is a human adenovirus (HAdV, or AdHu), or a simian adenovirus such as chimpanzee or gorilla adenovirus (ChAd, AdCh, or SAdV). In the invention, a human adenovirus is meant if referred to as Ad without indication of species, e.g. the brief notation Ad26 means the same as HadV26, which is human adenovirus serotype 26. Also as used herein, the notation rAd means recombinant adenovirus, e.g., rAd26 refers to recombinant human adenovirus 26.

    [0059] An adenovirus vector can be based on any adenovirus serotype, preferably human adenovirus serotype, including but not limited adenovirus serotype 11, 26, 34, 35, 48, 49, 50, 52, etc., preferably rAd11, rAd26, rAd34, rAd35, rAd48, rAd49, rAd50, rAd52, etc. In certain preferred embodiments, the adenovirus vector is adenovirus 26 (Ad26). An advantage of human adenovirus serotype 26 is a low seroprevalence and/or low pre-existing neutralizing antibody titers in the human population, and such vectors have shown to generate good immune responses against different antigens in human clinical trials.

    [0060] In a preferred embodiment, an adenovirus vector is an adenovirus 26 vector, particularly recombinant adenovirus 26 (rAd26) vector.

    [0061] An adenovirus capsid protein refers to a protein on the capsid of an adenovirus (e.g., Ad26 vectors) that is involved in determining the serotype and/or tropism of a particular adenovirus. Adenoviral capsid proteins typically include the fiber, penton and/or hexon proteins. An rAd26 vector comprises at least hexon of Ad26, preferably at least hexon and fiber of Ad26. In preferred embodiments, the hexon, penton and fiber are of Ad26. Preferably, also the non-capsid proteins are from Ad26.

    [0062] One of ordinary skill in the art will recognize that elements derived from multiple serotypes can be combined in a single recombinant adenovirus vector. Thus, a chimeric adenovirus that combines desirable properties from different serotypes can be produced. Thus, in some embodiments, a chimeric adenovirus of the invention could combine the absence of pre-existing immunity of a first serotype with characteristics such as temperature stability, assembly, anchoring, production yield, redirected or improved infection, stability of the DNA in the target cell, and the like.

    [0063] In certain embodiments the recombinant adenovirus vector useful in the invention is derived mainly or entirely from Ad26 (i.e., the vector is rAd26). In some embodiments, the adenovirus is replication deficient, e.g., because it contains a deletion in the E1 region of the genome. For adenoviruses derived from Ad26 or other non-subgroup C adenoviruses, it is useful to exchange the E4-orf6 coding sequence of the adenovirus with the E4-orf6 of an adenovirus of human subgroup C such as Ad5. This allows propagation of such adenoviruses in well-known complementing cell lines that express the E1 genes of Ad5, such as for example 293 cells, PER.C6 cells, and the like (see, e.g. Havenga, et al., 2006, J Gen Virol 87: 2135-43; WO 03/104467). However, such adenoviruses will not be capable of replicating in non-complementing cells that do not express the E1 genes of Ad5. Thus, in certain embodiments, the adenovirus is a human adenovirus of serotype 26, with a deletion in the E1 region into which the nucleic acid encoding one or more mosaic HIV antigens has been cloned, and with an E4 orf6 region of Ad5.

    [0064] The preparation of recombinant adenoviral vectors is well known in the art. Preparation of rAd26 vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO: 1 of WO 2007/104792. Examples of vectors useful for the invention for instance include those described in WO2012/082918, the disclosure of which is incorporated herein by reference in its entirety. Typically, an adenovirus vector useful in the invention is produced using a nucleic acid comprising the entire recombinant adenoviral genome (e.g., a plasmid, cosmid, or baculovirus vector).

    [0065] In some embodiments, adenovirus vectors are replication deficient. In these embodiments, the virus is rendered replication deficient by deletion or inactivation of regions critical to replication of the virus, such as the E1 region. The regions can be substantially deleted or inactivated by, for example, inserting a gene of interest, such as a gene encoding an HIV antigen (usually linked to a promoter) within the region. In some embodiments, the vectors of the invention can contain deletions in other regions, such as the E3 region, or insertions of heterologous genes linked to a promoter within such regions. Mutations in the E3 region of the adenovirus need not be complemented by the cell line, since E3 is not required for replication.

    [0066] A packaging cell line is typically used to produce sufficient amounts of adenovirus vectors. A packaging cell is a cell that comprises those genes that have been deleted or inactivated in a replication deficient vector, thus allowing the virus to replicate in the cell. Suitable packaging cell lines include, for example, PER.C6, 911, and HEK293.

    [0067] According to embodiments of the invention, any of the HIV antigens described herein, such as HIV Env antigens, can be encoded by an adenovirus vector. Optionally, the heterologous gene encoding the HIV antigen can be codon-optimized to ensure proper expression in the treated host (e.g., human). Codon-optimization is a technology widely applied in the art. Examples of nucleic acid encoding HIV antigens that can be used in the adenovirus vectors of the invention include those show in SEQ ID NOs: 8-12. Typically, the heterologous gene encoding the HIV antigen is cloned into the E1 and/or the E3 region of the adenoviral genome. The heterologous gene encoding the HIV antigen can be under the control of (i.e., operably linked to) an adenovirus-derived promoter (e.g., the Major Late Promoter), or can be under the control of a heterologous promoter. Examples of suitable heterologous promoters include the cytomegalovirus (CMV) promoter and the Rous sarcoma virus (RSV) promoter. Preferably, the promoter is located upstream of the heterologous gene encoding the HIV antigen within an expression cassette.

    Compositions and Immunogenic Compositions

    [0068] According to embodiments of the invention, an immunogenically effective amount of an isolated HIV envelope polypeptide is co-locally administered to a subject with an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen. As used herein, an immunogenically effective amount or immunologically effective amount means an amount sufficient to induce a desired immune effect or immune response in a subject. In reference to an adenovirus vector encoding an HIV antigen or isolated HIV envelope polypeptide, an immunogenically effective amount or immunologically effective amount means an amount of the adenovirus vector or isolated HIV envelope polypeptide sufficient to induce a desired immune effect or immune response against HIV in a subject.

    [0069] In one embodiment, an immunogenically effective amount means an amount sufficient to induce an immune response against HIV in a subject. In another embodiment, an immunogenically effective amount means an amount sufficient to produce immunity in a subject, e.g., provide a protective effect against HIV infection. An immunogenically effective amount can vary depending upon a variety of factors, such as the physical condition of the subject, age, weight, health, etc.; the particular application, whether inducing immune response or providing protective immunity; the specific adenovirus vector administered; the antigen encoded by the adenovirus vector administered; and the specific isolated HIV antigenic polypeptide administered. An immunogenically effective amount can readily be determined by one of ordinary skill in the art in view of the present disclosure.

    [0070] An immunogenically effective amount can be administered in a single step (such as a single injection), or multiple steps (such as multiple injection), or in a single composition or multiple compositions. It is also possible to administer an immunogenically effective amount to a subject, and subsequently administer another dose of an immunogenically effective amount to the same subject, in a so-called prime-boost regimen. This general concept of a prime-boost regimen is well known to the skilled person in the vaccine field. Further booster administrations can optionally be added to the regimen, as needed.

    [0071] An immunogenic composition or vaccine composition in particular is a composition comprising an immunogenically effective amount of a purified or partially purified adenovirus vector and/or an immunogenically effective amount of an isolated HIV envelope polypeptide. According to embodiments of the invention, the adenovirus vector and isolated HIV envelope polypeptide can be administered in the same composition (e.g., immunogenic composition or vaccine composition), or in separate compositions (e.g., immunogenic or vaccine compositions), wherein the composition(s) do not contain an adjuvant. Compositions and immunogenic or vaccine compositions can further comprise other HIV antigens, e.g., HIV gag, pol, and/or env antigens and/or adenovirus vectors expressing such antigens.

    [0072] In one embodiment, an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen is administered in a composition (e.g., immunogenic composition) separate from an immunogenically effective amount of an isolated HIV envelope polypeptide. In such embodiments, the separate compositions are administered co-locally, i.e., to the same or substantially the same site of the subject, and compositions do not comprise an adjuvant.

    [0073] In another embodiment, an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen is administered in the same composition (e.g., immunogenic composition) as an immunogenically effective amount of an isolated HIV envelope polypeptide, wherein the composition does not comprise an adjuvant. In such embodiments, the adenovirus vector and isolated HIV Env polypeptide can be pre-mixed to prepare a single formulation just prior to administration, or the adenovirus vector and isolated HIV Env polypeptide can be formulated in the same composition.

    [0074] As general guidance, an immunogenically effective amount when used with reference to a recombinant viral vector can range from about 10.sup.6 viral particles to about 10.sup.12 viral particles, for example 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, or 10.sup.12 viral particles. An immunogenically effective amount can be administered in a single composition, or in multiple compositions, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 compositions (e.g., tablets, capsules or injectables), wherein the administration of the multiple capsules or injections collectively provides a subject with the immunogenically effective amount. In general, when used with reference to a polypeptide, such as an isolated antigenic polypeptide, an immunogenically effective amount can range from, e.g. about 0.3 to about 3000 microgram (g), e.g. 1-1000 g, e.g. 10-500 g, e.g. about 1, 5, 10, 15, 50, 100, 150, 200, 250, 300, 350, 400, 450 or 500 g, or any amount in between. When an immunogenically effective amount of a vaccine component is administered in multiple compositions, the multiple compositions are preferably administered co-locally per administration.

    [0075] The preparation and use of compositions and immunogenic compositions are well known to those of ordinary skill in the art. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil, preferably water or saline. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can also be included. The compositions can comprise a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material can depend on the route of administration, e.g., intramuscular, subcutaneous, intradermal, oral, intravenous, cutaneous, mucosal (e.g., gut), intranasal or intraperitoneal routes.

    [0076] The ability to induce or stimulate an anti-HIV immune response upon administration in an animal or human organism can be evaluated either in vitro or in vivo using a variety of assays which are standard in the art. For a general description of techniques available to evaluate the onset and activation of an immune response, see for example Coligan et al. (1992 and 1994, Current Protocols in Immunology; ed J Wiley & Sons Inc, National Institute of Health). Measurement of cellular immunity can be performed by measurement of cytokine profiles secreted by activated effector cells including those derived from CD4+ and CD8+ T-cells (e.g. quantification of IL-10 or IFN gamma-producing cells by ELISpot), by determination of the activation status of immune effector cells (e.g. T cell proliferation assays by a classical [.sup.3H] thymidine uptake), by assaying for antigen-specific T lymphocytes in a sensitized subject (e.g. peptide-specific lysis in a cytotoxicity assay, etc.).

    [0077] The ability to stimulate a humoral response can be determined by antibody binding and/or competition in binding (see for example Harlow, 1989, Antibodies, Cold Spring Harbor Press). For example, titers of antibodies produced in response to administration of a composition providing an immunogen can be measured by enzyme-linked immunosorbent assay (ELISA). The immune responses can also be measured by neutralizing antibody assay, where a neutralization of a virus is defined as the loss of infectivity through reaction/inhibition/neutralization of the virus with specific antibody. The immune response can further be measured by Antibody-Dependent Cellular Phagocytosis (ADCP) Assay.

    Methods of Inducing an Immune Response

    [0078] As used with reference to the methods described herein, inducing an immune response encompasses providing protective immunity and/or vaccinating a subject against an infection, such as a HIV infection, for prophylactic purposes, as well as causing a desired immune response or effect in a subject in need thereof against an infection, such as a HIV infection, for therapeutic purposes. As used herein, the term protective immunity or protective immune response means that the vaccinated subject is able to control an infection with the pathogenic agent against which the vaccination was done. Usually, the subject having developed a protective immune response develops only mild to moderate clinical symptoms or no symptoms at all.

    [0079] Administration of an immunogenically effective amount of an isolated HIV Env polypeptide and/or immunogenically effective amount of an adenovirus vector, or composition(s) thereof is typically intramuscular or subcutaneous. Thus, compositions or immunogenic compositions comprising such vaccine components are typically formulated for intramuscular or subcutaneous injection, and for the purposes of the invention formulated without adjuvants as indicated above, preferably without any adjuvant. However other modes of administration, such as intravenous, cutaneous, intradermal or nasal can be envisaged as well. For intravenous, cutaneous or subcutaneous injection, the adenovirus vector will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Likewise, the isolated envelope polypeptide will be in the form of a parenterally acceptable solution having a suitable pH, isotonicity, and stability. Those of ordinary skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives can be included, as required.

    [0080] In a particular embodiment, an immunogenically effective amount of an isolated HIV Env polypeptide and/or immunogenically effective amount of an adenovirus vector, or composition(s) thereof is administered via intramuscular administration. Intramuscular administration can be achieved by using a needle to inject a suspension of the adenovirus vectors and/or envelope polypeptides. An alternative is the use of a needleless injection device to administer the composition (using, e.g., Biojector) or a freeze-dried powder containing the vaccine.

    [0081] In some embodiments, an immunogenically effective amount of an isolated HIV Env polypeptide and immunogenically effective amount of an adenovirus vector are administered in the same composition co-locally by intramuscular administration, wherein the composition does not comprise an adjuvant. An example of co-local administration according to the invention is intramuscular injection of the composition or compositions in the deltoid of one arm of a subject.

    [0082] In some embodiments, an immunogenically effective amount of an isolated HIV Env polypeptide and immunogenically effective amount of an adenovirus vector are administered in separate compositions co-locally by intramuscular administration, wherein none of the separate compositions comprises an adjuvant. In such embodiments, administration of the separate compositions can be via injection using a multi-chamber syringe, or via injection using two separate syringes to substantially the same-site, e.g., with the injections within 10 cm of each other into the same muscle.

    [0083] In some embodiments, an immunogenically effective amount of an isolated HIV Env polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen are administered co-locally to a subject for priming immunization and for boosting immunization.

    [0084] In some embodiments, an immunogenically effective amount of an isolated HIV Env polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen are administered co-locally to a subject for boosting immunization, after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen. In other words, an immunogenically effective amount of an adenovirus vector encoding an HIV Env polypeptide can be administered for priming immunization, followed by co-local administration of an immunogenically effective amount of an isolated HIV Env polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen for boosting immunization. Preferably, such priming and boosting immunizations are administered by intramuscular administration. Adenovirus vectors and isolated HIV Env polypeptides that can be used in such prime-boost regimens are described in detail above. In particular embodiments, the same adenovirus vector, preferably an rAd26 vector, is used in the priming immunization and boosting immunization.

    [0085] In certain embodiments, the priming immunization and/or the boosting administration, preferably both the priming and boosting administration, further comprise administering one or more adenovirus vectors that encode one or more further HIV antigens, e.g. Gag and/or Pol. The co-localized administration in the absence of adjuvant of the HIV Env antigen encoded by adenovirus and the isolated HIV Env polypeptide does not substantially lower the cellular immune response against such further HIV antigens.

    [0086] The timing for administering priming and boosting immunizations is not particularly limited. For example, a vaccine composition can be administered for priming immunization, and re-administered prior to administration of a vaccine composition for boosting immunization. Further administrations of a vaccine composition for further boosting immunizations are also contemplated. In certain embodiments, a booster vaccine is first administered about 1-12 weeks, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after a primer vaccine is initially administered. In other embodiments, a booster vaccine is first administered about 12-52 weeks, e.g., about 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, or 52 weeks after a primer vaccine is initially administered. One of ordinary skill in the art will be able to vary the exact timing of the priming and boosting vaccines, frequency of administration thereof, dosage thereof, etc., based upon the teachings herein and general knowledge in the art.

    [0087] In a particular embodiment, a method of inducing an immune response against HIV in a subject comprises co-locally administering to the subject an immunogenically effective amount of an isolated HIV Env polypeptide, and an immunogenically effective amount of an adenovirus vector, preferably an rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 1 in a single composition, or in separate compositions, wherein the composition or compositions do not comprise an adjuvant. The immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector can be re-administered, preferably co-locally, to boost the immune response. Additionally or alternatively, the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector can be administered co-locally one or more times for boosting immunization after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen, e.g., an HIV Env antigen of SEQ ID NO: 1. In certain embodiments, the isolated HIV Env polypeptide comprises SEQ ID NO: 6 or SEQ ID NO: 7, or comprises two isolated HIV Env polypeptides that comprise SEQ ID NOs: 6 and 7 respectively.

    [0088] In another particular embodiment, a method of inducing an immune response against HIV in a subject comprises co-locally administering to the subject an immunogenically effective amount of an isolated HIV Env polypeptide, and an immunogenically effective amount of an adenovirus vector, preferably an rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 3 in a single composition, or in separate compositions, wherein the composition or compositions do not comprise an adjuvant. The immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector can be re-administered, preferably co-locally, to boost the immune response. Additionally or alternatively, the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector can be administered co-locally one or more times for boosting immunization after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen, e.g., an HIV Env antigen of SEQ ID NO: 3. In certain embodiments, the isolated HIV Env polypeptide comprises SEQ ID NO: 6 or SEQ ID NO: 7, or comprises two isolated HIV Env polypeptides that comprise SEQ ID NOs: 6 and 7 respectively.

    [0089] In other embodiments, an adenovirus vector encoding an HIV Env antigen is administered together with one or more additional adenovirus vectors encoding one or more additional HIV antigens. The adenovirus vectors can be co-locally administered with an isolated HIV Env polypeptide in the same composition or in separate compositions, wherein the composition(s) do not comprise an adjuvant. The adenovirus vectors can be administered for priming immunization, and then re-administered co-locally with an isolated HIV Env polypeptide in the same composition or in separate compositions, wherein the composition(s) do not comprise an adjuvant. Preferably, the adenovirus vector and the one or more additional adenovirus vectors are rAd26 vectors.

    [0090] In a particular embodiment, an adenovirus vector encoding an HIV Env antigen is administered together with an additional adenovirus vector encoding an additional HIV Env antigen. For example, an adenovirus vector, preferably rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 1 can be administered in combination with an additional adenovirus vector, preferably rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 3. Such adenovirus vectors can be administered co-locally with an isolated HIV Env polypeptide to induce an immune response against HIV in a subject. Such adenovirus vectors can also be administered for priming immunization, and re-administered co-locally with an isolated HIV Env polypeptide for boosting immunization. According to embodiments of the invention, when administered together co-locally, the adenovirus vectors and isolated HIV Env polypeptide are administered in the same composition or in separate compositions, wherein the composition or compositions do not comprise an adjuvant. In certain embodiments, the isolated HIV Env polypeptide comprises SEQ ID NO: 6 or SEQ ID NO: 7, or comprises two isolated HIV Env polypeptides that comprise SEQ ID NOs: 6 and 7 respectively.

    [0091] In another particular embodiment, an adenovirus vector encoding an HIV Env antigen is administered together with one or more additional adenovirus vectors (e.g., 1, 2, 3, 4 or more additional adenovirus vectors) encoding one or more additional HIV antigens, e.g., HIV Env, Gag, and/or Pol antigens. Each adenovirus vector can encode a different HIV antigen, or combination of HIV antigens. For example, an adenovirus vector, preferably rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 1 can be administered in combination with a second adenovirus vector, preferably rAd26 vector, encoding an HIV Env antigen of SEQ ID NO: 3, a third adenovirus vector, preferably rAd26 vector, encoding an HIV Gag-Pol antigen of SEQ ID NO: 4, and a fourth adenovirus vector, preferably rAd26 vector, encoding an HIV Gag-Pol antigen of SEQ ID NO: 5. Such adenovirus vectors can be administered co-locally with an isolated HIV Env polypeptide to induce an immune response against HIV in a subject. Such adenovirus vectors can also be administered for priming immunization, and re-administered co-locally with an isolated HIV Env polypeptide for boosting immunization. When administered together co-locally, the adenovirus vectors and isolated HIV Env polypeptide are administered in the same composition or in separate compositions, wherein the composition or compositions do not comprise an adjuvant. In certain embodiments, the isolated HIV Env polypeptide comprises SEQ ID NO: 6 or SEQ ID NO: 7, or comprises two isolated HIV Env polypeptides that comprise SEQ ID NOs: 6 and 7 respectively.

    [0092] According to embodiments of the invention, when adenovirus vector(s) are administered for priming immunization, and subsequently administered co-locally with an isolated HIV Env polypeptide in the absence of adjuvant for boosting immunization, the adenovirus vector(s) administered for priming immunization and boosting immunization can be the same or different. In certain embodiments they are the same.

    [0093] In some embodiments, an immune response comprises a humoral immune response against HIV, preferably against multiple clades of HIV-1, such as at least clades A, B and/or C.

    [0094] In some embodiments, an immune response comprises a cellular immune response against HIV, preferably against multiple clades of HIV-1, such as at least clades A, B and/or C.

    [0095] In some embodiments, an immune response comprises a T-helper 1 (Th1) biased immune response. T lymphocytes expressing CD4 are also known as helper T cells, which produce cytokines. Helper T cells can be further subdivided into T-helper 1 (Th1) and T-helper 2 (Th2) cells, and the cytokines produced by such cells are known as Th1-type cytokines and Th2-type cytokines, respectively. Th1-type cytokines tend to produce the proinflammatory responses responsible for killing intracellular parasites and for perpetuating autoimmune responses. Interferon- is a primary Th1 cytokine. Excessive proinflammatory responses can lead to uncontrolled tissue damage, thus there needs to be a mechanism to counteract this effect. In particular, the Th2-type cytokines include interleukins (IL) 4, 5, and 13, which are associated with the promotion of IgE and eosinophilic responses in atopy, and also interleukin-10, which is considered a prototypical anti-inflammatory cytokine that can both impede pathogen clearance and ameliorate immunopathology. See, e.g., From: Bingley et al. BMJ. 2000 Aug. 12; 321(7258): 424.

    [0096] Thus, in some embodiments, a T-helper 1 biased immune response or Th1 biased immune response refers to an immune response in which a greater amount (e.g., concentration) of cytokines produced by T-helper 1 (Th1) cells are produced, as compared to the amount (e.g., concentration) of cytokines produced by T-helper 2 (Th2) cells. Whether an immune response can be characterized as Th1 biased can be determined by measuring a concentration of one or more Th1 cytokines (e.g., IFN-) and one or more Th2 cytokines (e.g., IL-4, IL-5, IL-13, etc.), and comparing the concentration of Th1 cytokine(s) to the concentration of Th2 cytokine(s). In a particular embodiment, a Th1 biased immune response is identified by determining a ratio of the concentration of a Th1 cytokine (e.g., IFN-) to the concentration of a Th2 cytokine (e.g., IL-5) in a sample from a subject. For example, a ratio of the concentration of IFN- to the concentration of IL-5 of 1 to 100, such as 1, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, or any value in between, more preferably greater than 1, even more preferably greater than 10, is indicative of a Th1 biased immune response.

    [0097] The invention also relates to use of an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen in the manufacture of a medicament for inducing an immune response against HIV in a subject by co-local administration of the isolated Env polypeptide and adenovirus vector to the subject, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are in a single composition or separate compositions, and wherein the composition or compositions does not comprise adjuvant. All aspects and embodiments of the invention as described herein with respect to methods of inducing an immune response against a human immunodeficiency virus (HIV) can be applied to this aspect of the invention.

    [0098] The invention further relates to an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide and an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen for use in inducing an immune response against HIV in a subject by co-local administration of the isolated HIV Env polypeptide and the adenovirus vector to the subject, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are in a single composition or separate compositions, and wherein the composition or compositions does not comprise adjuvant. All aspects and embodiments of the invention as described herein with respect to methods of inducing an immune response against a human immunodeficiency virus (HIV) can be applied to this aspect of the invention.

    Embodiments

    [0099] The invention also relates to the following non-limiting embodiments.

    [0100] Embodiment 1 is a method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject, the method comprising co-locally administering to the subject: [0101] a. an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide; and [0102] b. an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen, [0103] wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are co-locally administered in a single composition or in separate compositions, and wherein the composition or compositions do not comprise adjuvant.

    [0104] Embodiment 2 is a method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject, the method comprising co-locally administering to the subject: [0105] a. an immunogenically effective amount of an isolated HIV envelope (Env) polypeptide; and [0106] b. an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen,
    wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are co-locally administered in a single composition or in separate compositions, and wherein the composition or compositions do not comprise adjuvant, wherein the adjuvant is or comprises aluminum phosphate, aluminum hydroxide, aluminum sulfate, aluminum oxide, calcium phosphate, liposomes, oil-in-water emulsion (e.g. MF59), water-in-oil emulsion, paraffin oil, toxoids, saponins or fractions thereof (e.g. Quil A, QS21, Matrix-M, Iscomatrix, and ISCOM), IL-1, IL-2, IL-12, MoGM-CSF, lipid A or analogs or derivatives thereof (e.g. monophosphoryl lipid A (MPL), 3-de-O-acylated MPL (3D-MPL), GLA, SLA, PHAD, RC529, etc), CpG, imidazoquinolines (e.g. imiquimod, R848), or any combination thereof.

    [0107] Embodiment 2a is the method of embodiment 2, wherein the adjuvant is or comprises aluminum phosphate, aluminum hydroxide, aluminum sulfate, aluminum oxide, calcium phosphate, liposomes, oil-in-water emulsion (e.g. MF59), water-in-oil emulsion, paraffin oil, toxoids, saponins or fractions thereof (e.g. Quil A, QS21, Matrix-M, Iscomatrix, and ISCOM), IL-1, IL-2, IL-12, MoGM-CSF, lipid A or analogs or derivatives thereof (e.g. monophosphoryl lipid A (MPL), 3-de-O-acylated MPL (3D-MPL), GLA, SLA, PHAD, RC529, etc), CpG, imidazoquinolines (e.g. imiquimod, R848), Toll-like receptor agonists (e.g., TLR2, TLR3, TLR4, TLR5, TLR7, TLR8, TLR9, etc. agonists); AS01; AS02; AS03; AS04; AS15; AS25; polymer adjuvants (e.g., CRL-1005, Carbopol, Adjuplex), GERBU, TERamide, PSC97B, Adjumer, PG-026, GSK-I, GcMAF, B-alethine, MPC-026), Adjuvax, Betafectin, ALF, ALFA, or ALFQ, or any combination thereof.

    [0108] Embodiment 3 is the method of embodiment 2 or 2a, wherein the composition or compositions do not comprise any adjuvant.

    [0109] Embodiment 4 is the method of any one of embodiments 1-3, wherein the immunogenically effective amount of the isolated HIV Env polypeptide and the immunogenically effective amount of the adenovirus vector are administered co-locally for boosting immunization after administering to the subject an immunogenically effective amount of an adenovirus vector encoding an HIV Env antigen.

    [0110] Embodiment 5 is the method of any one of embodiments 1-4, wherein the adenovirus vector is an adenovirus 26 (rAd26) vector.

    [0111] Embodiment 6 is the method of any one of embodiments 1-5, further comprising administering an immunogenically effective amount of a second adenovirus vector encoding a second HIV Env antigen together with the immunogenically effective amount of the adenovirus vector.

    [0112] Embodiment 7 is the method of embodiment 6, wherein the second adenovirus vector is an adenovirus 26 (rAd26) vector.

    [0113] Embodiment 8 is the method of any one of embodiments 1-7, further comprising administering an immunogenically effective amount of one or more adenovirus vectors encoding further HIV antigens.

    [0114] Embodiment 9 is the method of embodiment 8, wherein the further HIV antigens comprise Gag and/or Pol.

    [0115] Embodiment 10 is the method of any one of embodiments 8 or 9, wherein the one or more adenovirus vectors encoding further HIV antigens are rAd26 vectors.

    [0116] Embodiment 11 is the method of any one of embodiments 1-10, wherein the co-localized administration is by intramuscular injection to a single muscle.

    [0117] Embodiment 12 is the method of any one of embodiments 1 to 11, wherein the immune response comprises a humoral immune response.

    [0118] Embodiment 13 is the method of any one of embodiments 1 to 11, wherein the immune response comprises a cellular immune response.

    [0119] Embodiment 14 is the method of any one of embodiments 1 to 13, wherein the immune response comprises a T-helper 1 (Th1) biased immune response.

    [0120] Embodiment 15 is the method of any one of embodiments 8 to 10, wherein the immune response against the further HIV antigens is not substantially lowered as compared to administration of the HIV Env polypeptide adjuvanted with aluminum phosphate and the adenovirus vectors in contralateral sites of the subject.

    [0121] The following examples of the invention are to further illustrate the nature of the invention. It should be understood that the following examples do not limit the invention and the scope of the invention is to be determined by the appended claims.

    EXAMPLES

    Example 1: Immunogenicity Study in Rabbits

    [0122] Immunogenicity was evaluated in a prime-boost regimen with a 6 week interval in New Zealand White (NZW) rabbits. Rabbits were dosed on day 0 and day 42 with HIV-1 Clade C gp140 recombinant protein (10 g) combined with 425 g aluminium phosphate adjuvant (Adju-Phos, 425 g) or without adjuvant, and either co-administered with Ad26.Mos4.HIV vaccine in separate legs of the rabbits, or extemporaneously pre-mixed (cage-side mixing) with the Ad26.Mos4.HIV vaccine and co-locally injected (i.e., same-site injection) into one leg of the rabbits. The Ad26.Mos4.HIV vaccine is composed of four recombinant Ad26 vectors each expressing a different HIV antigen or combination of HIV antigens, specifically Mos1.GagPol (SEQ ID NO: 4), Mos2.GagPol (SEQ ID NO: 5), Mos1.Env (SEQ ID NO: 1), and Mos2S.Env (SEQ ID NO: 3), and was administered at a total dose of 510.sup.9 viral particles (vps) per administration. Animals were immunized by intramuscular administration of a 200 L (co-administered in separate legs) or 400 L volume (same-site injection) per quadriceps muscle.

    [0123] Two weeks after the boost, serum antibodies were measured by enzyme-linked immunosorbent assay (ELISA) with vaccine autologous Clade C gp140 as coating antigen. The results are shown in FIG. 1. In particular, the results show that the clade C gp140 ELISA titers at day 56 of the study are indistinguishable between the group co-administered vector and adjuvanted protein in separate legs (alum+ same-site-), and the group co-locally administered (i.e., same-site injection) vector and protein without adjuvant (alum same-site+).

    [0124] This study thus demonstrates that aluminum adjuvant is dispensable when the administered vaccine components (i.e., HIV Env antigen in the form of adenovirus vector and isolated polypeptide) are injected in the same-site, i.e., co-locally administered.

    Example 2: Immunogenicity Study in Mice

    [0125] Immunogenicity was evaluated in a prime-boost regimen with a 6 week interval in mice. CB6/F1 mice were immunized on day 0 and day 42 with HIV-1 Clade C gp140 recombinant protein co-locally injected (i.e., same-site injection) or separately administrated in two different hind legs with Ad26.Mos4.HIV vaccine at 2 different doses, specifically 12.5 g and 1.25 g of Clade C gp140 recombinant protein. In the case of co-local injection, Ad26.Mos4.HIV and gp140 were extemporaneously pre-mixed (cage side mixing). The Clade C gp140 recombinant protein in the groups administered the recombinant protein and Ad26.Mos4.HIV vaccine (see Example 1 for a description) in the separate hind legs was adjuvanted with aluminum phosphate at corresponding dose levels of 21.25 g and 2.125 g, respectively. The Ad26.Mos4.HIV vaccine was administered at a total dose of 2.510.sup.9 viral particles (vps) when administered with 12.5 g of Clade C gp140 recombinant protein, and at a total dose of 2.510.sup.8 vps when administered with 1.25 g Clade C gp140 recombinant protein. Animals were immunized by intramuscular administration.

    [0126] Two weeks after the boost (i.e., at day 56), serum antibodies were measured by ELISA with vaccine-autologous Clade C gp140 as coating antigen. The results are shown in FIG. 2. In particular, the results show that the clade C gp140 ELISA titers in serum at day 56 in the group co-locally administered (i.e., same-site injection) vector and protein without adjuvant (alum same-site injection+) had increased clade C gp140 ELISA titers as compared to the group co-administered vector and adjuvanted protein in separate legs (alum+ same-site injection).

    [0127] Additionally, splenocytes from the mice were re-stimulated in vitro with Clade C gp140 recombinant protein, and cytokines were analyzed in the supernatant 48 hours after the re-stimulation. The ratio of IFN to IL-5 was determined, and a high IFN/IL-5 ratio was indicated of a relative T-helper 1 (Th1) biased immune response. The results are shown in FIG. 3. The results demonstrate that co-local administration (i.e., same-site injection) of vector and protein without adjuvant induced a Th1-biased immune response as compared to co-administration of vector and adjuvanted protein in separate locations.

    [0128] Additionally, HIV-1-specific cellular immune responses were assessed by IFN ELISpot at day 56 of the study. Splenocytes from the mice were stimulated ex vivo using global potential T-cell epitope (PTE) peptide pools with Gag, Pol and Env respectively. The results are shown in FIG. 4. The results show a significantly higher cellular immune response for the Env antigen when adenovirus vector and protein were co-locally administered as compared to distal co-administration (p<0.0001, 2-way ANOVA with dose and mode of administration as explanatory factors). These results demonstrate that co-local administration (i.e., same-site injection) of adenovirus vector and protein without adjuvant does not decrease (but even increases) the immune response to co-administered antigens.

    [0129] This study thus demonstrates that aluminum adjuvant is dispensable when the vaccine components are injected in the same-site, i.e., co-locally administered, and that co-local administration of HIV Env antigen in the form of adenovirus vector and isolated polypeptide results in an enhanced mean humoral response. This study also demonstrates that co-local administration of HIV Env antigen in the form of adenovirus vector and isolated polypeptide in the absence of adjuvant induces a more Th1-biased immune profile.

    REFERENCES

    [0130] 1. US 2012/0076812 [0131] 2. WO 2003/104467 [0132] 3. WO 2007/104792 [0133] 4. WO 2008/107370 [0134] 5. WO 2010/042942 [0135] 6. WO 2011/106705 [0136] 7. WO 2014/107744 [0137] 8. WO 2015/189425 [0138] 9. WO 2016/049287 [0139] 10. Abbink et al., (2007) Virol 81(9): 4654-63 [0140] 11. Barouch et al. The Lancet, Volume 392, Issue 10143, P232-243, Jul. 21, 2018; [0141] 12. Barouch et al., Nat Med 2010, 16:319-323; [0142] 13. Barouch et al., Cell 155:1-9, 2013 [0143] 14. Bingley et al. BMJ. 2000 Aug. 12; 321(7258): 424 [0144] 15. Coligan et al. (1992 and 1994, Current Protocols in Immunology; ed J Wiley & Sons Inc, National Institute of Health). [0145] 16. Havenga, et al., 2006, J Gen Virol 87: 2135-43; [0146] 17. Jones et al. J. Biol. Chem., 280, 13406-13414 (2005) [0147] 18. Kovacs et al, PNAS 2012, 109(30):12111-6, [0148] 19. Nkolola et al2010, J. Virology 84(7): 3270-3279

    TABLE-US-00001 SEQUENCELISTING SEQ ID Descrip- NO: tion Sequence 1 Mos1Env MRVTGIRKNYQHLWRWGTMLLGILMICSAAGKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWA THACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDDVRNVT NNATNTNSSWGEPMEKGEIKNCSFNITTSIRNKVQKQYALFYKLDVVPIDNDSNNTNYRLISCNTSVIT QACPKVSFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVV IRSENFTNNAKTIMVQLNVSVEINCTRPNNNTRKSIHIGPGRAFYTAGDIIGDIRQAHCNISRANWNNT LRQIV EKLGKQFGNNKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTKLFNSTWTWNNSTWNNTKRSNDTEEHI TLPCRIKQIINMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGNDTSGTEIFRPGGGDMRDNWRSEL YKYKVVKIEPLGVAPTKAKRRVVQSEKSAVGIGAVFLGELGAAGSTMGAASMTLTVQARLLLSGIVQQQ NNLLRAIEAQQHLLQLTVWGIEQLQARVLAVERYLKDQQLLGIWGCSGKLICTTTVPWNASWSNKSLDK IWNNMTWMEWEREINNYTSLIYTLIEESQNQQEKNEQELLELDEWASLWNWFDISNWLW 2 Mos2Env MRVRGIQRNWPQWWIWGILGEWMIIICRVMGNLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWA THACVPTDPNPQEMVLENVTENFNMWKNDMVDQMHEDIIRLWDQSLKPCVKLTPLCVTLECRNVRNVSS NGTYNIIHNETYKEMENCSFNATTVVEDRKQKVHALFYRLDIVPLDENNSSEKSSENSSEYYRLINCNT SAITQACPKVSFDPIPIHYCAPAGYAILKCNNKTFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAE EEIIIRSENLTNNAKTIIVHLNETVNITCTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHCNLSRDG WNKTLQGVKKKLAEHFPNKTINFTSSSGGDLEITTHSFNCRGEFFYCNTSGLFNGTYMPNGTNSNSSSN ITLPCRIXQIINMWQEVGRAMYAPPIAGNITCRSNITGLLLTRDGGSNNGVPNDTETFRPGGGDMRNNW RSELYKYKVVEVKPLGVAPTEAKRRVVESEKSAVGIGAVFLGILGAAGSTMGAASITLTVQARQLLSGI VQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLQDQQLLGLWGCSGKLICTTAVPWNTSWSNK SQTDIWDNMTWMQWDKEIGNYTGEIYRLLEESQNQQEKNEKDLLALDSWKNLWNWFDITNWLW 3 Mos2SEnv MRVRGMLRNWQQWWIWSSLGFWMLMIYSVMGNLWVTVYYGVPVWKDAKTTLFCASDAKAY EKEVHNVWATHACVPTDPNPQEIVLGNVTENFNMWENDMVDQMHEDIISLWDASLEPCVK LTPLCVTLNCRNVRNVSSNGTYNIIHNETYKEMENCSFNATTVVEDREQKVHALFYRLDI VPLDENNSSEESSENSSEYYRLINCNTSAITQACPKVSFDPIPIHYCAPAGYAILKCNNK TFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNET VNITCTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHCNLSRDGWNKTLQGVKKKLAEH FPNETIKFAPHSGGDLEITTHTFNCRGEFFYCNTSNLFNESNIERNDSIITLPCRIKQII NMWQEVGRAIYAPPIAGNITCRSNITGLLLTRDGGSNNGVPNDTETFRPGGGDMRNNWRS ELYKYKVVEVKPLGVAPTEAKRRVVEREKRAVGIGAVFLGILGAAGSTMGAASITLTVQA RQLLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLQDQQLLGLWGCSGK LICTTAVPWNTSWSNKSQTDIWDNMTWMQWDKEIGNYTGEIYRLLEESQNQQEKNEEDLL ALDSWNNLWNWFSISKWLWYIKIFIMIVGGLIGLRIIFAVLSIVNRVRQGY 4 Mos1 MGARASVLSGGELDRWEKIRLRPGGKKKYRLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQ GagPo1 TGSEELRSLYNTVATLYCVHQRIEIKDTKEALEKIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNI QGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINE EAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM YSPVSILDIRQGPKEPFRDYVDRFYKTLRAEQASQDVKNWMTETLLVQNANPDCKTILKALGPAATLEE MMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCW KCGKEGHQMKDCTERQANFLGKIWPSNKGRPGNFLQNRPEPTAPPEESFRFGEETTTPSQKQEPIDKEM YPLASLKSLFGNDPSSQMAPISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKI GPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLAVGDAYFSVP LDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRAKNPEIVIYQYMAALY VGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDI QKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAELELAENREILKEPVHGVYYDPSKDLI AEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTAHTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQK ETWETWWTDYWQATWIPEWEFVNTPPLVKLWYQLEKDPIAGVETFYVAGAANRETKLGKAGYVTDRGRQ KIVSLTETTNQKTALQAIYLALQDSGSEVNIVTASQYALGIIQAQPDKSESELVNQIIEQLIKKERVYL SWVPAHKGIGGNEQVDKLVSSGIRKVLFLDGIDKAQEEHEKTHSNWRAMASDFNLPPVVAKEIVASCDQ CQLKGEAMHGQVDCSPGIWQLACTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVK VIHTANGSNFTSAAVKAACWWAGIQQEFGIPYNPQSQGVVASMNKELKKIIGQVRDQAEHLKTAVQMAV FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAKLLWKGEGAV VIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED 5 Mos2 MGARASILRGGKLDKWEKIRLRPGGKKHYMLKHLVWASRELERFALNPGLLETSEGCKQIIKQLQPALQ GagPo1 TGTEELRSLFNTVATLYCVHAEIEVRDTKEALDKIEEEQNKSQQKTQQAKEADGKVSQNYPIVQNLQGQ MVHQPISPRTLNAWVKVIEEKAFSPEVIPMFTALSEGATPQDLNTMLNTVGGHQAAMQMLKDTINEEAA EWDRLHPVHAGPVAPGQMREPRGSDIAGTTSNLQEQIAWMTSNPPIPVGDIYKRWIILGLNKIVRMYSP TSILDIKQGPKEPERDYVDRFFKTLRAEQATQDVKNWMTDTLLVQNANPDCKTILRALGPGATLEEMMT ACQGVGGPSHKARVLAEAMSQTNSTILMQRSNFKGSKRIVKCFNCGKEGHIARNCRAPRKKGCWKCGKE GHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPAESFRFEETTPAPKQEPKDREPLTSLRSL FGSDPLSQMAPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTP IFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLAVGDAYFSVPLDEDFRKYT AFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMAALYVGSDLEIGQ HRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNW ASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG QWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTE YWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVAGAANRETKLGKAGYVTDRGRQKVVSLTDTT NQKTALQATHLALQDSGLEVNIVTASQYALGIIQAQPDXSESELVSQIIEQLIKKEKVYLAWVPAHKGI GGNEQVDKLVSRGIRKVLFLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIH GQVDCSPGIWQLACTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTANGSN FTSATVKAACWWAGIKQEFGIPYNPQSQGVVASINKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKG GIGEYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIK VVPRRKAKIIRDYGKQMAGDDCVASRQDED 6 Clade AENLWVGNMWVTVYYGVPVWTDAKTTLFCASDTKAYDREVHNVWATHACVPTDPNPQEIV Cgp140 LENVTENFNMWKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNATFKNNVTNDMN KEIRNCSFNTTTEIRDKKQQGYALFYRPDIVLLKENRNNSNNSEYILINCNASTITQACP KVNFDPIPIHYCAPAGYAILKCNNKTFSGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLA EKEIIIRSENLTDNVKTIIVHLNKSVEIVCTRPNNNTRKSMRIGPGQTFYATGDIIGDIR QAYCNISGSKWNETLKRVKEKLQENYNNNKTIKFAPSSGGDLEITTHSFNCRGEFFYCNT TRLFNNNATEDETITLPCRIKQIINMWQGVGRAMYAPPIAGNITCKSNITGLLLVRDGGE DNKTEEIFRPGGGNMKDNWRSELYKYKVIELKPLGIAPTGAKERVVEREERAVGIGAVFL GFLGAAGSTMGAASLTLTVQARQLLSSIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRV LAIERYLKDQQLLGIWGCSGKLICTTNVPWNSSWSNKSQTDIWNNMTWMEWDREISNYTD TIYRLLEDSQTQQEKNEKDLLALDSWKNLWSWFDISNWLWYIKSRIEGRGSGGYIPEAPR DGQATVRKDGEWVLLSTFL 7 Mosaic AGKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVT gp140 ENFNMWKNNMVEQMHEDIISLWDQSLEPCVKLTPLCVTLNCTDDVRNVTNNATNTNSSWG EPMEKGEIKNCSFNITTSIRNRVQKQYALFYKLDVVPIDNDSNNTNYRLISCNTSVITQA CPKVSFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGS LAEEEVVIRSENFTNNAKTIMVQLNVSVEINCTRPNNNTRESIHIGPGRAFYTAGDIIGD IRQAHCNISRANWNNTLRQIVEKLGKQFGNNKTIVFNHSSGGDPEIVMHSFNCGGEFFYC NSTKLFNSTWTWNNSTWNNTKRSNDTEEHITLPCRIXQIINMWQEVGKAMYAPPIRGQIR CSSNITGLLLTRDGGNDTSGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKER VVQREERAVGIGAVFLGFLGAAGSTMGAASMTLTVQARLLLSGIVQQQNNLLRAIEAQQH LLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTTVPWNASWSNKSLDKIWN NMTWMEWEREINNYTSLIYTLIEESQNQQEKNEQELLELDKWASLWNWFDISNWLWYIKS RIEGRGSGGYIPEAPRDGQAYVREDGEWVLLSTFL 8 Mos1Env ATGCGGGTGACCGGCATCCGGAAGAACTACCAGCACCTGTGGCGGTGGGGCACCATGCTGCTGGGCATC (nucleic CTGATGATTTGCTCTGCCGCCGGAAAGCTGTGGGTGACCGTGTACTACGGCGTGCCCGTGTGGAAAGAG acid) GCCACCACCACCCTGTTCTGCGCCAGCGACGCCAAGGCCTACGACACCGAGGTGCACAACGTGTGGGCC ACCCACGCCTGCGTGCCCACCGACCCCAACCCCCAGGAAGTGGTCCTGGAAAACGTGACCGAGAACTTC AACATGTGGAAGAACAACATGGTGGAGCAGATGCACGAGGACATCATCAGCCTGTGGGACCAGAGCCTG AAGCCCTGCGTGAAGCTGACCCCCCTGTGCGTGACCCTGAACTGCACCGACGACGTGCGGAACGTGACC AACAACGCCACCAACACCAACAGCAGCTGGGGCGAGCCTATGGAAAAGGGCGAGATCAAGAACTGCAGC TTCAACATCACCACCTCCATCCGGAACAAGGTGCAGAAGCAGTACGCCCTGTTCTACAAGCTGGACGTG GTGCCCATCGACAACGACAGCAACAACACCAACTACCGGCTGATCAGCTGCAACACCAGCGTGATCACC CAGGCCTGCCCCAAGGTGTCCTTCGAGCCCATCCCCATCCACTACTGCGCCCCTGCCGGCTTCGCCATC CTGAAGTGCAACGACAAGAAGTTCAACGGCACCGGCCCCTGCACCAACGTGAGCACCGTGCAGTGCACC CACGGCATCCGGCCCGTGGTGTCCACCCAGCTGCTGCTGAACGGCAGCCTGGCCGAGGAAGAGGTGGTG ATCAGAAGCGAGAATTTCACCAACAATGCCAAGACCATCATGGTGCAGCTGAACGTGAGCGTGGAGATC AACTGCACCCGGCCCAACAACAACACCCGGAAGAGCATCCACATCGGCCCTGGCAGGGCCTTCTACACA GCCGGCGACATCATCGGCGACATCCGGCAGGCCCACTGCAACATCAGCCGGGCCAACTGGAACAACACC CTGCGGCAGATCGTGGAGAAGCTGGGCAAGCAGTTCGGCAACAACAAGACCATCGTGTTCAACCACAGC AGCGGCGGAGACCCCGAGATCGTGATGCACAGCTTCAACTGTGGCGGCGAGTTCTTCTACTGCAACAGC ACCAAGCTGTTCAACAGCACCTGGACCTGGAACAACTCCACCTGGAATAACACCAAGCGGAGCAACGAC ACCGAAGAGCACATCACCCTGCCCTGCCGGATCAAGCAGATTATCAATATGTGGCAGGAGGTCGGCAAG GCCATGTACGCCCCTCCCATCCGGGGCCAGATCCGGTGCAGCAGCAACATCACCGGCCTGCTGCTGACC CGGGACGGCGGCAACGATACCAGCGGCACCGAGATCTTCCGGCCTGGCGGCGGAGATATGCGGGACAAC TGGCGGAGCGAGCTGTACAAGTACAAGGTGGTGAAGATCGAGCCCCTGGGCGTGGCTCCCACCAAGGCC AAGCGGCGGGTGGTGCAGAGCGAGAAGAGCGCCGTGGGCATCGGCGCCGTGTTTCTGGGCTTCCTGGGA GCCGCCGGAAGCACCATGGGAGCCGCCAGCATGACCCTGACCGTGCAGGCCCGGCTGCTGCTGTCCGGC ATCGTGCAGCAGCAGAACAACCTGCTCCGGGCCATCGAGGCCCAGCAGCACCTGCTGCAGCTGACCGTG TGGGGCATCAAGCAGCTGCAGGCCAGGGTGCTGGCCGTGGAGAGATACCTGAAGGATCAGCAGCTCCTG GGGATCTGGGGCTGCAGCGGCAAGCTGATCTGCACCACCACCGTGCCCTGGAACGCCAGCTGGTCCAAC AAGAGCCTGGACAAGATCTGGAACAATATGACCTGGATGGAATGGGAGCGCGAGATCAACAATTACACC AGCCTGATCTACACCCTGATCGAGGAAAGCCAGAACCAGCAGGAAAAGAACGAGCAGGAACTGCTGGAA CTGGACAAGTGGGCCAGCCTGTGGAACTGGTTCGACATCAGCAACTGGCTGTGG 9 Mos2Env ATGAGAGTGCGGGGCATCCAGCGGAACTGGCCCCAGTGGTGGATCTGGGGCATCCTGGGCTTTTGGATG (nucleic ATCATCATCTGCCGGGTGATGGGCAACCTGTGGGTGACCGTGTACTACGGCGTGCCCGTGTGGAAAGAG acid) GCCAAGACCACCCTGTTCTGCGCCAGCGACGCCAAGGCCTACGAGAAAGAGGTGCACAACGTGTGGGCC ACCCACGCCTGCGTGCCCACCGACCCCAACCCCCAGGAAATGGTCCTGGAAAACGTGACCGAGAACTTC AACATGTGGAAGAACGACATGGTGGACCAGATGCACGAGGACATCATCCGGCTGTGGGACCAGAGCCTG AAGCCCTGCGTGAAGCTGACCCCCCTGTGCGTGACCCTGGAATGCCGGAACGTGAGAAACGTGAGCAGC AACGGCACCTACAACATCATCCACAACGAGACCTACAAAGAGATGAAGAACTGCAGCTTCAACGCCACC ACCGTGGTGGAGGACCGGAAGCAGAAGGTGCACGCCCTGTTCTACCGGCTGGACATCGTGCCCCTGGAC GAGAACAACAGCAGCGAGAAGTCCAGCGAGAACAGCTCCGAGTACTACCGGCTGATCAACTGCAACACC AGCGCCATCACCCAGGCCTGCCCCAAGGTGTCCTTCGACCCCATCCCCATCCACTACTGCGCCCCTGCC GGCTACGCCATCCTGAAGTGCAACAACAAGACCTTCAACGGCACCGGCCCCTGCAACAACGTGAGCACC GTGCAGTGCACCCACGGCATCAAGCCCGTGGTGTCCACCCAGCTGCTGCTGAACGGCAGCCTGGCCGAG GAAGAGATCATCATCCGGTCCGAGAACCTGACCAACAACGCCAAGACCATCATCGTGCACCTGAATGAG ACCGTGAACATCACCTGCACCCGGCCCAACAACAACACCCGGAAGAGCATCCGGATCGGCCCTGGCCAG ACCTTTTACGCCACCGGCGACATCATCGGCGACATCCGGCAGGCCCACTGCAACCTGAGCCGGGACGGC TGGAACAAGACCCTGCAGGGCGTGAAGAAGAAGCTGGCCGAGCACTTCCCCAATAAGACCATCAACTTC ACCAGCAGCAGCGGCGGAGACCTGGAAATCACCACCCACAGCTTCAACTGCAGGGGCGAGTTCTTCTAC TGCAATACCTCCGGCCTGTTCAATGGCACCTACATGCCCAACGGCACCAACAGCAACAGCAGCAGCAAC ATCACCCTGCCCTGCCGGATCAAGCAGATCATCAATATGTGGCAGGAGGTCGGCAGGGCCATGTACGCC CCTCCCATCGCCGGCAATATCACCTGCCGGTCCAACATCACCGGCCTGCTGCTGACCAGGGACGGCGGC AGCAACAACGGCGTGCCTAACGACACCGAGACCTTCCGGCCTGGCGGCGGAGATATGCGGAACAACTGG CGGAGCGAGCTGTACAAGTACAAGGTGGTGGAGGTGAAGCCCCTGGGCGTGGCTCCTACCGAGGCCAAG CGGCGGGTGGTGGAGAGCGAGAAGAGCGCCGTGGGCATCGGCGCCGTGTTTCTGGGCATTCTGGGAGCC GCCGGAAGCACCATGGGAGCCGCCAGCATCACCCTGACCGTGCAGGCCCGGCAGCTGCTGTCCGGCATC GTGCAGCAGCAGAGCAACCTGCTGAGAGCCATCGAGGCCCAGCAGCACATGCTGCAGCTGACCGTGTGG GGCATCAAGCAGCTGCAGACCCGGGTGCTGGCCATCGAGAGATACCTGCAGGATCAGCAGCTCCTGGGC CTGTGGGGCTGCAGCGGCAAGCTGATCTGCACCACCGCCGTGCCCTGGAACACCAGCTGGTCCAACAAG AGCCAGACCGACATCTGGGACAACATGACCTGGATGCAGTGGGACAAAGAGATCGGCAACTACACCGGC GAGATCTACAGGCTGCTGGAAGAGAGCCAGAACCAGCAGGAAAAGAACGAGAAGGACCTGCTGGCCCTG GACAGCTGGAAGAACCTGTGGAACTGGTTCGACATCACCAACTGGCTGTGG 10 Mos2SEnv ATGAGAGTGCGGGGCATGCTGAGAAACTGGCAGCAGTGGTGGATCTGGTCCAGCCTGGGCTTCTGGATG (nucleic CTGATGATCTACAGCGTGATGGGCAACCTGTGGGTCACCGTGTACTACGGCGTGCCCGTGTGGAAGGAC acid) GCCAAGACCACCCTGTTTTGCGCCTCCGATGCCAAGGCCTACGAGAAAGAGGTGCACAACGTCTGGGCC ACCCACGCCTGTGTGCCCACCGACCCCAATCCCCAGGAAATCGTCCTGGGCAACGTGACCGAGAACTTC AACATGTGGAAGAACGACATGGTCGATCAGATGCACGAGGACATCATCTCCCTGTGGGACGCCTCCCTG GAACCCTGCGTGAAGCTGACCCCTCTGTGCGTGACCCTGAACTGCCGGAACGTGCGCAACGTGTCCAGC AACGGCACCTACAACATCATCCACAACGAGACATACAAAGAGATGAAGAACTGCAGCTTCAACGCTACC ACCGTGGTCGAGGACCGGAAGCAGAAGGTGCACGCCCTGTTCTACCGGCTGGACATCGTGCCCCTGGAC GAGAACAACAGCAGCGAGAAGTCCTCCGAGAACAGCTCCGAGTACTACAGACTGATCAACTGCAACACC AGCGCCATCACCCAGGCCTGCCCCAAGGTGTCCTTCGACCCTATCCCCATCCACTACTGCGCCCCTGCC GGCTACGCCATCCTGAAGTGCAACAACAAGACCTTCAATGGCACCGGCCCCTGCAACAATGTGTCCACC GTGCAGTGCACCCACGGCATCAAGCCCGTGGTGTCTACCCAGCTGCTGCTGAACGGCAGCCTGGCCGAG GAAGAGATCATTATCAGAAGCGAGAACCTGACCAACAACGCCAAAACCATCATCGTCCACCTGAACGAA ACCGTGAACATCACCTGTACCCGGCCTAACAACAACACCCGGAAGTCCATCCGGATCGGCCCTGGCCAG ACCTTTTACGCCACCGGCGATATTATCGGCGACATCCGGCAGGCCCACTGCAATCTGAGCCGGGACGGC TGGAACAAGACACTGCAGGGCGTCAAGAAGAAGCTGGCCGAACACTTCCCTAACAAGACTATCAAGTTC GCCCCTCACTCTGGCGGCGACCTGGAAATCACCACCCACACCTTCAACTGTCGGGGCGAGTTCTTCTAC TGCAATACCTCCAACCTGTTCAACGAGAGCAACATCGAGCGGAACGACAGCATCATCACACTGCCTTGC CGGATCAAGCAGATTATCAATATGTGGCAGGAAGTGGGCAGAGCCATCTACGCCCCTCCAATCGCCGGC AACATCACATGCCGGTCCAATATCACCGGCCTGCTGCTCACCAGAGATGGCGGCTCCAACAATGGCGTG CCAAACGACACCGAGACATTCAGACCCGGCGGAGGCGACATGCGGAACAATTGGCGGAGCGAGCTGTAC AAGTACAAGGTGGTGGAAGTGAAGCCCCTGGGCGTGGCCCCTACCGAGGCCAAGAGAAGAGTGGTCGAA CGCGAGAAGCGGGCCGTGGGAATCGGAGCCGTGTTTCTGGGAATCCTGGGAGCCGCTGGCTCTACCATG GGCGCTGCCTCTATCACCCTGACAGTGCAGGCCAGACAGCTGCTCAGCGGCATCGTGCAGCAGCAGAGC AACCTGCTGAGAGCCATTGAGGCCCAGCAGCACATGCTGCAGCTGACCGTGTGGGGCATTAAGCAGCTC CAGACACGGGTGCTGGCCATCGAGAGATACCTGCAGGATCAGCAGCTCCTGGGCCTGTGGGGCTGTAGC GGCAAGCTGATCTGTACCACCGCCGTGCCCTGGAATACCTCTTGGAGCAACAAGAGCCAGACCGACATC TGGGACAACATGACCTGGATGCAGTGGGACAAAGAAATCGGCAACTATACCGGCGAGATCTATAGACTG CTGGAAGAGTCCCAGAACCAGCAGGAAAAGAACGAGAAGGACCTGCTGGCCCTGGATTCTTGGAACAAT CTGTGGAACTGGTTCAGCATCTCCAAGTGGCTGTGGTACATCAAGATCTTCATCATGATCGTGGGCGGC CTGATCGGCCTGCGGATCATCTTTGCCGTGCTGAGCATCGTGAACCGCGTGCGGCAGGGCTAC 11 Mos1 ATGGGAGCCAGAGCCAGCGTGCTGTCCGGAGGGGAGCTGGACCGCTGGGAGAAGATCAGGCTGAGGCCT GagPo1 GGAGGGAAGAAGAAGTACAGGCTGAAGCACATCGTGTGGGCCAGCAGAGAGCTGGAACGGTTTGCCGTG (nucleic AACCCTGGCCTGCTGGAAACCAGCGAGGGCTGTAGGCAGATTCTGGGACAGCTGCAGCCCAGCCTGCAG acid) ACAGGCAGCGAGGAACTGCGGAGCCTGTACAACACCGTGGCCACCCTGTACTGCGTGCACCAGCGGATC GAGATCAAGGACACCAAAGAAGCCCTGGAAAAGATCGAGGAAGAGCAGAACAAGAGCAAGAAGAAAGCC CAGCAGGCTGCCGCTGACACAGGCAACAGCAGCCAGGTGTCCCAGAACTACCCCATCGTGCAGAACATC CAGGGACAGATGGTGCACCAGGCCATCAGCCCTCGGACCCTGAACGCCTGGGTGAAGGTGGTGGAGGAA AAGGCCTTCAGCCCTGAGGTGATCCCCATGTTCTCTGCCCTGAGCGAGGGAGCCACACCCCAGGACCTG AACACCATGCTGAACACCGTGGGAGGGCACCAGGCTGCCATGCAGATGCTGAAAGAGACAATCAACGAG GAAGCTGCCGAGTGGGACAGGGTCCACCCAGTGCACGCTGGACCTATCGCTCCTGGCCAGATGAGAGAG CCCAGAGGCAGCGATATTGCTGGCACCACCTCCACACTGCAGGAACAGATCGGCTGGATGACCAACAAC CCTCCCATCCCTGTGGGAGAGATCTACAAGCGGTGGATCATTCTGGGACTGAACAAGATCGTGCGGATG TACAGCCCTGTGAGCATCCTGGACATCAGGCAGGGACCCAAAGAGCCCTTCAGGGACTACGTGGACCGG TTCTACAAGACCCTGAGAGCCGAGCAGGCCAGCCAGGACGTGAAGAACTGGATGACCGAGACACTGCTG GTGCAGAACGCCAACCCTGACTGCAAGACCATCCTGAAAGCCCTGGGACCTGCTGCCACCCTGGAAGAG ATGATGACAGCCTGCCAGGGAGTGGGAGGACCTGGCCACAAGGCCAGGGTGCTGGCCGAGGCCATGAGC CAGGTGACCAACTCTGCCACCATCATGATGCAGAGAGGCAACTTCCGGAACCAGAGAAAGACCGTGAAG TGCTTCAACTGTGGCAAAGAGGGACACATTGCCAAGAACTGCAGGGCTCCCAGGAAGAAAGGCTGCTGG AAGTGCGGAAAAGAAGGCCACCAGATGAAGGACTGCACCGAGAGGCAGGCCAACTTCCTGGGCAAGATC TGGCCTAGCAACAAGGGCAGGCCTGGCAACTTCCTGCAGAACAGACCCGAGCCCACCGCTCCTCCCGAG GAAAGCTTCCGGTTTGGCGAGGAAACCACCACCCCTAGCCAGAAGCAGGAACCCATCGACAAAGAGATG TACCCTCTGGCCAGCCTGAAGAGCCTGTTCGGCAACGACCCCAGCAGCCAGATGGCTCCCATCAGCCCA ATCGAGACAGTGCCTGTGAAGCTGAAGCCTGGCATGGACGGACCCAGGGTGAAGCAGTGGCCTCTGACC GAGGAAAAGATCAAAGCCCTGACAGCCATCTGCGAGGAAATGGAAAAAGAGGGCAAGATCACCAAGATC GGACCCGAGAACCCCTACAACACCCCTGTGTTCGCCATCAAGAAGAAAGACAGCACCAAGTGGAGGAAA CTGGTGGACTTCAGAGAGCTGAACAAGCGGACCCAGGACTTCTGGGAGGTGCAGCTGGGCATCCCTCAC CCTGCTGGCCTGAAGAAAAAGAAAAGCGTGACCGTGCTGGCTGTGGGAGATGCCTACTTCAGCGTGCCT CTGGACGAGGGCTTCCGGAAGTACACAGCCTTCACCATCCCCAGCACCAACAACGAGACACCTGGCATC AGATACCAGTACAACGTGCTGCCTCAGGGCTGGAAAGGCAGCCCTGCCATCTTCCAGTGCAGCATGACC AGAATCCTGGAACCCTTCAGAGCCAAGAACCCTGAGATCGTGATCTACCAGTATATGGCTGCCCTCTAC GTGGGCAGCGACCTGGAAATCGGACAGCACAGAGCCAAAATCGAAGAACTCCGCGAGCACCTGCTGAAG TGGGGATTCACCACCCCTGACAAGAAGCACCAGAAAGAGCCTCCCTTCCTGTGGATGGGCTACGAGCTG CACCCTGACAAGTGGACCGTGCAGCCCATCCAGCTGCCAGAGAAGGACTCCTGGACCGTGAACGACATC CAGAAACTGGTCGGCAAGCTGAACTGGGCCAGCCAGATCTACCCTGGCATCAAAGTCAGACAGCTGTGT AAGCTGCTGAGGGGAGCCAAAGCACTGACCGACATCGTGCCTCTGACAGAAGAAGCCGAGCTGGAACTG GCCGAGAACAGAGAGATCCTGAAAGAACCCGTGCACGGAGTGTACTACGACCCCTCCAAGGACCTGATT GCCGAGATCCAGAAACAGGGACACGACCAGTGGACCTACCAGATCTATCAGGAACCTTTCAAGAACCTG AAAACAGGCAAGTACGCCAAGATGCGGACAGCCCACACCAACGACGTGAAGCAGCTGACCGAAGCCGTG CAGAAAATCGCCATGGAAAGCATCGTGATCTGGGGAAAGACACCCAAGTTCAGGCTGCCCATCCAGAAA GAGACATGGGAAACCTGGTGGACCGACTACTGGCAGGCCACCTGGATTCCCGAGTGGGAGTTCGTGAAC ACCCCACCCCTGGTGAAGCTGTGGTATCAGCTGGAAAAGGACCCTATCGCTGGCGTGGAGACATTCTAC GTGGCTGGAGCTGCCAACAGAGAGACAAAGCTGGGCAAGGCTGGCTACGTGACCGACAGAGGCAGACAG AAAATCGTGAGCCTGACCGAAACCACCAACCAGAAAACAGCCCYGCAGGCCATCTATCTGGCACTGCAG GACAGCGGAAGCGAGGTGAACATCGTGACAGCCAGCCAGTATGCCCTGGGCATCATCCAGGCCCAGCCT GACAAGAGCGAGAGCGAGCTGGTGAACCAGATCATCGAGCAGCTGATCAAGAAAGAACGGGTGTACCTG AGCTGGGTGCCAGCCCACAAGGGCATCGGAGGGAACGAGCAGGTGGACAAGCTGGTGTCCAGCGGAATC CGGAAGGTGCTGTTCCTGGACGGCATCGATAAAGCCCAGGAAGAGCACGAGAAGTACCACAGCAATTGG AGAGCCATGGCCAGCGACTTCAACCTGCCTCCCGTGGTGGCCAAAGAAATCGTGGCCAGCTGCGACCAG TGCCAGCTGAAAGGCGAGGCCATGCACGGACAGGTGGACTGCTCCCCTGGCATCTGGCAGCTGGCATGC ACCCACCTGGAAGGCAAGATCATTCTGGTGGCCGTGCACGTGGCCAGCGGATACATCGAAGCCGAAGTG ATCCCTGCCGAGACAGGGCAGGAAACAGCCTACTTCATCCTGAAGCTGGCTGGCAGATGGCCTGTGAAG GTGATCCACACAGCCAACGGCAGCAACTTCACCTCTGCTGCCGTGAAGGCTGCCTGTTGGTGGGCTGGC ATTCAGCAGGAATTTGGCATCCCCTACAATCCCCAGTCTCAGGGAGTGGTGGCCAGCATGAACAAAGAG CTGAAGAAGATCATCGGACAGGTCAGGGATCAGGCCGAGCACCTGAAAACTGCCGTCCAGATGGCCGTG TTCATCCACAACTTCAAGCGGAAGGGAGGGATCGGAGGGTACTCTGCTGGCGAGCGGATCATCGACATC ATTGCCACCGATATCCAGACCAAAGAGCTGCAGAAACAGATCATCAAGATCCAGAACTTCAGGGTGTAC TACAGGGACAGCAGGGACCCCATCTGGAAGGGACCTGCCAAGCTGCTGTGGAAAGGCGAAGGAGCCGTC GTCATCCAGGACAACAGCGACATCAAGGTGGTGCCCAGACGGAAGGTGAAAATCATCAAGGACTACGGC AAACAGATGGCTGGAGCCGACTGTGTCGCTGGCAGGCAGGACGAGGAC 12 Mos2 ATGGGAGCCAGAGCCAGCATCCTGCGAGGAGGGAAGCTGGACAAGTGGGAGAAGATCAGGCTGAGGCCT GagPo1 GGAGGGAAGAAACACTACATGCTGAAGCACCTGGTCTGGGCCAGCAGAGAGCTGGAACGGTTTGCCCTC (nucleic AATCCTGGCCTGCTGGAAACCAGCGAGGGCTGCAAGCAGATCATCAAGCAGCTGCAGCCTGCCCTGCAG acid) ACAGGCACCGAGGAACTGCGGAGCCTGTTCAACACCGTGGCCACCCTGTACTGCGTGCATGCCGAGATC GAAGTGAGGGACACCAAAGAAGCCCTGGACAAGATCGAGGAAGAGCAGAACAAGAGCCAGCAGAAAACC CAGCAGGCCAAAGAAGCCGACGGCAAGGTCTCCCAGAACTACCCCATCGTGCAGAACCTGCAGGGACAG ATGGTGCACCAGCCCATCAGCCCTCGGACACTGAATGCCTGGGTGAAGGTGATCGAGGAAAAGGCCTTC AGCCCTGAGGTGATCCCCATGTTCACAGCCCTGAGCGAGGGAGCCACACCCCAGGACCTGAACACCATG CTGAACACCGTGGGAGGGCACCAGGCTGCCSTGCAGATGCTGAAGGACACCATCAACGAGGAAGCTGCC GAGTGGGACAGGCTGCACCCTGTGCACGCTGGACCTGTGGCTCCTGGCCAGATGAGAGAGCCCAGAGGC AGCGATATTGCTGGCACCACCTCCAATCTGCAGGAACAGATCGCCTGGATGACCAGCAACCCTCCCATC CCTGTGGGAGACATCTACAAGCGGTGGATCATCCTGGGACTGAACAAGATCGTGCGGATGTACAGCCCT ACCTCCATCCTGGACATCAAGCAGGGACCCAAAGAGCCTTTCAGGGACTACGTGGACCGGTTCTTCAAG ACCCTGAGAGCCGAGCAGGCCACCCAGGACGTGAAGAACTGGATGACCGACACCCTGCTGGTGCAGAAC GCCAACCCTGACTGCAAGACCATCCTGAGAGCCCTGGGACCTGGAGCCACCCTGGAAGAGATGATGACA GCCTGCCAGGGAGTGGGAGGACCCTCTCACAAGGCTAGGGTGCTGGCCGAGGCCATGAGCCAGACCAAC AGCACCATCCTGATGCAGCGGAGCAACTTCAAGGGCAGCAAGCGGATCGTGAAGTGCTTCAACTGTGGC AAAGAGGGACACATTGCCAGAAACTGTAGGGCACCCAGGAAGAAAGGCTGCTGGAAGTGCGGAAAAGAA GGCCACCAGATGAAGGACTGCACCGAGAGGCAGGCCAACTTCCTGGGCAAGATCTGGCCTAGCCACAAG GGCAGACCTGGCAACTTCCTGCAGAGCAGACCCGAGCCCACCGCTCCTCCAGCCGAGAGCTTCCGGTTC GAGGAAACCACCCCTGCTCCCAAGCAGGAACCTAAGGACAGAGAGCCTCTGACCAGCCTGAGAAGCCTG TTCGGCAGCGACCCTCTGAGCCAGATGGCTCCCATCTCCCCTATCGAGACAGTGCCTGTGAAGCTGAAG CCTGGCATGGACGGACCCAAGGTGAAACAGTGGCCTCTGACCGAGGAAAAGATCAAAGCCCTGGTGGAG ATCTGTACCGAGATGGAAAAAGAGGGCAAGATCAGCAAGATCGGACCCGAGAACCCCTACAACACCCCT ATCTTCGCCATCAAGAAGAAAGACAGCACCAAGTGGAGGAAACTGGTGGACTTCAGAGAGCTGAACAAG CGGACCCAGGACTTCTGGGAGGTGCAGCTGGGCATCCCTCACCCTGCTGGCCTGAAGAAAAAGAAAAGC GTGACCGTGCTGGCCGTGGGAGATGCCTACTTCAGCGTGCCTCTGGACGAGGACTTCAGAAAGTACACA GCCTTCACCATCCCCAGCATCAACAACGAGACACCTGGCATCAGATACCAGTACAACGTGCTGCCTCAG GGATGGAAGGGCTCTCCTGCAATCTTCCAGAGCAGCATGACCAAGATCCTGGAACCCTTCCGGAAGCAG AACCCTGACATCGTGATCTACCAGTACATGGCAGCCCTGTACGTCGGCAGCGACCTGGAAATCGGACAG CACCGGACCAAGATCGAAGAACTCAGGCAGCACCTGCTGCGGTGGGGATTCACCACCCCTGACAAGAAG CACCAGAAAGAGCCTCCCTTCCTGTGGATGGGCTACGAGCTGCACCCAGACAAGTGGACCGTGCAGCCC ATCGTGCTGCCTGAGAAGGACTCCTGGACCGTGAACGACATCCAGAAACTGGTCGGCAAGCTGAACTGG GCCAGCCAGATCTACGCTGGCATCAAAGTGAAGCAGCTGTGTAAGCTCCTGAGAGGCACCAAAGCCCTG ACCGAGGTGGTGCCACTGACAGAGGAAGCCGAGCTGGAACTGGCCGAGAACAGAGAGATCCTGAAAGAA CCCGTGCACGGAGTGTACTACGACCCCAGCAAGGACCTGATTGCCGAGATCCAGAAGCAGGGACAGGGA CAGTGGACCTACCAGATCTACCAGGAACCCTTCAAGAACCTGAAAACAGGCAAGTACGCCAGGATGAGG GGAGCCCACACCAACGACGTCAAACAGCTGACCGAAGCCGTGCAGAAGATCGCCACCGAGAGCATCGTG ATTTGGGGAAAGACACCCAAGTTCAAGCTGCCCATCCAGAAAGAGACATGGGAGGCCTGGTGGACCGAG TACTGGCAGGCCACCTGGATTCCCGAGTGGGAGTTCGTGAACACCCCACCCCTGGTGAAGCTGTGGTAT CAGCTGGAAAAAGAACCCATCGTGGGAGCCGAGACATTCTACGTGGCTGGAGCTGCCAACAGAGAGACA AAGCTGGGCAAGGCTGGCTACGTGACCGACAGAGGCAGGCAGAAAGTGGTGTCCCTGACCGATACCACC AACCAGAAAACAGCCCTGCAGGCCATCCACCTGGCTCTGCAGGACTCTGGCCTGGAAGTGAACATCGTG ACAGCCAGCCAGTATGCCCTGGGCATCATTCAGGCACAGCCTGACAAGAGCGAGAGCGAGCTGGTGTCT CAGATCATTGAGCAGCTGATCAAGAAAGAAAAGGTGTACCTGGCCTGGGTGCCAGCCCACAAGGGGATC GGAGGGAACGAGCAGGTGGACAAGCTGGTGTCCAGGGGCATCCGGAAGGTGCTGTTTCTGGACGGCATC GACAAAGCCCAGGAAGAGCACGAGAAGTACCACAGCAATTGGAGAGCCATGGCCAGCGAGTTCAACCTG CCTCCCATCGTGGCCAAAGAAATCGTGGCCTCTTGCGACAAGTGCCAGCTGAAAGGCGAGGCCATTCAC GGACAGGTGGACTGCAGCCCAGGCATCTGGCAGCTGGCCTGCACCCACCTGGAAGGCAAGGTGATCCTG GTGGCCGTGCACGTGGCCTCTGGATACATCGAAGCCGAAGTGATCCCTGCCGAGACAGGCCAGGAAACA GCCTACTTCCTGCTGAAGCTGGCTGGCAGGTGGCCTGTGAAAACCATCCACACAGCCAACGGCAGCAAC TTCACCTCTGCCACCGTGAAGGCTGCCTGTTGGTGGGCTGGCATTAAGCAGGAATTTGGCATCCCCTAC AACCCTCAGTCTCAGGGAGTGGTGGCCTCCATCAACAAAGAGCTGAAGAAGATCATCGGACAGGTCAGG GATCAGGCCGAGCATCTGAAAACAGCCGTCCAGATGGCCGTGTTCATCCACAACTTCAAGCGGAAGGGA GGGATCGGAGAGTACTCTGCTGGCGAGAGGATCGTGGACATTATCGCCAGCGATATCCAGACCAAAGAA CTGCAGAAGCAGATCACAAAGATCCAGAACTTCAGGGTGTACTACAGGGACAGCAGAGATCCCCTGTGG AAGGGACCTGCCAAGCTGCTGTGGAAAGGCGAAGGAGCCGTGGTCATCCAGGACAACAGCGACATCAAG GTGGTGCCCAGACGGAAGGCCAAGATCATCAGAGACTACGGCAAACAGATGGCTGGCGACGACTGCGTC GCCTCTAGGCAGGACGAGGAC