NEW ENZYMATIC PROCESS FOR PRODUCTION OF MODIFIED HOP PRODUCTS

20200095619 ยท 2020-03-26

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a process for producing a beer bittering agent via enzyme catalyzed bioconversion of hop-derived isoalpha acids to dihydro-(rho)-isoalpha acids and to the novel enzyme catalysts which may be employed in such a process.

    Claims

    1. A process for the preparation of dihydro-(rho)-isoalpha acids, comprising treating isoalpha acids with a ketoreductase enzyme or a microorganism expressing a gene that encodes the ketoreductase.

    2. The process according to claim 1, wherein the process is carried out in an aqueous system.

    3. The process according to claim 2, wherein the process is carried out under mild temperature and pH conditions.

    4. The process according to claim 1, comprising adding the ketoreductase enzyme and NADPH or NADP to a mixture of isoalpha acids followed by incubation.

    5. The process according to claim 1, comprising adding the ketoreductase enzyme and NADPH or NADP to a mixture of isoalpha acids in the presence of isopropanol for cofactor recycling, followed by incubation.

    6. The process according to claim 5, wherein the concentration of isoalpha acids, i.e. the substrate, is maximized to increase the volumetric productivity of the bioconversion.

    7. The process according to claim 5, wherein the concentration of the cofactor NADPH or NADP in the mixture is minimized to improve the economics of the bioconversion.

    8. The process according to claim 1, comprising adding the ketoreductase enzyme and NADPH or NADP to a mixture of isoalpha acids in the presence of another enzyme for cofactor recycling, followed by incubation.

    9. The process according to claim 1, comprising adding a whole cell biocatalyst, wherein the whole cell biocatalyst is an immobilized microorganism expressing the gene which encodes a ketoreductase, to a mixture of isoalpha acids followed by incubation.

    10. The process according to claim 1, comprising culturing a microorganism expressing the gene which encodes the ketoreductase and adding isoalpha acids to the culture.

    11. The process according to claim 1, comprising adding the ketoreductase enzyme, wherein the ketoreductase is thermostable, to an extract of isoalpha acids wherein heat is applied, and the mixture is incubated.

    12. The process according to claim 1, wherein the ketoreductase specifically reduces cis-isohumulone, cis-isocohumulone, and cis-isoadhumulone.

    13. The process according to claim 1, wherein the ketoreductase specifically reduces trans-isohumulone, trans-isocohumulone, and trans-isoadhumulone.

    14. The process according to claim 1, comprising adding a mixture of 2 or more ketoreductase enzymes in an amount effective to reduce a mixture of cis- and trans-isoalpha acids, to their respective dihydroisoalpha acids.

    15. The process according to claim 14, wherein the mixture of 2 or more ketoreductase enzymes produces a unique mixture of dihydroisoalpha acids that is distinct from that produced by chemical reducing agents, such as sodium borohydride.

    16. (canceled)

    17. (canceled)

    18. (canceled)

    19. A ketoreductase enzyme which comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16 SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22.

    20. The ketoreductase enzyme according to claim 19, wherein the reductase enzyme or microorganism expressing a gene which encodes the reductase can optionally have one or more differences at amino acid residues as compared to the ketoreductase of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO;8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22,

    21. The ketoreductase enzyme according to claim 20, wherein the ketoreductase is 99, 95, 90, 85, 80, 75 or 70 percent homologous to the ketoreductase of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22.

    22. The process according to claim 1, wherein the ketoreductase enzyme comprises the amino acid sequence of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22.

    23. The process according to claim 22, wherein the ketoreductase enzyme or microorganism expressing a gene which encodes the ketoreductase can optionally have one or more differences at amino acid residues as compared to the ketoreductase of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22.

    24. The process according to claim 23, wherein the ketoreductase is 99, 95, 90, 85, 80, 75 or 70 percent homologous to the ketoreductase of SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:22.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0045] FIG. 1 shows the enzyme catalyzed reduction of a representative epimer of isoalpha acids.

    [0046] FIG. 2 shows an SDS-PAGE analysis of purified reductases.

    [0047] FIG. 3 shows UPLC chromatograms for isoalpha acids incubated with (top two panels) and without (bottom two panels) reductase R20 for 24 hr at 30 C. Peaks corresponding to the product, dihydro-(rho)-isoalpha acids, are indicated.

    [0048] FIG. 4 shows a structural model of reductase R17 (dark gray, surface rendering) with a representative substrate (trans-isohumulone, black) and cofactor (NADPH, light gray) bound to the active site cavity.

    [0049] FIG. 5A shows UPLC chromatogram (A) for a ketoreductase that produces only one diastereomer of dihydro-(rho)-isoalpha acids and FIG. 5B shows UPLC chromatogram (B) for a ketoreductase that produces both diastereomers of dihydro-(rho)-isoalpha acids. Peaks corresponding to the product, dihydro-(rho)-isoalpha acids, are indicated.

    [0050] FIG. 6 shows an amino acid sequence alignment, generated with Clustal Omega (www.ebi.ac.uk/Tools/msa/clustalo/) of active ketoreductase homologs: R4, R17, R20, R21, and R23. A shared domain, containing 3 regions of good (solid line) or low homology (dashed line), are highlighted in boxes. An * (asterisk) indicates positions which have a single, fully conserved residue. A : (colon) indicates conservation between groups of strongly similar propertiesscoring >0.5 in the Gonnet PAM 250 matrix.A . (period) indicates conservation between groups of weakly similar propertiesscoring=<0.5 in the Gonnet PAM 250 matrix. Therefore the hierchy of conservation using these symbols is * (identical)>:(colon)>. (period).

    DETAILED DESCRIPTION OF THE INVENTION

    [0051] In this invention, a ketoreductase enzyme replaces the function of sodium borohydride and allows a more natural production method for the beverage additive, dihydro-(rho)-isoalpha acids. The enzyme may be any ketoreductase specifically reducing a ketone group to a hydroxy group of any or all isomers of isoalpha acid (co-, n- ad-, and cis/trans-). The enzyme may be derived from, but not limited to, bacteria, fungi, or plants. The enzyme may be cofactor dependent (NADH or NADPH) or independent.

    [0052] Herein, isoalpha acids, hop isoalpha acids, and hop-derived isoalpha acids may be used interchangeably.

    [0053] According to the instant invention, an isoalpha acid solution is subjected to enzymatic treatment using one or more purified enzyme or a mixture containing the enzyme(s) and optionally additional enzymes for cofactor recycling. The amount of enzyme depends on the incubation parameters including duration, temperature, amount and concentration of substrate.

    [0054] Alternatively, an isoalpha acid solution is subjected to enzymatic treatment using a mixture containing a microorganism expressing said enzyme(s). The invention furthermore provides a process for reducing isoalpha acids according to the invention, which comprises cultivating a ketoreductase-producing microorganism, if appropriate inducing the expression of the ketoreductase. Intact cells can be harvested and added directly to a reaction, in place of isolated enzyme, for the reduction of isoalpha acids as described above. Furthermore, the harvested cells can be immobilized prior to addition to a reduction reaction. The microorganism can be cultivated and fermented by known methods. The microorganism can be bacteria or fungi.

    [0055] A mixture of cis- and trans-isoalpha acids may be incubated with a single ketoreductase displaying the capacity to reduce both isomers. Alternatively, a mixture of cis- and trans-isoalpha acids may be incubated with 2 or more ketoreductases showing varying specificity where the resulting product is a mixture of cis- and trans-dihydroisoalpha acids.

    [0056] Alternatively, a solution containing only cis-isoalpha acids may be incubated with ketoreductase(s) specific for the cis-isomer, and the resulting product is a solution of cis-dihydroisoalpha acids. A solution of only cis-dihydroisoalpha acids may display advantageous bitterness and/or thermal stability properties.

    [0057] Alternatively, a solution containing only trans-isoalpha acids may be incubated with ketoreductase(s) specific for the trans-isomer, and the resulting product is a solution of trans-dihydroisoalpha acids. A solution of only trans-dihydroisoalpha acids may display advantageous bitterness properties.

    [0058] Customized blends of trans- and cis-isoalphacids may be incubated with 1 or more ketoreductases displaying variable substrate specificity, to produce unique blends of dihydroisoalpha acids otherwise unattainable.

    [0059] An isoalpha acid mixture may be subjected to an enzymatic reaction using ketoreductase enzyme(s) in addition to enzymes for catalyzing additional desired modifications, such as but not limited to, dehydrogenases, isomerases, hydratases and lyases. Enzymes of varying activity may be combined in a one pot reaction or added sequentially.

    [0060] A suitable solvent to use in enzyme incubation includes water and mixtures of water with another solvent compatible with the enzyme, such as ethanol or isopropanol. Enzymatic activity benefits from buffering of aqueous solutions. Buffering agents include, but are not limited to: tris(hydroxymethyl)aminomethane (aka. Tris), 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (aka. HEPES), sodium phosphate, and potassium phosphate.

    [0061] The enzyme(s) and isoalpha acids are incubated within a suitable pH range, for example pH 6 to 10, and temperature range, for example 10 to 90 C., and held at this temperature for a sufficient time to convert isoalpha acids to the desired dihydro-(rho)-isoalpha acids yield. Continuous stirring will ensure a constant temperature and exposure of substrate to enzyme. The reaction duration, typically 24 to 48 hours, will depend on the amount and concentration of the enzyme and substrate, solvent present, and temperature chosen.

    [0062] The enzyme(s) may be free in solution, immobilized onto beads or similar mixable scaffolds, or immobilized onto a film or resin over which a solution of isoalpha acids is passed. The purity level of the enzyme may vary from 30 to 90+% depending on the purification method.

    [0063] The enzyme(s) may be removed from the final product via physical filtering or centrifugation. The enzyme(s) may also be rendered inactive by extreme temperature or pH and remain in the final product.

    [0064] Reductase enzymes encompassed by the present invention include ketoreductase enzymes.

    [0065] Details for 23 successfully purified enzymes are listed in Table 1, including: shorthand label, sequence ID number, and amino acid sequence.

    TABLE-US-00001 TABLE1 Purifiedreductases. SEQ ID Label NO AminoAcidSequence R1 1 MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSP EEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW R2/3 2 MRLEGKVCLITGAASGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAEGLPGKVDPYVLNVTDR DQIKEVVEKVVQKYGRIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIKQ RNGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEKLP EKARETALSRIPLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGGLVI R4 3 MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDH VFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFD MAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNP VYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQ RLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKET IDDTASQILKFEGRI R5 4 MNQVVLVTGGSSGIGKSICLYLHEKGYIVYGTSRNPARYAHEVPFKLIALDVLDDTTITPALKTIIDA EGKLDVLVNNAGIGMLGSIEDSTAEEVKEVFETNVYGILRTCQAVLPHMRERKMGLIINVSSIAGY MGLPYRGIYSATKASVHMITEAMRMELKPYGVHACVVDPGDFATNISDNRKVAHAGRSGSVYM EEINRIEAMINAEVAHSSDPLLMGKAIEKIIRSSNPDINYLVGKPMQKLSILVRRLVPKKWFEKIIASH YNMPVK R6 5 MANSGEGKVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVSLEGAKERLHLFK ADLLEQGSFDSAIDGCHGVFHTASPFFNDAKDPQAELIDPAVKGTLNVLNSCAKASSVKRVVVTS SMAAVGYNGKPRTPDVTVDETWFSDPELCEASKMWYVLSKTLAEDAAWKLAKEKGLDIVTINPA MVIGPLLQPTLNTSAAAILNLINGAKTFPNLSFGWVNVKDVANAHIQAFEVPSANGRYCLVERVVH HSEIVNILRELYPNLPLPERCVDENPYVPTYQVSKDKTRSLGIDYIPLKVSIKETVESLKEKGFAQF R7 6 MTLSSAPILITGASQRVGLHCALRLLEHGHRVIISYRTEHASVTELRQAGAVALYGDFSCETGIMA FIDLLKTQTSSLRAVVHNASEWLAETPGEEADNFTRMFSVHMLAPYLINLHCEPLLTASEVADIVHI SDDVTRKGSSKHIAYCATKAGLESLTLSFAARFAPLVKVNGIAPALLMFQPKDDAAYRANALAKS ALGIEPGAEVIYQSLRYLLDSTYVTGTTLTVNGGRHVK R8 7 MSLQGKVALVTGASRGIGQAIALELGRQGATVIGTATSASGAERIAATLKEHGITGTGMELNVTSA ESVEAVLAAIGEQFGAPAILVNNAGITRDNLMLRMKDDEWFDVIDTNLNSLYRLSKGVLRGMTKA RWGRIISIGSVVGAMGNAGQANYAAAKAGLEGFSRALAREVGSRGITVNSVTPGFIDTDMTRELP EAQREALQTQIPLGRLGQADEIAKVVSFLASDGAAYVTGATVPVNGGMYM R9 8 MDLTNKVVVVTGGSAGLGEQICYEAAKQGAVVVVCARRINLIGKVREQCAVLSGREAFSYQLDIA DPESVERVVEAISAEVGPIDVLVNNAGFGLFENFVEIDLAVARQMFDVNVLGMMTFTQKVAIKMIE AGQGHIINVASMAGKMATAKSTVYSATKFAVLGFSNALRLELKPLGVAVTTVNPGPIQTEFFDKA DPTGTYLAAVDKIVLDPTKLAKEVVGSMGTSRREINRPFVMEAAARFYTLFPHLGDFIAGNILNKK R10 9 MRRILITGANGFVGQILCSMLRQAGHHVIALVGAESALSSHADESVRCDIRDASGLEQALCRAAP THVVHLAAITHVPTSFNNPVLTWQTNVMGSVNLLQALQRSAPEAFVLFVSSSEVYGETFKQGTAL GEDSACKPMNPYAASKLAAEAAFNEYFRQGRKGIVVRPFNHIGARQSPDFATASFARQIALIEAG KQAPQLKVGNLQAARDFLDVHDVCDAYVALLQLADEQERYPGCLNICRGEPTSLQTLLTQLMAL SSSVIEVTIDPDRMRPSDIPSAFGNNSAMRCATGWKPKTKLDDTLEALLNYWRHEVISAV R11 10 MSLLLEPYTLRQLTLRNRIAVSPMCQYSSVDGLANDWHLVHLGSRAVGGAGLVISEAMAVTPDG RITPEDLGLWNDEQIEPLQRITRFINTQGAVAGIQLAHAGRKASTWRPWLGKHGSVPLTEGGWT PVGPSAIAFDPQHTAPLQLSETQIQELIKAFVDSARRALTAGFKVVEIHAAHGYLLHQFLSPLSNQ RTDQYGGSFENRIRLTLQVTEAVRAVWPQELPLFVRVSATDWVEDGWNAEETVELARRLKALG TDLIDVSSGGTSANAEIPVGPGYQTRFAEQVRKEADIATGTVGMITDPAQAEHILRTGQADIILLAR ELLRDPYWPLRADEDLGGRQATWPAQYQRATHRDQPIHESDLRD R12 11 MSSSSLRVLAIGNNPNILFYTSRFQLAKNIDLYHVNDSKSCQFEIETEYYGKDRFELENHFTSIEHL TEALSSKSSEAVFDIIIMSAPSLQELSSLASKLTSIIDSNTKIFLESSGFIQLEPFVKLSMESPHVNVF SILTDLDIRQIGPNHFKHFPSTAKENTIYLGESKSSTEKYSSGVITLLTTFEKLFAKLFSNIKINLCNF SSIEFLSQQWKLAISRICFDPLLIMFEQENPSDLDQQIIAKPLISGLVTEIITVAKTMGARLNSSHDN ENSLLSLWKNSYHSTNKPPALVYHFIHQTTPLNIDILLLQTILLADDFGIKTPYLEFLYSVLSQFERL NSG R13 12 MEYRKVGKWGVKISELSLGSWLTFGKQLDLDTATEVVKKAFNSGINFFDTAEAYAGGIAEAMLG KILKNFRREDLVVSTKIFWGGSGPNDLGLSKKHLLEGTWNSLKRLQMDYVDILYCHRPDPNVPM EEVVFAMDYILREGLALYWGTSEWSAKEIEEAHRVCKELGVMPPIVEQPQYNMFVRERVEKEYA PLYEKYGMGLTTYSPLASGLLSGKYNNGIPEGSRLATFPQVRKWLEEGGLLNEKTFKKLRKLQNI ADQLGASLPQLAIAWILKNKNVSSVILGVSRPEQLEENLKAVEIKEKLTEDVMEEIEKILNE R14 13 MTLANLPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAGFLQPLGNVGQISFAQANLR YRDSIIKAVEDADHVVNCVGILAESGRNTFDAVQEFGAKAIAEAARDTGATLTHISAIGADANSQT GYGRTKGRAEAAIHSVLPGAVILRPSIIFGPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVYVED VAEAVARSVDGKLKPGAIYELGGPDVMTFRDCLEAVLAATYRERSFVNLPFGVASMIGKLASLVP LITPPLTPDQVTMLKKDNVVSAEAEKKGLTLEGIGITPVRVASVLPSYMVQYRQHGQFSNAGKAA R15 14 MTAEVFDPRALRDAFGAFATGVTVVTASDAAGKPIGFTANSFTSVSLDPPLLLVCLAKSSRNYES MTSAGRFAINVLSETQKDVSNTFARPVEDRFAAVDWRLGRDGCPIFSDVAAWFECSMQDIIEAG DHVIIIGRVTAFENSGLNGLGYARGGYFTPRLAGKAVSAAVEGEIRLGAVLEQQGAVFLAGNETL SLPNCTVEGGDPARTLAAYLEQLTGLNVTIGFLYSVYEDKSDGRQNIVYHALASDGAPRQGRFLR PAELAAAKFSSSATADIINRFVLESSIGNFGIYFGDETGGTVHPIANKDAHS R16 15 MDEVILVTGAAKGIGLATVKRLSSQGARVILNVHHEIEATDWQALTAEYPRLTQLVGDVSDDQSA ANLIDTVMTNFGRLDGLVNNAGVTHDQLLTRLHAEDFMSVIQTNLLGTFNMTKYALKVMQRQRQ GAIVNVASVVGLHGNVGQANYAASKAGIIGLTKTTAKEAARRQVRCNAVAPGMITTAMTAQLNDR VTAAALSDIPLKRFGTPDEIAQAIDFLLHQPYLTGQVLTVDGGMTI R17 16 MRVLLTGGSGFIAAHILDILLSRGHTVITTVRSQQKIDAIKAAHPDVPASKLDFFIVEDIAKENAFDE CLKKFGEGLEAVLHTASPFHFNVTDTKKDLLDPAIIGTTAILHAIKKFAPSVTRVVVTSSFASIIDASK GNWPDHTYTEEDWNPITLSEAVENPSNGYRASKTFAEKAAWEFVEKENPNFTLSTMNPPLVLG PIVHYLNSLDALNTSNQRVRDVLQGKWKEEIPGTGTFIWIDVRDLALAHVKAIEIAEAAGKRFFITE GYFSNKEICEIIRKNFPEDGGELPGKEVKGGGYPEGGIYKFDNARTRSVLGLEFRGLEESIVDLVK SLKEVGV R18 17 MSRNLALVTGSTQGIGLAVAKELAIKHNYQVLLGVRNTKAGEEIASDLRKEGHEASVVELDLTSA DSIDKAVKHIDEKYGYLDVLINNAGVLLDRQEGLSTWDLFSKTFTTNVFGTGCLTQSLLPLLRKAK NSPPRIVFVTSVMGSLTKATDETTTYYNIDYKAYDASKAAVNMLMFNFARELDAVGGKVNSVCP GLVKTGLTNYHEWGTSPETGAERIVEMATIGEDGPTKTISDRNGELPL R19 18 MDLQNKRVLVTGSTQGIGAATALAFAQKGCQVLLNGRRPELPEEIADQLEKIGADYQYFSADVSD EGAIKQLFKEIGEIDILVNNAGITKDQIMIGMKLADFDQVIKVNLRSSFMLTQKALKKMLKKRSGAII NMASIVGQHGNAGQANYAASKAGVIALTQTAAKEAAGRGVRVNAIAPGMIASQMTAVLPDEVKE QALSQIPLARFGKAEEVAQAAVFLAENDYVTGQTLVVDGGMTI R20 19 MTKVLVAGGSGFIGAHILEQLLAKGHSVVTTVRSKEKAQKILDAHKAEADRLEVAIVPEIAREDAF DEVVKTPGIEVVIHPASPCHLNFTDPQKELIDPAVLGTTNILRAIKRDAPQVRRVIITSSVAAIFNTK DPVSTLTEQSWNPNDLSNIHDSRAVAYCVSKTLAERAAWDYVDQEKPNFDLVTVNPPLVLGPVV GHFSNVDSINASNECLANLVRGKWRDEIPPTGPVNIWIDVRDVAAAHVRAMERQEAGGKRLFTV GGRFSYTKIAEIVREHGPDRFKDKMPRAEARSGDANYTGPVLKFDNGETNRILGIEWTPLEKSVL DFVESIKEFDL R21 20 MTKVLLTGGSGFIAAHILEQLLAKNYTVITTVRTKSKADLIKEAHADLVKSGRLSVAIVPDIAVLSAF DDLVAKIASGPDGDLEYVVHTASPLFFTFTDAQKEIITPALNGTRGILEAVKRSAPKVKRVVITSSF AAILSEDDFTNPNATFSESSWNPDTVKDANRSIATGYHVSKVESERLAWDFIKNEKPNFDLVTVN PPLVLGPVAHSLASVDAINASNERIADLLRGKWKAEIPETGAVDLYIDVRDTAKAHIKALELPEASG HRLFPVASRTSNHEIAKIIRDNFPEFAERLPGPEVKGGEHVDENKAYKWNCDETNKLLKIDWIPIE QSMIDTVNSLKDKGI R22 21 MPTVSPGSKVLVTGANGFIAIWVVRRLLEEGYSVRGTVRAASKASHLKDIFKSYGEKLEVVVVPD FTKEGAFDELIKGMDAIQHIASPGPANTDDLYEIVNPAVDGTLNLLNTALKHGSGLKRIVITSGAGA IIDTTTAWKFYNDHKNVIKWDLTVLNPVFVFGPPIHEIGASPMTLNSSMVHFWVNVISTDTPKTKE GLSFAASWVDVRDVAQGHVLALQKEAAGGERIILSEGSFVWQDWVDVANKFKSKRELPKGMPE IERVYKFQMDASKATRILGITYRSKEDTMKDLLEDFERRGW R23 22 MKVLLTGGSGFIATHCLDALLKHGHEVVITVRSAEKGQALVDLFKGQKVSYTIVKDISVPGAFDQA VISDPPFDAVVHTASPFHYDVQDNKRDLLDPAIIGTTGILESIQKGAPSVKKVVVTSSFAAISNPTA PPKVYDETVWNQMTMEEALTTKDPQAVYRGSKTFAEKAAWEFVEREKPNFTLTVLNPPVSHFLF SRHKDVAVTFFSDSFQHCRWSTARSCTPWHHWTISTPRASES

    [0066] Almost all candidates were sufficiently pure (>80% protein content is the protein of interest) after one-step purification (See FIG. 2).

    [0067] Reductase enzymes encompassed by the present invention include those comprising the following amino acid sequences: SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, and SEQ ID NO:22.

    [0068] Reductase enzymes encompassed by the present invention also include those having one or more differences at amino acid residues as compared to the following amino acid sequences: SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, and SEQ ID NO:22.

    [0069] Reductase enzymes encompassed by the present invention also include those comprising an amino add sequence which is identical by at least 40% (including at least 50%, at least 60%, at least 70%, at least 80%, al least 85%, at least 90%, and at least 95%) to the following amino acid sequences: SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:20, and SEQ ID NO:22.

    [0070] As used herein, percentage of sequence homology, percent homology, and percent identical refer to comparisons between polynucleotide sequences or polypeptide sequences, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Determination of optimal alignment and percent sequence homology is performed using the BLAST and BLAST 2.0 algorithms (See e.g., Altschul et al., J. Mol. Biol. 215: 403-410 [1990]; and Altschul et al., Nucleic Acids Res. 3389-3402 [1977]). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.

    [0071] Promiscuous enzymes may catalyze the same chemical reaction despite possessing low shared amino acid identity. Ketoreductase R4 (SEQ ID NO:3) was initially selected for screening due to its promiscuous nature [Guo et al. Biochim. Biophys. Acta 2014, 1844]. Five additional ketoreductases (R17 (SEQ ID NO:16), R20 (SEQ ID NO:19), R21 (SEQ ID NO:20), R22 (SEQ ID NO:21) and R23 (SEQ ID NO:22)) that contain the same enzyme domain (IPR001509: NAD-dependent epimerase/dehydratase) and share amino acid identity to R4 (SEQ ID NO:3) were acquired as synthetic genes, purified and characterized. Reductases were purposely selected at increasingly lower sequence identity in order to establish a sequence identity cutoff.

    [0072] Despite sharing a relatively low percent identity (34-39% over entire length of the enzyme) to R4 (SEQ ID NO:3), enzymes R17 (SEQ ID NO:16), R20 (SEQ ID NO:19), R21 (SEQ ID NO:20) and R23 (SEQ ID NO:22) catalyze the transformation of isoalpha acids to dihydro-(rho)-isoalpha acids . R22 (SEQ ID NO:21) which shares 33% identity to R4 (SEQ ID NO:3) does not catalyze the transformation of isoalpha acids to dihydro-(rho)-isoalpha acids but is otherwise an active enzyme as purified (established by measuring enzyme-catalyzed oxidation activity of isopropanol).

    [0073] A feature that separates functional from nonfunctional reductases for obtaining dihydro-(rho)-isoalpha acids is illustrated by a multiple sequence alignment (FIG. 6). Ketoreductase R4 (SEQ ID NO:3), and all R4 (SEQ ID NO:3) homologs characterized as capable of converting isoalpha acids to dihydro-(rho)-isoalpha acids herein, possess a domain occurring between residues 100 and 200, composed of 13 amino acids of good homology (>53% identity) and 9 amino acids of high homology (>55%) separated by 36-39 amino acids of low homology (38-46%). This domain is missing in the nonfunctional R22 polypeptide (SEQ ID NO:21). The domain is thus deemed a hallmark of ketoreductase activity for obtaining dihydro-(rho)-isoalpha acids.

    [0074] Specific embodiments disclosed herein may be further limited in the claims using consisting of or and consisting essentially of language. When used in the claims, whether as filed or added per amendment, the transition term consisting of excludes any element, step, or ingredient not specified in the claims. The transition term consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s). Embodiments of the invention so claimed are inherently or expressly described and enabled herein.

    [0075] As used herein, the term comprising or comprises is intended to mean that the compositions and methods include the recited elements, but not excluding others.

    [0076] The term effective amount refers to that quantity of a reductase which is sufficient to transform isoalpha acids into dihydro-(rho)-isoalpha acids. Determination of an effective amount for a given administration is well within the ordinary skill in the pharmaceutical arts.

    [0077] In a method for preparing dihydro-(rho)-isoalpha acids, an isoalpha acid solution is subjected to enzymatic treatment using one or more purified reductase enzymes or a mixture containing a reductase enzyme(s) and optionally additional enzymes for cofactor recycling, in an amount effective to transform the isoalpha acids into dihydro-(rho)-isoalpha acids. The amount of enzyme depends on the incubation parameters including duration, temperature, amount and concentration of substrate.

    [0078] Alternatively, an isoalpha acid solution is subjected to enzymatic treatment using a mixture containing a microorganism expressing said enzyme.

    [0079] A mixture of cis- and trans-isoalpha acids may be incubated with a single reductase/ketoreductase displaying the capacity to reduce both isomers. Alternatively, a mixture of cis- and trans-isoalpha acids may be incubated with 2 or more ketoreductases showing varying specificity where the resulting product is a mixture of cis- and trans-dihydroisoalpha acids.

    [0080] Customized blends of trans- and cis-isoalphacids may be incubated with 1 or more reductases/ketoreductases displaying variable substrate specificity, to produce unique blends of dihydroisoalpha acids otherwise unattainable.

    [0081] An isoalpha acid mixture may be subjected to an enzymatic reaction using a reductase enzyme in addition to enzymes for catalyzing additional desired modifications, such as but not limited to, dehydrogenases, isomerases, hydratases and lyases. Enzymes of varying activity may be combined in a one pot reaction or added sequentially.

    [0082] A suitable solvent to use in the enzyme incubation includes water and mixtures of water with another solvent compatible with the enzyme, such as ethanol or isopropanol. Enzymatic activity benefits from buffering of aqueous solutions. Buffering agents include, but are not limited to: tris(hydroxymethyl)aminomethane (aka. Tris), 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (aka. HEPES), sodium phosphate, and potassium phosphate.

    [0083] The enzyme and isoalpha acids are incubated within a suitable pH range, for example pH 6 to 10, and temperature range, for example 10 to 90 C., and held at this temperature for a sufficient time to convert isoalpha acids to the desired dihydro-(rho)-isoalpha acids yield. Continuous stirring will ensure a constant temperature and exposure of substrate to enzyme. The reaction duration, typically 24 to 48 hours, will depend on the amount and concentration of the enzyme and substrate, solvent present, and temperature chosen.

    [0084] The reductase enzyme may be free in solution, immobilized onto beads or similar mixable scaffolds, or immobilized onto a film or resin over which a solution of isoalpha acids is passed. The purity level of the enzyme may vary from 30 to 90+% depending on the purification method.

    [0085] The reductase may be removed from the final product via physical filtering or centrifugation. The enzyme may also be rendered inactive by extreme temperature or pH and remain in the final product.

    [0086] The present invention is a novel method of utilizing reductases to transform isoalpha acids into dihydro-(rho)-isoalpha acids. Codon optimized reductase genes have achieved yields of upwards of 100 mg purified enzyme per L cell culture in E. coli BL21(DE3). All enzymes were characterized with NADPH as the cofactor. The reductases characterized in this study possess an enzymatic activity that has not been described previously. These enzymes form a basis for the novel biocatalysts which may be utilized in a novel biotransformation to replace current processes utilizing sodium borohydride.

    EXAMPLES

    [0087] The following examples illustrate the invention without limiting its scope.

    Example 1Reductase Preparation and Screening Methods

    Candidate Identification

    [0088] Reductase candidates were selected after an extensive search of the literature for characterized enzymatic reactions of a similar nature to the desired reaction, followed by bioinformatic mining of three public protein sequence databases: UniProt (www.uniprot.org/), Pfam (//pfam.xfam.org/), and InterPro (www.ebi.ac.uk/interpro/E. coli). Bioinformatics relied on BLASTP sequence alignments (//blast.ncbi.nlm.nih.gov/Blast.cgi) between characterized enzymes and reductase candidates.

    Enzyme Expression and Purification

    [0089] Plasmid DNA was acquired in several manners: 1) in an expression vector from the DNASU Plasmid Repository (www.dnasu.org), 2) in a cloning vector from DNASU Plasmid Repository and subsequently cloned into an in-house expression vector, 3) as a synthetic gene in an expression vector from Atum (www.atum.bio), or 4) as a synthetic gene in an expression vector from General Biosystems (www.generalbiosystems.com). Synthetic genes were codon-optimized for expression in E. coli.

    [0090] 5 mL Luria Broth with appropriate antibiotics was inoculated from an agar plate of E. coli BL21 (DE3) containing the expression vector of interest and incubated at 30 C. with shaking overnight. The following day, the overnight culture was back-diluted 1:100 into fresh 0.5 L Luria Broth with antibiotics and incubated at 37 C. for 2-3 hr with 220 rpm shaking until an optical density of 0.5 was reached. Cultures were induced with 0.2 mM final concentration of isopropyl -D-1-thiogalactopyranoside (IPTG) and incubated at 25 C. with 180 rpm shaking for 16 h. Cells were harvested by centrifugation at 4800 rpm for 15 min. The cell pellet was resuspended in 12 mL of Bind Buffer (10 mM HEPES, 50 mM NaCl, pH 7.5) and cells were lysed via sonication for 15 min (5 sec on, 5 sec off). Cell lysate was clarified via centrifugation at 10,000 rpm for 20 min. Tagged protein was purified from clarified cell lysate via cobalt affinity, maltose affinity, or glutathione affinity chromatography. Protein solutions were exchanged into Protein Storage Buffer (20 mM Tris-HCl, 50 mM NaCl pH 7.0) via centrifugal filtration. Protein concentration was measured via absorbance at 280 nm using extinction coefficients calculated by using the appropriate amino acid sequence. Glycerol added to a final concentration of 20% and enzyme solutions frozen at 20 or 80 C.

    Isoalpha Acids Reduction Assay

    [0091] Purified enzyme candidates were tested for their ability to reduce isoalpha acids. The specific reaction entails reducing a specific ketone group to a hydroxy group of any or all isomers and congeners of isoalpha acid (co-, n- ad-, and cis/trans-). In a 2 mL microcentrifuge tube, 100 uL of enzyme solution (final concentration of 0.15-1.8 mg/mL enzyme) was added to 900 uL of buffered aqueous solution with cofactor recycling by glucose dehydrogenase (263 mM sodium phosphate, 1.7 mM magnesium sulfate, 1.1 mM NADP+, 1.1 mM NAD+, 80 mM D-glucose, 4.3 U/mL glucose dehydrogenase, pH 7.0). 5 uL of alkaline isoalpha acid solution (ISOLONE, 29% isoalpha acids) was added for a final concentration of 0.29% isoalpha acids. The reaction was incubated at 30 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture was filtered to remove enzyme. Isoalpha acids and dihydro-(rho)-isoalpha acids were detected by UPLC-MS/MS. A negative control sample contains all the above reaction components where the enzyme solution was replaced with Protein Storage Buffer.

    Results

    Candidate Selection

    [0092] Based on public functional annotations and amino acid sequence similarity, 60 unique enzyme sequences were identified as being reductase candidates.

    Enzyme Expression and Purification

    [0093] 30 candidates were selected for expression and purification based on the availability of DNA and sufficient sampling of the diversity of amino acid sequences represented in the initial group of 60 candidates. Most candidates displayed good expression and solubility levels in the E. coli BL21(DE3) with yields varying from 5 to 100 mg purified protein per liter culture. Several candidates were abandoned due to poor solubility in the host organism.

    Reductase Characterization

    [0094] Enzymes were determined to reduce isoalpha acids if peaks corresponding to cis/trans- co/ad/n-dihydro-(rho)-isoalpha acid were detected via UPLC at a greater intensity than a control sample lacking enzyme. Ten unique enzymes were determined to be isoalpha acid reductases (See FIG. 3). Details of these enzymes are summarized in Table 2. Due to solubility and enzyme yield, the final concentration of in-house enzymes in the assay varied from 0.15-1.8 mg/mL. Lower enzyme concentration contributes to the dihydro-(rho)-isoalpha acids yield.

    [0095] Enzymes were initially tested for reductase activity in the presence of glucose, glucose dehydrogenase, and NAD in order to recycle the NADP required for isoalpha acid reduction. After determination of reductase activity, enzymes were characterized for their ability to oxidize isopropanol, a more economical alternative for cofactor recycling. Ability to efficiently oxidize isopropanol is indicated in Table 2.

    TABLE-US-00002 TABLE 2 Novel isoalpha acid reductases characterized. Label Isoalpha Acid Reduction Isopropanol Oxidation R2 Yes No R4 Yes Yes R7 Yes No R9 Yes Yes R13 Yes No R14 Yes Yes R17 Yes Yes R20 Yes Yes R21 Yes Not Tested R23 Yes Not Tested

    Substrate Specificity

    [0096] The ideal ketoreductase for biotransformation purposes shows no substrate specificity for the isohumulone congeners which vary based on side chain composition (conferring n-, ad-, and co-isohumulone). Additionally, the ketoreductase shows no specificity for the isohumulone cis and trans isomers which vary spatially at the C4 tertiary alcohol group proximal to the site of enzymatic reduction. Substrate specificity is dictated by the amino acid sequence and thus the geometry of the substrate binding pocket of an enzyme. Larger binding pockets accommodate larger substrates, as well as a greater variety of substrates, compared to more restricted binding pockets. (See FIG. 4).

    [0097] Two varieties of reduction stereospecificities were observed among the characterized reductases (See FIG. 5).

    [0098] Despite the presence of two additional ketone groups on the isoalpha acid molecule, only the desired reduction at the C4 side chain was observed for all characterized ketoreductases.

    Example 2Enzyme Treatment of Hop Derived Isoalpha Acids with Cofactor Recycling by Isopropanol Oxidation

    [0099] In a 1.5 mL microcentrifuge tube, 10 mg reductase is resuspended in 700 uL of buffered aqueous solution (eg. Sodium Phosphate pH 7.5). 290 uL of isopropanol is added. 10 uL of alkaline isoalpha acid solution (29% isoalpha acids) is added for a final concentration of 0.29% isoalpha acids. The reaction is incubated at 30 C. with orbital shaking at 180 rpm for 48 hours. The obtained reaction mixture is filtered to remove enzyme. Isoalpha acids and dihydro-(rho)-isoalpha acids are quantified by HPLC.

    Example 3Enzyme Treatment of Acidified Hop Derived Isoalpha Acids with Cofactor Recycling by Isopropanol Oxidation

    [0100] Isoalpha acids are treated in a manner described in Example 2, where the source of isoalpha acids is a highly concentrated material (68.9% isoalpha acids) having a pH<7.

    Example 4Enzyme Treatment of Hop Derived Isoalpha Acids with Cofactor Recycling by Glucose Dehydrogenase

    [0101] Isoalpha acids are treated in a manner described in Example 2, with the exception that isopropanol is replaced with 4.3 U/mL Glucose Dehydrogenase, 0.7 g/L mM NAD, and 14.4 g/L D-glucose.

    Example 5Enzyme Treatment of Hop Derived Isoalpha Acids without Cofactor Recycling

    [0102] Isoalpha acids are treated in a manner described in Example 2, with the exception that isopropanol is replaced with an equimolar amount of NADPH as substrate.

    Example 6Enzyme Treatment of Hop Derived Isoalpha Acids with Thermostable Reductase

    [0103] Naturally thermostable reductases are obtained from thermophilic bacterial and archaeal organisms, such as Thermotoga maritima. In a 1.5 mL microcentrifuge tube, 100 uL enzyme solution (1.5-15.0 mg/mL enzyme) is added to 900 uL of buffered aqueous solution (263 mM Sodium Phosphate pH 7.0, 1.7 mM magnesium sulfate, 4.3 U/mL Glucose Dehydrogenase, 1.1 mM NADP+, 1.1 mM NAD+, 80 mM D-glucose). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 60-80 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is filtered to remove enzyme.

    Example 7Enzyme Treatment of Hop Derived Isoalpha Acids with Cofactor Recycling by Ethanol Oxidation

    [0104] Isoalpha acids are treated in a manner described in Example 2, with the exception that isopropanol is replaced with ethanol.

    Example 8Enzyme Treatment of Hop Derived Isoalpha Acids with Immobilized Ketoreductase Via SiO.SUB.2

    [0105] A ketoreductase is adsorbed on SiO.sub.2 and crosslinked with glutaraldehyde to yield an immobilized ketoreductase material. Isoalpha acids are treated with the immobilized ketoreductase in a manner described in Example 2. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 9Enzyme Treatment of Hop Derived Isoalpha Acids with Immobilized Ketoreductase Via DEAE-Cellulose

    [0106] A ketoreductase is crosslinked with glutaraldehyde and adsorbed onto DEAE-cellulose to yield an immobilized ketoreductase material. Isoalpha acids are treated with the immobilized ketoreductase in a manner described in Example 2. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 10Enzyme Treatment of Hop Derived Isoalpha Acids with Immobilized Ketoreductase Via PEI-Treated Alumina

    [0107] A ketoreductase is crosslinked with glutaraldehyde and adsorbed onto polyethylimine (PEI)-treated alumina to yield an immobilized ketoreductase material. Isoalpha acids are treated with the immobilized ketoreductase in a manner described in Example 2. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 11Enzyme Treatment of Hop Derived Isoalpha Acids with Co-Immobilized Enzymes

    [0108] A reductase and cofactor recycling enzyme, such as glucose dehydrogenase, are immobilized sequentially or together in a single composition utilizing any of the above-mentioned methods to yield a coimmobilized material. Coimmobilized material is added to a concentration of 0.1-10 mg/mL in buffered aqueous solution (50-250 mM sodium phosphate, 0.1-1.0 mM NADPH, 10-40% isopropanol, pH 7-9). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 12 Enzyme Treatment of Hop Derived Isoalpha Acids with Crosslinked/Spheronized Cells

    [0109] A cell (bacterial, fungal, plant) expressing the reductase is crosslinked with polyamine/glutaraldehyde, extruded and spheronized to yield an immobilized reductase material. Immobilized reductase is added to a concentration of 0.1-10 mg/mL in buffered aqueous solution (50-250 mM sodium phosphate, 0.1-1.0 mM NADPH, 10-40% isopropanol, pH 7-9). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 13Enzyme Treatment of Hop Derived Isoalpha Acids with Crosslinked/Entrapped Cells

    [0110] A cell (bacterial, fungal, plant) expressing the reductase is crosslinked with glutaraldehyde and entrapped within gelatin or polymer beads to yield an immobilized reductase material. Immobilized reductase is added to a concentration of 0.1-10 mg/mL in buffered aqueous solution (50-250 mM sodium phosphate, 0.1-1.0 mM NADPH, 10-40% isopropanol, pH 7-9). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is centrifuged at 10,000 g to remove immobilized enzyme.

    Example 14Enzyme Treatment of Hop Derived Isoalpha Acids with Living Cells

    [0111] A microorganism (bacteria, fungus) expressing the reductase is grown via fermentation to high density, harvested, washed, and pelleted to form cell paste. Cell paste is resuspended in fresh growth media containing 0.145-16% isoalpha acids. The cell culture is incubated at 25-37 C. with mixing for 24-72 hours. The cell culture is centrifuged at 10,000 g to remove cells from spent growth media. Dihydro-(rho)-isoalpha acids are extracted from the spent growth media with ethanol.

    Example 15Enzyme Treatment of Hop Derived Isoalpha Acids with Cell Lysate

    [0112] A microorganism (bacteria, fungus) expressing the reductase is grown via fermentation to high density, harvested, washed, and lysed to yield a crude cell lysate. Isoalpha acids are added to the crude cell lysate to a final concentration of 0.145-16% isoalpha acids. The cell culture is incubated at 25-40 C. with mixing for 24 hours. The reaction mixture is centrifuged at 10,000 g or filtered to remove cellular material from the lysate. Dihydro-(rho)-isoalpha acids are extracted from the clarified lysate with ethanol.

    Example 16Enzyme Treatment of Hop Derived Isoalpha Acids with Psychrophilic Reductase

    [0113] Enzyme treatment where the reductase is a homolog from a psychrophilic (cold tolerant) microorganism. Reductase is added to a concentration of 0.1-10 mg/mL in buffered aqueous solution (50-250 mM sodium phosphate, 0.1-1.0 mM NADPH, 10-40% isopropanol, pH 7-9). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 0-20 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is filtered to remove enzyme.

    Example 17Enzyme Treatment of Hop Derived Isoalpha Acids with NADH Cofactor Recycling

    [0114] Enzyme treatment where the NADPH cofactor is substituted with NADH. Isoalpha Acids are treated in a manner described in Example 2 but the NADP is replaced with NAD.

    Example 18Enzyme Treatment of Hop Derived Isoalpha Acids with Cofactor Recycling Via Ethanol Oxidation

    [0115] Enzyme treatment where the isopropanol starting material is substituted with ethanol, wherein a reductase is added to a concentration of 0.1-10 mg/mL in buffered aqueous solution (50-250 mM sodium phosphate, 0.1-1.0 mM NADH, 10-40% ethanol, pH 7-9). ISOLONE Isomerized Hop Extract solution (29% isoalpha acids) is added for a final concentration of 0.145-16% isoalpha acids. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is filtered to remove enzyme.

    Example 19Enzyme Treatment of Hop Derived Isoalpha Acids Followed by Extraction

    [0116] Enzyme treatment followed by extraction to increase final concentration of dihydro-(rho)-isoalpha acids. Isoalpha acids are treated in a manner described in Example 2. The obtained reaction mixture is filtered to remove enzyme and extracted with food-grade solvent to achieve a desired concentration of dihydro-(rho)-isoalpha acids.

    Example 20Enzyme Treatment of Hop Derived Isoalpha Acids Followed by Thermal Inactivation

    [0117] Isoalpha acids are treated in a manner described in Example 2. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. The obtained reaction mixture is heated at 80-100 C. for 10-30 minutes to inactivate enzyme.

    Example 21Enzyme Treatment of Hop Derived Isoalpha Acids Followed by Chemical Inactivation

    [0118] Isoalpha acids are treated in a manner described in Example 2. The reaction is incubated at 30-40 C. with orbital shaking at 180 rpm for 24 hours. Food-grade ethanol is added to a final concentration of >50% to inactivate enzyme.

    Example 22Enzyme Treatment of Hop Derived Isoalpha Acids with Immobilized Ketoreductase Recycling

    [0119] A ketoreductase is crosslinked with glutaraldehyde and absorbed onto DEAE-cellulose to yield an immobilized ketoreductase material. Isoalpha acids are then treated with the immobilized ketoreductase in a manner described in Example 2. The obtained reaction mixture is centrifuged at 10,000 g to separate immobilized ketoreductase from the reaction solution. Immobilized ketoreductase is recovered, washed with water or aqueous buffer, and re-used in a new reaction mixture.

    CONCLUSIONS

    [0120] 23 ketoreductases have been characterized as transforming isoalpha acids into dihydro-(rho)-isoalpha acids. The ketoreductases characterized in this study possess an enzymatic activity that has not been described previously. The ketoreductases characterized in this study all reduce a ketone group into an alcohol and are thus ketoreductases. These results demonstrate that a ketoreductase biocatalyst may be employed to convert isoalpha acids to dihydro-(rho)-isoalpha acids in a novel biotransformation process. The present invention replaces current chemical processes utilizing sodium borohydride.

    [0121] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.

    [0122] All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference.

    CITED REFERENCES

    [0123] 1. Sodium Borohydride; MSDS No. S9125; Sigma-Aldrich Co.: Saint Louis, Mo. Nov. 1, 2015. (accessed Jun. 8, 2017). [0124] 2. Robinson, P. K., Enzymes: principles and biotechnological applications. Essays Biochem 2015, 59, 1-41. [0125] 3. Hult, K.; Berglund, P., Enzyme promiscuity: mechanism and applications. Trends Biotechnol. 2007, 25 (5), 231-238. [0126] 4. Nobeli, I.; Favia, A. D.; Thornton, J. M., Protein promiscuity and its implications for biotechnology. Nat. Biotechnol. 2009, 27 (2), 157-167. [0127] 5. Pozen, M., Enzymes in Brewing. Ind. Eng. Chem, 1934, 26 (11), 1127-1133. [0128] 6. Praet, T.; Opstaele, F.; Jaskula-Goiris, B.; Aerts, G.; De Cooman, L., Biotransformations of hop-derived aroma compounds by Saccharomyces cerevisiae upon fermentation. Cerevisia, 2012, 36, 125-132. [0129] 7. Wallerstein, L. (1947) Bentonite and Proteolytic Enzyme Treatment of Beer, U.S. Pat. No. 2,433,411. [0130] 8. Ghionno, L.; Marconi, O; Sileoni, V.; De Francesco, G.; Perretti, G., Brewing with prolyl endopeptidase from Aspergillus niger the impact of enzymatic treatment on gluten levels, quality attributes, and sensory profile. Int. J. Food Sci. Technol, 2017, 52 (6), 1367-1374. [0131] 9. Gros, J.; Tran, T. T. H.; Collin, S., Enzymatic release of odourant polyfunctional thiols from cysteine conjugates in hop. J. Inst. Brew. 2013, 119 (4), 221-227.