GLUCOSE DEHYDROGENASE VARIANTS WITH IMPROVED PROPERTIES
20200087633 ยท 2020-03-19
Assignee
Inventors
- Mara Boenitz-Dulat (Penzberg, DE)
- Carina Horn (Biblis, DE)
- Peter Kratzsch (Penzberg, DE)
- Thomas Meier (Penzberg, DE)
- Markus RUDOLPH (Basel, CH)
- Bernd Schneidinger (Mannheim, DE)
Cpc classification
International classification
Abstract
The present invention relates to improved variants of variants of the Glucose Dehydrogenases (GlucDH) derived from Bacillus subtilis having improved properties in the presence of cNAD as cofactor, to genes encoding such variant GlucDHs, to proteins of such GlucDH variants, and to different applications of these GlucDH variants, particularly for determining concentrations of sugars, especially of glucose, in samples such as bodily fluids, especially blood.
Claims
1. A variant of a Glucose Dehydrogenase (GlucDH) derived from Bacillus subtilis, wherein said variant comprises an amino acid sequence having at least 90% identity to SEQ ID NO:1 and wherein said variant comprises a substitution of amino acid residue glutamic acid at a position corresponding to position 170 of SEQ ID NO: 1 with an amino acid residue lysine and a substitution of amino acid residue glutamine at a position corresponding to position 252 of SEQ ID NO: 1 with an amino acid residue leucine, and wherein said variant further comprises at least one additional amino acid substitution at a position corresponding to a position between 95 and 237 of SEQ ID NO: 1 with an amino acid residue other than glycine or lysine, wherein said variant has increased affinity for glucose and/or carba-NAD relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2, and wherein said at least one additional amino acid substitution is selected from the group consisting of a substitution of amino acid residue leucine at a position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine, a substitution of amino acid residue asparagine at a position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, a substitution of amino acid residue glycine at a position corresponding to position 163 of SEQ ID NO: 1 with an amino acid residue alanine, a substitution of amino acid residue glutamic acid at a position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and a substitution of amino acid residue serine at a position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine.
2. The variant according to claim 1, wherein said variant comprises the additional amino acid substitutions of amino acid residue glutamic acid at the position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and of amino acid residue serine at the position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine.
3. The variant according to claim 1, wherein said variant comprises the additional amino acid substitutions of amino acid residue glutamic acid at the position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, of amino acid residue serine at the position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine and of amino acid residue glycine at the position corresponding to position 163 of SEQ ID NO:1 with an amino acid residue alanine.
4. The variant according to claim 3, wherein said variant further comprises one or more additional amino acid substitutions, wherein the amino acid at the position corresponding to position 39 of SEQ ID NO: 1 is substituted with Glu (39Glu); position 40 of SEQ ID NO: 1 is substituted with Cys (40Cys); position 46 of SEQ ID NO: 1 is substituted with Asp (46Asp); position 70 of SEQ ID NO: 1 is substituted with Cys (70Cys); position 78 of SEQ ID NO: 1 is substituted with Ala (78Ala); position 80 of SEQ ID NO: 1 is substituted with Leu (80Leu); position 96 of SEQ ID NO: 1 is substituted with Leu (96Leu), Gin (96Gin), Val (96Val), or Met (96Met); position 107 of SEQ ID NO: 1 is substituted with Glu (107Glu); position 134 of SEQ ID NO: 1 is substituted with Glu (134Glu); position 178 of SEQ ID NO: 1 is substituted with Ser (178Ser); position 201 of SEQ ID NO: 1 is substituted with Ser (201Ser); position 205 of SEQ ID NO: 1 is substituted with Lys (205Lys); and/or position 255 of SEQ ID NO: 1 is substituted with Cys (255Cys).
5. The variant according to claim 1, wherein said variant comprises at least one additional amino acid substitution selected from the group consisting of the substitution of amino acid residue leucine at the position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine and the substitution of amino acid residue asparagine at the position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, said variant optionally further comprising additional amino acid substitutions of amino acid residue tyrosine at a position corresponding to position 39 of SEQ ID NO: 1 with an amino acid residue glutamic acid and/or of amino acid residue serine at a position corresponding to position 40 of SEQ ID NO: 1 with an amino acid residue cysteine.
6. The variant according to claim 1, wherein said variant comprises or consists of an amino acid sequence that has at least 95% identity to SEQ ID NO:1.
7. An isolated polynucleotide encoding the GlucDH variant protein according to claim 1.
8. An expression vector comprising an isolated polynucleotide as defined in claim 7 operably linked to a promoter sequence capable of promoting the expression of said polynucleotide in a host cell.
9. A host cell comprising the expression vector of claim 8.
10. A process for producing GlucDH variants comprising culturing the host cell of claim 9 under conditions suitable for production of the enzyme variants.
11. A method of detecting, determining or measuring glucose in a sample using a GlucDH variant according to claim 1, comprising contacting the sample with said variant.
12. The method of claim 11 further characterized in that said detection, determination or measurement of glucose is performed using a sensor or test strip device.
13. Use of a GlucDH variant according to claim 1 for determining the amount or concentration of glucose in a sample.
14. A device for the detection or measurement of glucose in a sample comprising a GlucDH variant according to claim 1 and other reagents required for said measurement.
15. The device according to claim 14, characterized in that the device is or comprises a sensor.
16. The device according to claim 14, characterized in that the device is or comprises an electrochemical sensor.
17. The device according to claim 14, characterized in that the device is or comprises an optical sensor.
18. The device according to claim 14, characterized in that the device is or comprises a test strip.
Description
DETAILED DESCRIPTION OF THE INVENTION
[0030] As used in the following, the terms have, comprise or include or any arbitrary grammatical variations thereof are used in a non-exclusive way. Thus, these terms may both refer to a situation in which, besides the feature introduced by these terms, no further features are present in the entity described in this context and to a situation in which one or more further features are present. As an example, the expressions A has B, A comprises B and A includes B may both refer to a situation in which, besides B, no other element is present in A (i.e. a situation in which a solely and exclusively consists of B) and to a situation in which, besides B, one or more further elements are present in entity A, such as element C, elements C and D or even further elements.
[0031] As set out above, in a first embodiment the invention relates to a variant of a Glucose Dehydrogenase (GlucDH) derived from Bacillus subtilis, wherein said variant comprises an amino acid sequence having at least 90% identity to SEQ ID NO:1 and wherein said variant comprises a substitution of amino acid residue glutamic acid at a position corresponding to position 170 of SEQ ID NO: 1 with an amino acid residue lysine and a substitution of amino acid residue glutamine at a position corresponding to position 252 of SEQ ID NO: 1 with an amino acid residue leucine, and wherein said variant further comprises at least one additional amino acid substitution at a position corresponding to a position between 95 and 237 of SEQ ID NO: 1 with an amino acid residue other than glycine or lysine, wherein said variant has increased affinity for glucose and/or carba-NAD relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2, and wherein said at least one additional amino acid substitution is selected from the group consisting of a substitution of amino acid residue leucine at a position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine, a substitution of amino acid residue asparagine at a position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, a substitution of amino acid residue glycine at a position corresponding to position 163 of SEQ ID NO: 1 with an amino acid residue alanine, a substitution of amino acid residue glutamic acid at a position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and a substitution of amino acid residue serine at a position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine.
[0032] In one embodiment the invention relates to a variant of a Glucose Dehydrogenase (GlucDH) derived from Bacillus subtilis, said variant having at least 90% identity to SEQ ID NO:1 and comprising a substitution of amino acid residue glutamic acid at a position corresponding to position 170 of SEQ ID NO: 1 with an amino acid residue lysine and a substitution of amino acid residue glutamine at a position corresponding to position 252 of SEQ ID NO: 1 with an amino acid residue leucine, and wherein said variant further comprises at least one additional amino acid substitution at a position corresponding to a position between 95 and 237 of SEQ ID NO: 1 with an amino acid residue other than glycine or lysine, wherein said variant has increased affinity for glucose and/or carba-NAD relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2, and wherein said at least one additional amino acid substitution is selected from the group consisting of a substitution of amino acid residue leucine at a position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine, a substitution of amino acid residue glycine at a position corresponding to position 163 of SEQ ID NO: 1 with an amino acid residue alanine, a substitution of amino acid residue glutamic acid at a position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and a substitution of amino acid residue serine at a position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine.
[0033] The sequence of the wild-type glucose dehydrogenase from Bacillus subtilis is shown as SEQ ID NO: 1:
TABLE-US-00001 (GlucDHfromBacillussubtilis) SEQIDNO:1 MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKGGIKLMTETLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEEIAAVAVWLASKESSYVT 240 GITLFADGGMTQYPSFQAGRG 261
[0034] With the introduction of mutations into the wild-type sequence (SEQ ID NO: 1), GlucDH variants are obtained. The variants are functionally active, i.e. they convert glucose to gluconolactone.
[0035] The GlucDH variant of the present invention comprises an amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NO: 1 (GlucDH from Bacillus subtilis).
[0036] The term at least 90% identical or at least 90% identity as used herein means that the sequence of the variant GlucDH according to the present invention has an amino acid sequence characterized in that, within a stretch of 100 amino acids, at least 90 amino acids residues are identical to the sequence of SEQ ID NO:1. Sequence identities of other percentages are defined accordingly.
[0037] Sequence identity according to the present invention can, e.g., be determined by methods of sequence alignment in form of sequence comparison. Methods of sequence alignment are well known in the art and include various programs and alignment algorithms which have been described in, e.g., Pearson and Lipman (1988). Moreover, the NCBI Basic Local Alignment Search Tool (BLAST) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. Percentage of identity of variants according to the present invention relative to the amino acid sequence of e.g. SEQ ID NO: 1 is typically characterized using the NCBI Blast blastp with standard settings. Alternatively, sequence identity may be determined using the software GENEious with standard settings. Alignment results can be, e.g., derived from the Software Geneious (version R8), using the global alignment protocol with free end gaps as alignment type, and Blosum62 as a cost matrix. In one embodiment, the GlucDH variant of the present invention comprises the additional amino acid substitutions of amino acid residue glutamic acid at the position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and of amino acid residue serine at the position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine. In one embodiment, the GlucDH variant of the present invention further comprises the additional amino acid substitutions at the position corresponding to position 163 of SEQ ID NO:1 with an amino acid residue alanine.
[0038] It could be shown that the indicated substitutions can improve the performance of the enzyme. The indicated substitution at position 95, 97, 163, 223 and/or 237 are particularly suitable in order to increase affinity for glucose and/or for cNAD, as shown in Tables 1 and 2 for single and multiple mutations.
[0039] The term increased affinity for glucose relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2 means that the affinity of the variant for glucose which is converted into gluconolactone is increased. For the determination, the enzymatic reaction may be monitored (e.g. at room temperature at 340 nm for 5 minutes) and the dE/min may be calculated for each sample. The affinity of the variant is increased compared to the Glucose Dehydrogenase mutant of SEQ ID NO: 2, if the variant, e.g., has a higher absolute or relative affinity for glucose. Affinity of the variant compared to the Glucose Dehydrogenase mutant of SEQ ID NO: 2 can be determined by comparing the absolute affinities of both enzymes (absolute comparison). Alternatively, the affinity of the variant compared to the Glucose Dehydrogenase mutant of SEQ ID NO: 2 can be determined by comparing the relative affinities of both enzymes (relative comparison). Relative affinity of Glucose Dehydrogenase mutant of SEQ ID NO: 2 or variant of the present invention may be determined by setting the affinity at subsaturation substrate concentration in relation to the affinity at saturation substrate concentration. As detailed in the Examples, affinity to glucose may be determined in an activity assay with reduced amount of substrate (i.e. at subsaturation concentration), e.g. with 12.5 mM glucose. Particular suitable tests for determining affinity are described in detail in Examples 2 and 4. In accordance with this, the affinity may be expressed as relative activity and calculated as [dE/min (subsaturation substrate concentration)]/[dE/min (saturation substrate concentration)]*100. Further details are given in Examples 2 and 4. A value obtained with a variant higher than the value obtained with Glucose Dehydrogenase mutant of SEQ ID NO: 2 represents an increase in affinity for glucose for the variant.
[0040] An increased affinity correlates with a lower Km value. The Michaelis constant Km is the substrate concentration at which an enzyme reaction rate is at half-maximum and is an inverse measure of the substrate's affinity for the enzyme.
[0041] The term increased affinity for carba-NAD relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2 means that the affinity of the variant for the cofactor cNAD needed to convert glucose into gluconolactone is increased. As detailed in example 2, the affinity for cNAD (cNAD acceptance) may be expressed as relative activity and calculated as [dE/min (obtained with cNAD)]/[dE/min (obtained with NAD)]*100. Further details are given in Example 2. A value obtained with a variant higher than the value obtained with Glucose Dehydrogenase mutant of SEQ ID NO: 2 represents an increase in affinity for cNAD for the variant.
[0042] Particularly, the variant of the present invention is characterized in that it has an increased glucose and/or cNAD affinity relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2, particularly wherein the glucose and/or cNAD affinity is increased by at least 5%, more particularly at least 10%, still more particularly by at least 15% or 20%.
[0043] In one embodiment, the GlucDH variant of the present invention further comprises one or more additional amino acid substitutions, wherein the amino acid at the position corresponding to [0044] position 39 of SEQ ID NO: 1 is substituted with Glu (39Glu); [0045] position 40 of SEQ ID NO: 1 is substituted with Cys (40Cys); [0046] position 46 of SEQ ID NO: 1 is substituted with Asp (46Asp); [0047] position 70 of SEQ ID NO: 1 is substituted with Cys (70Cys); [0048] position 78 of SEQ ID NO: 1 is substituted with Ala (78Ala); [0049] position 80 of SEQ ID NO: 1 is substituted with Leu (80Leu); [0050] position 96 of SEQ ID NO: 1 is substituted with Leu (96Leu), Gln (96Gln), Val (96Val), or Met (96Met); [0051] position 107 of SEQ ID NO: 1 is substituted with Glu (107Glu); [0052] position 134 of SEQ ID NO: 1 is substituted with Glu (134Glu); [0053] position 178 of SEQ ID NO: 1 is substituted with Ser (178Ser); [0054] position 201 of SEQ ID NO: 1 is substituted with Ser (201Ser); [0055] position 205 of SEQ ID NO: 1 is substituted with Lys (205Lys); and/or [0056] position 255 of SEQ ID NO: 1 is substituted with Cys (255Cys).
[0057] Thereby, the performance of the enzyme can be further improved (see Table 2).
[0058] In another embodiment, the GlucDH variant of the present invention, comprises at least one additional amino acid substitution selected from the group consisting of the substitution of amino acid residue leucine at the position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine and the substitution of amino acid residue asparagine at the position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, said variant optionally further comprising additional amino acid substitutions of amino acid residue tyrosine at the position corresponding to position 39 of SEQ ID NO: 1 with an amino acid residue glutamic acid and/or of amino acid residue serine at the position corresponding to position 40 of SEQ ID NO: 1 with an amino acid residue cysteine.
[0059] The GlucDH variant of the present invention may comprise other substitutions than those mentioned above and/or deletions and/or insertions provided that it comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO: 1.
[0060] The GlucDH variant of the present invention in one embodiment consists of an amino acid sequence having at least 90% identity to SEQ ID NO:1. In another embodiment, the variant comprises or consists of an amino acid sequence that has at least 95% identity to the amino acid sequence of SEQ ID NO: 1. In one embodiment, the variant GlucDH comprises or consists of an amino acid sequence that has at least 96% or 97% identity to the amino acid sequences of SEQ ID NO: 1. Sequence identity may be determined as described above.
[0061] In one embodiment of the present invention, the GlucDH variant of the present invention comprises or consists of an amino acid sequence that has at least 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of any of SEQ ID NOs: 2-5. In another embodiment the GlucDH variant of the present inventions consists of the sequence selected from the group consisting of SEQ ID NOs: 2-5. The sequences of SEQ ID NOs: 2-5 are shown in the section Sequences. Sequence identity may be determined as described above.
[0062] The present invention also relates to an isolated polynucleotide encoding the GlucDH variant protein of the present invention. The term nucleic acid as used herein generally relates to any nucleotide molecule which encodes the Gluc DH variant of the invention and which may be of variable length. Examples of a nucleic acid of the invention include, but are not limited to, plasmids, vectors, or any kind of DNA and/or RNA fragment(s) which can be isolated by standard molecular biology procedures, including, e.g. ion-exchange chromatography. A nucleic acid of the invention may be used for transfection or transduction of a particular cell or organism.
[0063] Nucleic acid of the present invention may be in the form of RNA, such as mRNA or cRNA, or in the form of DNA, including, for instance, cDNA and genomic DNA e.g. obtained by cloning or produced by chemical synthetic techniques or by a combination thereof. The DNA may be triple-stranded, double-stranded or single-stranded. Single-stranded DNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand. Nucleic acid as used herein also refers to, among other, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded RNA, and RNA that is a mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded, or triple-stranded, or a mixture of single- and double-stranded regions. In addition, nucleic acid as used herein refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. Additionally, the nucleic acid may contain one or more modified bases. Moreover, DNAs or RNAs comprising unusual bases, such as inosine, or modified bases, such as tritylated bases, to name just two examples, are nucleic acids within the context of the present invention. The term nucleic acid as it is employed herein embraces chemically, enzymatically or metabolically modified forms of nucleic acid molecule, as well as the chemical forms of DNA and RNA characteristic of viruses and cells, including simple and complex cells, inter alia.
[0064] The nucleic acid of the invention may be originally formed in vitro or in a cell in culture, in general, by the manipulation of nucleic acids by endonucleases and/or exonucleases and/or polymerases and/or ligases and/or recombinases or other methods known to the skilled practitioner to produce the nucleic acids.
[0065] The present invention further relates to an expression vector comprising the isolated polynucleotide operably linked to a promoter sequence capable of promoting the expression of said polynucleotide in a host cell. As used herein, the term expression vector generally refers to any kind of nucleic acid that can be used to express a protein of interest in a cell (see also above details on the nucleic acids of the present invention). In particular, the expression vector of the invention can be any plasmid or vector known to the person skilled in the art which is suitable for expressing a protein in a particular host cell including, but not limited to, mammalian cells, bacterial cell, and yeast cells. An expression construct of the present invention may also be a nucleic acid which encodes a GlucDH variant of the invention, and which is used for subsequent cloning into a respective vector to ensure expression. Plasmids and vectors for protein expression are well known in the art, and can be commercially purchased from diverse suppliers including, e.g., Promega (Madison, Wis., USA), Qiagen (Hilden, Germany), Invitrogen (Carlsbad, Calif., USA), or MoBiTec (Germany). Methods of protein expression are well known to the person skilled in the art and are, e.g., described in Sambrook et al., 2000 (Molecular Cloning: A laboratory manual, Third Edition).
[0066] The vector may additionally include nucleic acid sequences that permit it to replicate in the host cell, such as an origin of replication, one or more therapeutic genes and/or selectable marker genes and other genetic elements known in the art such as regulatory elements directing transcription, translation and/or secretion of the encoded protein. The vector may be used to transduce, transform or infect a cell, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell. The vector optionally includes materials to aid in achieving entry of the nucleic acid into the cell, such as a viral particle, liposome, protein coating or the like. Numerous types of appropriate expression vectors are known in the art for protein expression, by standard molecular biology techniques. Such vectors are selected from among conventional vector types including insects, e.g., baculovirus expression, or yeast, fungal, bacterial or viral expression systems. Other appropriate expression vectors, of which numerous types are known in the art, can also be used for this purpose. Methods for obtaining such expression vectors are well-known (see, e.g. Sambrook et al, supra).
[0067] As detailed above, the nucleic acid which encodes GlucDH variant of the invention is operably linked to sequence which is suitable for driving the expression of a protein in a host cell, in order to ensure expression of the protein. However, it is encompassed within the present invention that the claimed expression construct may represent an intermediate product, which is subsequently cloned into a suitable expression vector to ensure expression of the protein. The expression vector of the present invention may further comprise all kind of nucleic acid sequences, including, but not limited to, polyadenylation signals, splice donor and splice acceptor signals, intervening sequences, transcriptional enhancer sequences, translational enhancer sequences, drug resistance gene(s) or alike. Optionally, the drug resistance gene may be operably linked to an internal ribosome entry site (IRES), which might be either cell cycle-specific or cell cycle-independent.
[0068] The term operably linked as used herein generally means that the gene elements are arranged as such that they function in concert for their intended purposes, e.g. in that transcription is initiated by the promoter and proceeds through the DNA sequence encoding the protein of the present invention. That is, RNA polymerase transcribes the sequence encoding the fusion protein into mRNA, which in then spliced and translated into a protein.
[0069] The term promoter sequence as used in the context of the present invention generally refers to any kind of regulatory DNA sequence operably linked to a downstream coding sequence, wherein said promoter is capable of binding RNA polymerase and initiating transcription of the encoded open reading frame in a cell, thereby driving the expression of said downstream coding sequence. The promoter sequence of the present invention can be any kind of promoter sequence known to the person skilled in the art, including, but not limited to, constitutive promoters, inducible promoters, cell cycle-specific promoters, and cell type-specific promoters.
[0070] Furthermore, the present invention also relates to a host cell comprising the expression vector of the present invention. The cell is preferably a host cell. A host cell of the present invention can be any kind of organism suitable for application in recombinant DNA technology, and includes, but is not limited to, all sorts of bacterial and yeast strain which are suitable for expressing one or more recombinant protein(s). Examples of host cells include, for example, various E. coli strains. A variety of E. coli bacterial host cells are known to a person skilled in the art and include, but are not limited to, strains such as DH5-alpha, HB101, MV1190, JM109, JM101, or XL-1 blue which can be commercially purchased from diverse suppliers including, e.g., Stratagene (CA, USA), Promega (WI, USA) or Qiagen (Hilden, Germany). A particularly suitable host cell is also described in the Examples, namely E. coli XL-1Blue cells.
[0071] The present invention also relates to a process for producing GlucDH variants comprising culturing the host cell under conditions suitable for production of the enzyme variants. The cultivation of host cells according to the invention is a routine procedure known to the skilled person. That is, a nucleic acid encoding a GlucDH variant of the invention can be introduced into a suitable host cell(s) to produce the respective protein by recombinant means. These host cells can by any kind of suitable cells, preferably bacterial cells such as E. coli, which can be easily cultivated. At a first step, this approach may include the cloning of the respective gene into a suitable plasmid vector. Plasmid vectors are widely used for gene cloning, and can be easily introduced, i.e. transformed, into bacterial cells which have been made competent. After the protein has been expressed in the respective host cell, the cells can be broken by means of either chemical or mechanical cell lysis are well known to the person skilled in the art, and include, but are not limited to, e.g. hypotonic salt treatment, detergent treatment, homogenization, or ultrasonification.
[0072] In another aspect the present invention relates to a method of detecting, determining or measuring glucose in a sample using a GlucDH variant according to the present invention, comprising contacting the sample with said variant. The method may be performed using a sensor or test strip device.
[0073] More particularly, the method of determining glucose in a sample may comprise [0074] a) contacting the sample with the GlucDH variant of the present invention under conditions conducive to the activity of the GlucDH [0075] b) reacting glucose with carba nicotinamide adenine dinucleotide (cNAD) or a functionally active derivative thereof; and [0076] c) determining the change in the redox state of cNAD or the derivative thereof, thereby determining the amount or concentration of glucose in the sample.
[0077] The above method is based on the fact that GlucDH may be used to catalyze the conversion of glucose to gluconolactone according to the following scheme: [0078] glucose+cNAD.sup.+gluconolactone+cNADH+H.sup.+
[0079] In carba-NAD (cNAD) the ribose is substituted by a carbacyclic sugar unit compared to NAD. Carba-NAD has the following structure (I):
##STR00001##
[0080] The compound, its production and use are described in detail in WO 2007/012494, WO 2011/012270 and WO2014/195363. The cofactor in the present invention is preferably carba-NAD. In one embodiment of the present invention, a cNAD or a functionally active derivative of cNAD is used as disclosed in formula III of WO 2011/012270 to which it is explicitly referred. In one embodiment of the present invention, cNADP is used instead of cNAD.
[0081] In a first step of the method of the present invention a sample is contacted with the GlucDH variant of the present invention. The contacting of the sample with the GluDH can be direct (e.g. in liquid assays) or indirect (e.g. in sensor systems in which only a fraction of the sample (containing the analyte) is contacting the GlucDH. It is evident that the contacting should be carried out under conditions conducive to the activity of the GlucDH variant, i.e. allowing the enzyme to convert glucose to gluconolactone. Incubation step can vary from about 3 seconds to several hours, preferably from about 3 seconds to about 10 minutes. However, the incubation time will depend upon the assay format, volume of solution, concentrations and the like. Usually the assay will be carried out at ambient temperature or a temperature required for other test formats carried out concomitantly (e.g. 25 C. to 38 C.; such as 30 C. or 37 C.), although it can be conducted over a range of temperatures, such as 10 C. to 40 C.
[0082] Optionally, the enzyme can be fixed to or immobilized into a support layer prior to the contacting with the sample to facilitate the assay. Examples of support layers include glass or plastic in the form of, for example, a microtiter plate, a glass microscope slide or cover slip, a stick, a bead, or a microbead, membranes (e.g. used in test strips) and layers of biosensors.
[0083] The sample may be any sample suspected of containing glucose, particularly a sample from a subject. The term sample from a subject includes all biological fluids, excretions and tissues isolated from any given subject, particularly a human. In the context of the present invention such samples include, but are not limited to, blood, blood serum, blood plasma, nipple aspirate, urine, semen, seminal fluid, seminal plasma, prostatic fluid, excreta, tears, saliva, sweat, biopsy, ascites, cerebrospinal fluid, milk, lymph, bronchial and other lavage samples, or tissue extract samples. Preferably, the subject is an animal (including human), more preferably a mammal, still more preferably a human. Preferably, the sample is a body fluid, particularly a blood sample or a urine sample.
[0084] Typically, blood samples are preferred test samples for use in the context of the present invention.
[0085] After the contacting and the conversion of glucose, if present, the change in the redox state of cNAD or derivate mediated by the GlucDH variant are determined, thereby determining glucose in the sample. Evidently, the amount of cNADH or derivate thereof produced and the amount of cNAD or derivate thereof consumed correlate with the amount of glucose present in the sample. Accordingly, the change in the redox state of cNAD includes the determination of the amount or concentration of cNAD and/or cNADH as well as the ratio of the two. The same applies to cNAD derivates.
[0086] A variety of methods for determining cNADH/NAD or derivate thereof are known in the art and any of these can be used.
[0087] Exemplary methods for determining cNADH/NAD or derivate thereof include electrochemical methods (e.g. as described in U.S. Pat. No. 6,541,216) or optical methods (e.g. by measuring cNAD/cNADH conversion by light absorbance at e.g. 340 nm or 365 nm or by assays based on a reductase to form luciferin, which is then quantified optically). If electrochemical methods are used, cNADH/cNAD or derivate thereof can either a) react directly on a measurement electrode or b) cNADH/cNAD or derivate thereof reacts in a first step with an additional redoxmediator substance which changes its redox state in a defined relation to the redox state of cNADH/cNAD or derivate thereof and this redoxmediator reacts in a subsequent step on the measurement electrode.
[0088] The method of the present invention can be carried out in a so-called liquid or wet test, for example in a cuvette, or as a so-called dry test on an appropriate reagent carrier, the necessary test reagents thereby being present in or on a solid carrier, which is preferably an absorbent or swellable material.
[0089] Alternatively or additionally, the GlucDH may be part of a sensor, a test strip, a test element, a test strip device or a liquid test.
[0090] A sensor is an entity that measures a physical/chemical quantity and converts it into a signal which can be read by an observer or by an instrument. In the present invention, the GlucDH may be part of a sensor. The sensor converts glucose and cNAD or a derivate thereof into gluconolactone and cNADH or a derivate thereof, which is further converted into a signal such as a change in colour or a value displayed e.g. on a display or monitor.
[0091] In one embodiment, the sensor may comprise GlucDH and an amperometric device to determine glucose of a sample. Enzyme-coupled biosensors have been described in the art. In accordance with this, GlucDH may be coupled to a surface (e.g. by printing a GlucDH/graphite mixture onto electroplated graphite pads or by adsorption or immobilization of the GlucDH on carbon particles, platinized carbon particles, carbon/manganese dioxide particles, glassy carbon, or mixing it with carbon paste electrodes etc.)
[0092] A test strip or a test element is an analytic or diagnostic device used to determine presence and/or quantity of a target substance within a sample. A standard test strip may comprise one or more different reaction zones or pads comprising reagents which react (e.g. change colour) when contacted with a sample. Test strips are known in many embodiments, for example from U.S. Pat. No. 6,541,216, EP 262445 and U.S. Pat. No. 4,816,224. It is commonly known that one or more reagents (e.g. enzymes) needed for carrying out the determination methods are present on or in solid carrier layers. As carrier layers, there are especially preferred absorbent and/or swellable materials which are wetted by the sample liquid to be analyzed. Examples include gelatine, cellulose and synthetic fiber fleece layers.
[0093] The GlucDH of the present invention may also be part of a liquid test. A liquid test is a test wherein test components react in a liquid medium. Usually in the field of laboratory analytics, the liquid reagents are on water basis, e.g. a buffered salt solution in order to provide the activity of enzyme(s) involved. The liquid is usually adapted to the specific intended use. For carrying out a liquid test, all test components are solved in a liquid and combined (or vice versa). Typical containments for carrying out such tests include vials, multi wells plates, cuvettes, vessels, reagent cups, tubes etc.
[0094] Accordingly, the method of the present invention may further be characterized in that [0095] a) wherein the determining the change in the redox state of cNAD or the derivate thereof includes the determination of the concentration of (i) cNAD or the derivate thereof and/or (ii) cNADH or the derivate thereof; and/or [0096] b) wherein the determining the change in the redox state of cNAD or the derivative thereof is electrochemically or optically; and/or [0097] c) wherein the method further comprises determining the amount or concentration of gluconolactone; and/or [0098] d) wherein the GlucDH variant is part of a sensor, a test strip, a test element, a test strip device or a liquid test; and/or [0099] e) wherein the sample is a body fluid, particularly a blood sample or a urine sample.
[0100] With respect to the use of the present invention it is referred to the terms, examples and specific embodiments used in the context of the other aspects of the present disclosure, which are also applicable to this aspect. For details it may be referred to the methods of the present invention.
[0101] Yet, in another aspect, the present invention relates to a device for the detection or measurement of glucose in a sample comprising a GlucDH of the present invention and other reagents required for said measurement. With respect to the device of the present invention it is referred to the terms, examples and specific embodiments used in the context of the other aspects of the present disclosure, which are also applicable to this aspect.
[0102] The device may be or comprise a sensor, preferably an electrochemical sensor or an optical sensor, or a test strip, particularly a test strip.
[0103] A sensor is an analytical device for the detection of an analyte that combines a biological component (here the glucose according to the present invention) with a detector component, particularly a physicochemical detector component. Exemplary sensors based on an electrochemical test strip format are described in U.S. Pat. Nos. 5,413,690; 5,762,770 and 5,997,817.
[0104] An electrochemical sensor is based on the translation of a chemical signal (here presence of glucose) into an electrical signal (e.g. current). A suitable electrode can measure the glucose mediated production of cNADH or derivative thereof as an electrical signal. A suitable optical sensor can measure the GlucDH-mediated change in the redox state of cNAD or derivate thereof. The signal may be the cNAD/cNADH-mediated absorbance/emission of light.
[0105] The device of the present invention may comprisein addition to the GlucDH of the present inventionone or more further component(s), such as other reagents, required for or helpful in said determining. The components may be any of these described in the context of the methods and devices of the present invention. Additionally, this may include an instruction manual, a lancet device, a capillary pipette, a further enzyme, a substrate and/or a control solution etc.
[0106] Also disclosed herein are the following embodiments: [0107] 1. A variant of a Glucose Dehydrogenase (GlucDH) derived from Bacillus subtilis, wherein said variant comprises an amino acid sequence having at least 90% identity to SEQ ID NO:1 and wherein said variant comprises a substitution of amino acid residue glutamic acid at a position corresponding to position 170 of SEQ ID NO: 1 with an amino acid residue lysine and a substitution of amino acid residue glutamine at a position corresponding to position 252 of SEQ ID NO: 1 with an amino acid residue leucine, and wherein said variant further comprises one or more additional amino acid substitutions selected from the group consisting of a substitution of amino acid residue leucine at a position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine, a substitution of amino acid residue asparagine at a position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, a substitution of amino acid residue glycine at a position corresponding to position 163 of SEQ ID NO: 1 with an amino acid residue alanine, a substitution of amino acid residue glutamic acid at a position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and a substitution of amino acid residue serine at a position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine. [0108] 2. The variant according to embodiment 1, wherein said variant has increased affinity for glucose and/or carba-NAD relative to a Glucose Dehydrogenase mutant of SEQ ID NO: 2. [0109] 3. The variant according to embodiment 1 or 2, wherein said variant comprises the additional amino acid substitutions of amino acid residue glutamic acid at the position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, and of amino acid residue serine at the position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine. [0110] 4. The variant according to embodiment 1 or 2, wherein said variant comprises the additional amino acid substitutions of amino acid residue glutamic acid at the position corresponding to position 223 of SEQ ID NO: 1 with an amino acid residue phenylalanine, tryptophan, isoleucine, leucine, threonine or tyrosine, of amino acid residue serine at the position corresponding to position 237 of SEQ ID NO: 1 with an amino acid residue glutamic acid, arginine or asparagine and of amino acid residue glycine at the position corresponding to position 163 of SEQ ID NO:1 with an amino acid residue alanine. [0111] 5. The variant according to embodiment 4, wherein said variant further comprises one or more additional amino acid substitutions, wherein the amino acid at the position corresponding to [0112] position 39 of SEQ ID NO: 1 is substituted with Glu (39Glu); [0113] position 40 of SEQ ID NO: 1 is substituted with Cys (40Cys); [0114] position 46 of SEQ ID NO: 1 is substituted with Asp (46Asp); [0115] position 70 of SEQ ID NO: 1 is substituted with Cys (70Cys); [0116] position 78 of SEQ ID NO: 1 is substituted with Ala (78Ala); [0117] position 80 of SEQ ID NO: 1 is substituted with Leu (80Leu); [0118] position 96 of SEQ ID NO: 1 is substituted with Leu (96Leu), Gln (96Gln), Val (96Val), or Met (96Met); [0119] position 107 of SEQ ID NO: 1 is substituted with Glu (107Glu); [0120] position 134 of SEQ ID NO: 1 is substituted with Glu (134Glu); [0121] position 178 of SEQ ID NO: 1 is substituted with Ser (178Ser); [0122] position 201 of SEQ ID NO: 1 is substituted with Ser (201Ser); [0123] position 205 of SEQ ID NO: 1 is substituted with Lys (205Lys); and/or [0124] position 255 of SEQ ID NO: 1 is substituted with Cys (255Cys). [0125] 6. The variant according to embodiment for 2, wherein said variant comprises at least one additional amino acid substitution selected from the group consisting of the substitution of amino acid residue leucine at the position corresponding to position 95 of SEQ ID NO: 1 with an amino acid residue isoleucine or valine and the substitution of amino acid residue asparagine at the position corresponding to position 97 of SEQ ID NO: 1 with an amino acid residue serine, said variant optionally further comprising additional amino acid substitutions of amino acid residue tyrosine at a position corresponding to position 39 of SEQ ID NO: 1 with an amino acid residue glutamic acid and/or of amino acid residue serine at a position corresponding to position 40 of SEQ ID NO: 1 with an amino acid residue cysteine. [0126] 7. The variant according to any of embodiments 1 to 6, wherein said variant comprises or consists of an amino acid sequence that has at least 95% identity to SEQ ID NO:1. [0127] 8. An isolated polynucleotide encoding the GlucDH variant protein according to any of embodiments 1 to 7. [0128] 9. An expression vector comprising an isolated polynucleotide as defined in embodiment 8 operably linked to a promoter sequence capable of promoting the expression of said polynucleotide in a host cell. [0129] 10. A host cell comprising the expression vector of embodiment 9. [0130] 11. A process for producing GlucDH variants comprising culturing the host cell of embodiment 10 under conditions suitable for production of the enzyme variants. [0131] 12. A method of detecting, determining or measuring glucose in a sample using a GlucDH variant according to any of embodiments 1 to 7, comprising contacting the sample with said variant. [0132] 13. The method of embodiment 12 further characterized in that said detection, determination or measurement of glucose is performed using a sensor or test strip device. [0133] 14. Use of a GlucDH variant according to any of embodiments 1 to 7 for determining the amount or concentration of glucose in a sample. [0134] 15. A device for the detection or measurement of glucose in a sample comprising a GlucDH variant according to any of embodiments 1 to 7 and other reagents required for said measurement. [0135] 16. The device according to embodiment 15, characterized in that the device is or comprises a sensor, preferably an electrochemical sensor or an optical sensor, or a test strip, particularly a test strip.
[0136] Unless defined otherwise, all technical and scientific terms and any acronyms used herein have the same meanings as commonly understood by one of ordinary skill in the art in the field of the invention. Definitions of common terms in molecular biology can be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
[0137] The invention is not limited to the particular methodology, protocols, and reagents described herein because they may vary. Although any methods and materials similar or equivalent to those described herein can be used in the practice of the present invention, the preferred methods, and materials are described herein. Further, the terminology used herein is for the purpose of describing particular embodiments only and is not intended to limit the scope of the present invention.
[0138] In the following examples, all reagents, restriction enzymes, and other materials were obtained from Roche Diagnostics Germany, unless other commercial sources are specified, and used according to the instructions given by the suppliers. Operations and methods employed for the purification, characterization and cloning of DNA are well known in the art (Ausubel, F., et al., in Current protocols in molecular biology (1994) Wiley Verlag) and can be adapted as required by the skilled artisan.
[0139] The following examples further illustrate the present invention. These examples are not intended to limit the scope of the present invention, but provide further understanding of the invention.
EXAMPLES
Example 1
First Round of Mutagenesis
[0140] Wild type Glucose Dehydrogenase from Bacillus subtilis was mutated at positions 170 and 252 (i.e. E170K and Q252L) in order to improve thermal stability. This mutant is referred further as GlucDH Mut.A. For improving enzymatic activity of this GlucDH variant carrying mutations E170K and Q252L in the presence of the artificial cofactor cNAD a first round of mutagenesis was applied.
[0141] QuikChange Site-Directed Mutagenesis Kit (Stratagene, Cat. 200518) was used to substitute successively wild type amino acids at defined positions of the enzyme.
[0142] Hot spot regions were identified by analysis of x-ray structures of the enzyme from Bacillus megaterium. The corresponding positions were mutated by saturation mutagenesis.
[0143] The 5- and the 3-primer used for mutagenesis were complementary to each other and contained NNN (randomly synthesized nucleotides) for the amino acid exchange in a central position. This randomly created codon was flanked by 12 to 16 nucleotides at each end. The sequences of these nucleotides were identical to the cDNA-strand or to the complementary cDNA-strand flanking the codon for the amino substitution. Mutant library was created by transformation of mutated genes in E. coli strain Xl-Blue and cultivation on agar plates over night at 37 C.
Example 2
[0144] Determination of Properties of Variant GlucDHs from First Round of Mutagenesis
[0145] GlucDH variants 1-18 obtained as described in Example 1 were analyzed for their enzymatic properties (i.e., thermal stability, activity with cofactor cNAD, KM value for glucose and substrate specificity). The results relative to GlucDH variant carrying mutations E170K and Q252L are summarized in Table 1 (+=improved; o=similar; =decreased).
[0146] The clones obtained in Example 1 were cultivated in LB media, cell disrupted and the enzymatic activity of glucose dehydrogenase determined. To identify the different properties of the mutated enzymes the following procedure was applied: [0147] Reference Measurement: [0148] Measurement under standard conditions with NAD and Glucose in saturated concentrations for the enzyme [0149] Affinity to Glucose: [0150] Measurement under glucose limitation=>comparison to reference measurement=>higher values indicate better km values [0151] Thermal Stability: [0152] Incubation of sample at elevated temperature for 30 Min=>comparison to reference measurement=>higher remaining activity=better temperature stability [0153] cNAD acceptance: [0154] Measurement with cNAD and comparison to reference measurement=>higher values=better enzymatic activity with cNAD [0155] Substrate specificity: [0156] Measurement with xylose instead of glucose as substrate=>comparison to reference measurement=>statement to substrate specificity=>lower values=better specificity to glucose
[0157] In detail, samples were prepared as follows:
[0158] Mutant colonies on agar plates described in example 1 were picked in microtiter plates (mtp) containing 200 l LB-Ampicillin-media/hole and incubated at 37 C. over night. These plates were referred to as master plates. For each amino acid position two master plates were picked to assure that every possible exchange is included.
[0159] From each master plate 20 l of cultivated clone/cavity was transferred to a mtp containing 250 l 0.14% Triton X-100, 190 mM NaCl, 4.8% B-PER (Thermo Scientific Prod.78248), 95 mM Tris pH 8.8/cavity and incubated for cell disruption at 50 C. for 30 minutes. This plate was referred to as working plate.
[0160] From the working plate 510 l sample/cavity were transferred to five empty mtps.
[0161] With one mtp a standard measurement was performed with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM NAD, 200 mM glucose, 73 mM Tris pH8.8 (reference measurement).
[0162] With another mtp measurement under glucose limitation was performed with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM NAD, 12.5 mM glucose, 73 mM Tris pH8.8.
[0163] With another mtp temperature stability was examined by determination of remaining activity after 30 minutes incubation at 80 C. with standard test conditions as described above.
[0164] With another mtp cNAD acceptance was measured with 90 l reagent solution containing 1.37 mM cNAD, 0.11% Triton X-100, 145 mM NaCl, 200 mM glucose, 73 mM Potassium phosphate pH7.0.
[0165] With another mtp Xylose conversion was measured with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM NAD, 1M xylose, 73 mM Tris pH8.8.
[0166] The enzymatic reaction was monitored at room temperature at 340 nm for 5 minutes and the dE/min calculated for each working plate. The value from the reference measurement was set to 100% activity. The values obtained with the other four plates were compared to the reference measurement and calculated in percent activity ((dE/min Parameter/dE/min Reference)*100).
[0167] Calculation of different screening parameters:
[0168] Affinity to glucose (expressed as activity ratio) was calculated as follows:
[0169] Thermal Stability (expressed as remaining activity) was calculated as follows:
[0170] cNAD acceptance (expressed as activity ratio) was calculated as follows:
[0171] Substrate specificity (expressed as activity ratio) was calculated as follows:
[0172] Summary of Table 1 below:
[0173] Variant 18 was valuated the best mutant for further improvement since it has the best cNAD acceptance and affinity for glucose. Throwback is its low temperature stability. This mutant is referred further as GlucDH Mut.B.
TABLE-US-00002 TABLE 1 Activity with Thermal Cofactor KM Value Substrate Variant Substitution Additional Substitutions Stability cNAD for Glucose Specificity 1 E170K + Q252L L95I ++ + + 2 E170K + Q252L L95I N97S ++ + + 3 E170K + Q252L L95I N97S Y39E S40C ++ ++ ++ 4 E170K + Q252L N97S Y39E S40C ++ ++ ++ 5 E170K + Q252L L95V + + + 6 E170K + Q252L G163A ++ + 7 E170K + Q252L E223W + + ++ 8 E170K + Q252L E223F +/ + + 9 E170K + Q252L S237N + + ++ 10 E170K + Q252L S237R +/ + + 11 E170K + Q252L S237E + + 12 E170K + Q252L E223I S237N + + + 13 E170K + Q252L E223L S237N + + 14 E170K + Q252L E223F S237N + + + 15 E170K + Q252L E223T S237N + + + 16 E170K + Q252L E223Y S237N + + + 17 E170K + Q252L E223W S237N + + + 18 E170K + Q252L G163A E223W S237N +++ ++ (+ = improved; = similar; = decreased)
Example 3
Second Round of Mutagenesis
[0174] Based on GlucDH variant 18 (see Table 1) carrying mutations E170K, Q252L, G163A, E223W and S237N=GlucDH Mut.B a further round of mutagenesis was carried out in order to enhance thermal stability, while maintaining or further improving specific activity, affinity for glucose using cNAD as artificial cofactor and substrate specificity.
[0175] Exchanges found during mutagenesis of GlucDH Mut.A concerning temperature stability were applied for GlucDH Mut.B.
[0176] Mutagenesis was performed as described above.
Example 4
[0177] Determination of Properties of Variant GlucDHs from Second Round of Mutagenesis
[0178] GlucDH variants 19-50 obtained as described in Example 3 were analyzed for their enzymatic properties (i.e., thermal stability, KM value for glucose and substrate specificity). The results relative to variant 18 (GlucDHMut.B) carrying mutations E170K, Q252L, G163A, E223W and S237N are summarized in Table 2 (+=improved; o=similar; =decreased).
[0179] The clones obtained in Example 3 were cultivated in LB media, cell disrupted and the enzymatic activity of glucose dehydrogenase determined. To identify the different properties of the mutated enzymes the following procedure was applied:
[0180] The screening system was changed compared to example 2 concerning cofactor appliance: [0181] Reference Measurement: [0182] Measurement under standard conditions with cNAD and Glucose in saturated concentrations for the enzyme [0183] Affinity to Glucose: [0184] Measurement under glucose limitation=>comparison to reference measurement=>higher values indicate better km values [0185] Thermal Stability: [0186] Incubation of sample at elevated temperature for 30 Min=>comparison to reference measurement=>higher remaining activity=better temperature stability [0187] Substrate specificity: [0188] Measurement with xylose instead of glucose as substrate=>comparison to reference measurement=>statement to substrate specificity=>lower values indicate better specificity to glucose
[0189] In detail, samples were prepared as described in example 3 to obtain master and working plates. From the working plate 410 l sample/cavity were transferred to four empty mtps.
[0190] With one mtp a standard measurement was performed with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM cNAD, 200 mM glucose, 73 mM Tris pH8.0, (reference measurement).
[0191] With another mtp measurement under glucose limitation was performed with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM cNAD, 12.5 mM glucose, 73 mM Tris pH8.0.
[0192] With another mtp temperature temperature stability was examined by determination of remaining activity after 30 minutes incubation at 68 C. with standard test conditions as described above.
[0193] With another mtp Xylose conversion was measured with 90 l reagent solution containing 0.11% Triton X-100, 145 mM NaCl, 1.37 mM cNAD, 1M xylose, 73 mM Tris pH8.0.
[0194] The enzymatic reaction was monitored at room temperature at 340 nm for 5 minutes and the dE/min calculated for each working plate. The value from the reference measurement was set to 100% activity. The values obtained with the other plates were compared to the reference measurement and calculated in percent activity ((dE/min Parameter/dE/min Reference)*100).
[0195] Calculation of different screening parameters:
[0196] Affinity to glucose (expressed as activity ratio) was calculated as follows:
[0197] Thermal Stability (expressed as remaining activity) was calculated as follows:
[0198] Substrate specificity (expressed as activity ratio) was calculated as follows:
[0199] Summary of Table 2 below:
[0200] Variant 34 from the mutants listed in Table 2 was judged as one of the best candidates for further examination. Besides its improved properties concerning KM value for Glucose, and thermal stability, the applied exchanges did not contain a Cystein which could potentially react with some reagents on a test strip.
TABLE-US-00003 TABLE 2 Thermal KM Value Substrate Variant Substitution Additional Substitutions Stability for Glucose Specificity 19 E170K + Q252L + G163A + E223W + S237N Y39E + 20 E170K + Q252L + G163A + E223W + S237N Y39E S40C + 21 E170K + Q252L + G163A + E223W + S237N Y39E N46D + + 22 E170K + Q252L + G163A + E223W + S237N Y39E S40C N46D ++ ++ 23 E170K + Q252L + G163A + E223W + S237N Y39E S40C L95I + + 24 E170K + Q252L + G163A + E223W + S237N Y39E S40C Q205K ++ ++ 25 E170K + Q252L + G163A + E223W + S237N Y39E S40C L95I Q205K ++ 26 E170K + Q252L + G163A + E223W + S237N S40C + 27 E170K + Q252L + G163A + E223W + S237N S40C Q205K ++ + 28 E170K + Q252L + G163A + E223W + S237N E70C ++ 29 E170K + Q252L + G163A + E223W + S237N E70C P178S + + 30 E170K + Q252L + G163A + E223W + S237N E70C P178S E96L ++ ++ 31 E170K + Q252L + G163A + E223W + S237N T78A + 32 E170K + Q252L + G163A + E223W + S237N I80L + 33 E170K + Q252L + G163A + E223W + S237N I80L L95I + 34 E170K + Q252L + G163A + E223W + S237N I80L L95I Y39E + ++ 35 E170K + Q252L + G163A + E223W + S237N I80L L95I S40C + + 36 E170K + Q252L + G163A + E223W + S237N I80L L95I P178S + + 37 E170K + Q252L + G163A + E223W + S237N I80L L95I A301S ++ ++ 38 E170K + Q252L + G163A + E223W + S237N I80L L95I Q205K + 39 E170K + Q252L + G163A + E223W + S237N I80L L95I S255C ++ + 40 E170K + Q252L + G163A + E223W + S237N E96Q ++ ++ 41 E170K + Q252L + G163A + E223W + S237N E96V ++ ++ 42 E170K + Q252L + G163A + E223W + S237N E96M ++ ++ 43 E170K + Q252L + G163A + E223W + S237N K107E + 44 E170K + Q252L + G163A + E223W + S237N N134E + 45 E170K + Q252L + G163A + E223W + S237N N134E Q205K + + 46 E170K + Q252L + G163A + E223W + S237N P178S + 47 E170K + Q252L + G163A + E223W + S237N A201S
48 E170K + Q252L + G163A + E223W + S237N Q205K
49 E170K + Q252L + G163A + E223W + S237N Q205K S255C
+ 50 E170K + Q252L + G163A + E223W + S237N S255C
(+ = improved; = similar; = decreased)
indicates data missing or illegible when filed
Example 5
Determination of Properties of Exemplary Variant GlucDHs
[0201] Exemplary GlucDH variant from the first round of mutagenesis (GlucDH variant 2) and from the second round of mutagenesis (GlucDH variant 34) were further analyzed for their enzymatic properties in comparison with the initial GlucDH variant carrying the E170K and the Q252L substitution.
[0202] To identify the different properties of the mutated enzymes the following procedure was applied: [0203] Determination of enzymatic activity [0204] Measurement under standard conditions with cNAD and Glucose in saturated concentrations for the enzyme [0205] Determination of Km value for glucose: [0206] Enzyme activity assay was performed with different glucose concentrations and fixed cNAD concentration. [0207] Temperature stability: [0208] Determination of temperature with 50% remaining activity after 30 minutes incubation: [0209] Incubation of sample at elevated temperatures for 30 Min to estimate temperature at which GlucDH sample still contains 50% of its starting activity=>higher values=better temperature stability [0210] Determination of Km value for cNAD: [0211] Determination was performed as for the determination of Km value for glucose with the difference that the glucose concentration was fixed and cNAD concentration was varied. [0212] Substrate specificity: [0213] Measurement with xylose, maltose or galactose instead of glucose as substrate=>comparison to reference measurement=>statement to substrate specificity=>lower values=better specificity to glucose
[0214] In detail, samples were prepared as follows:
[0215] The clones were cultivated in LB-Amp media (250 ml at 37 C., 150 rpm for 19 h), cell disrupted (French press at ca.800 bar), and raw purified (centrifugation of disrupted cells). The obtained supernatants were used as sample.
[0216] Activity was determined by adding 50 l of sample to 1.5 ml 2.06 mM cNAD; 147 mM glucose; 167 mM NaCl; 83 mM Tris pH 8.0 in a cuvette (1 cm light path length) at 25 C. and monitoring the absorbance increase at 360 nm for 5 minutes. The dE/min was calculated
[0217] KM value determinations were performed by reducing the glucose concentration at the activity assay (see above) stepwise. The KM value is the substrate concentration at which an enzyme reaction rate is at half-maximum. Temperature with 50% remaining activity after 30 minutes incubation was assessed as follows:
[0218] The GlucDH samples were incubated in 50 mM Tris pH 8.0, incubated for 30 minutes at 50 C. and the activity tested (see above). Afterwards the samples (new samples, i.e. not the ones that were stressed before at 50 C.) were incubated at 55 C. for 30 minutes and the remaining activity determined as described before. This procedure was continued by increasing the temperature in 5 C. steps until no significant activity could be detected. A plot of the remaining activity values in % to the incubation temperature allows detection of the temperature at which 50% activity is still measurable
[0219] Determination of Km value for cNAD was performed as for glucose with the difference that cNAD concentration was varied and glucose concentration was fixed at a saturated value.
[0220] Substrate specificity was determined as follows:
[0221] Activity assay was performed as above described. Only the applied sugars were exchanged. Xylose, maltose and galactose conversion was determined by exchanging the sugar substrate at equimolar amounts.
[0222] The value from the reference measurement with glucose as substrate was set to 100% activity. The values obtained with the other sugars were compared to the reference measurement and calculated in percent activity
[0223] The results are summarized in Table 3 below.
TABLE-US-00004 TABLE 3 Temperature [ C.] with 50% K.sub.m- K.sub.m- remaining value value Malt- Galac- activity after Glucose cNAD Xylose ose tose 30 minutes Mutant [mM] [mM] [%] [%] [%] incubation GlucDH 56.0 0.80 3.81 1.48 0.09 80* Mut. A GlucDH 44.4 0.54 1.76 0.66 0.03 57.5 Mut. B Variant 2 39.5 0.35 0.53 0.20 0.02 76 Variant 34 18.8 0.95 3.19 1.12 0.05 63.5 *no experiment conducted as described above, value estimated from other screening experiments
TABLE-US-00005 SEQUENCES Wild-typeGlucDHfromBacillussubtilis (SEQIDNO:1) MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKGGIKLMTETLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEEIAAVAVWLASKESSYVT 240 GITLFADGGMTQYPSFQAGRG 261 GlucDHMut.A:Wild-typeGlucDHfromBacillussubtilis+E170K+Q252L (SEQIDNO:2) MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKGGIKLMTKTLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEEIAAVAVWLASKESSYVT 240 GITLFADGGMTLYPSFQAGRG 261 GlucDHMut.B:GlucDHMut.A+G163A+E223W+S237N (SEQIDNO:3) MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKAGIKLMTKTLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEWIAAVAVWLASKESNYVT 240 GITLFADGGMTLYPSFQAGRG 261 Variant2:GlucDHMut.A+L95I+N97S (SEQIDNO:4) MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGIESPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKGGIKLMTKTLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEEIAAVAVWLASKESSYVT 240 GITLFADGGMTLYPSFQAGRG 261 Variant34:GlucDHMut.B+I80L+L95I+Y39E (SEQIDNO:5) MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYESNKQDPNEVKEEVIKAGGEAV 60 VVQGDVTKEEDVKNIVQTALKEFGTLDIMINNAGIENPVPSHEMPLKDWDKVIGINLIGA 120 FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKAGIKLMTKTLALEYAPKG 180 IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEWIAAVAVWLASKESNYVT 240 GITLFADGGMTLYPSFQAGRG 261