RECOMBINANT HIV-1 ENVELOPE PROTEINS AND THEIR USE
20230227512 · 2023-07-20
Assignee
- The United States of America, as represented by the Secretary, Department of Health and Human Servic
Inventors
- Peter Kwong (Washington, DC)
- Marie Pancera (Seattle, WA)
- Tongqing Zhou (Boyds, MD)
- Ivelin Georgiev (Nashville, TN)
- Michael Gordon Joyce (Washington, DC)
- Priyamvada Acharya (Chapel Hill, NC, US)
- Jason Gorman (Washington, DC)
- Yongping Yang (Potomac, MD)
- Guillaume Stewart-Jones (Cambridge, MA, US)
- Rita Chen (St. Louis, MO, US)
- Gwo-Yu Chuang (Rockville, MD)
- John Mascola (Rockville, MD)
- Baoshan Zhang (Bethesda, MD)
- Cheng Cheng (Bethesda, MD, US)
- Mallika Sastry (Rockville, MD)
- Aliaksandr Druz (Germantown, MD)
Cpc classification
C12N2740/16022
CHEMISTRY; METALLURGY
C12N2740/16034
CHEMISTRY; METALLURGY
C07K16/1063
CHEMISTRY; METALLURGY
A61K39/21
HUMAN NECESSITIES
G01N2469/20
PHYSICS
A61K2039/55555
HUMAN NECESSITIES
A61K2039/55561
HUMAN NECESSITIES
G01N2333/162
PHYSICS
C12N2740/16122
CHEMISTRY; METALLURGY
International classification
A61K39/21
HUMAN NECESSITIES
Abstract
HIV-1 Env ectodomain trimers stabilized in a prefusion mature closed conformation and methods of their use and production are disclosed. In several embodiments, the HIV-1 Env ectodomain trimers and/or nucleic acid molecules can be used to generate an immune response to HIV-1 in a subject. In additional embodiments, the therapeutically effective amount of the HIV-1 Env ectodomain trimers can be administered to a subject in a method of treating or preventing HIV-1 infection.
Claims
1. An mRNA molecule encoding a recombinant Human Immunodeficiency Virus type 1 (HIV-1) Envelope (Env) protein comprising cysteine substitutions at HIV-1 Env positions 201 and 433, wherein the HIV-1 Env positions correspond to a HXB2 reference sequence set forth as SEQ ID NO: 1.
2. The mRNA of claim 1, wherein the cysteine substitutions to introduce a non-natural disulfide bond between at HIV-1 Env positions 201 and 433 are I201C and A433C substitutions.
3. The mRNA of claim 1, further comprising a methionine substitution at HIV-1 Env position 302, and a leucine substitution at HIV-1 Env position 320.
4. The mRNA of claim 3, the methionine substitution at HIV-1 Env position 302 is a N302M substitution, and the leucine substitution at HIV-1 Env position 320 is aT320L substitution.
5. The mRNA of claim 1, further comprising cysteine substitutions at HIV-1 Env positions 501 and 605, and a proline substitution at HIV-1 Env position 559.
6. The mRNA of claim 5, the cysteine substitutions at HIV-1 Env positions 501 and 605 are A501C and T605C substitutions; and the proline substitution at HIV-1 Env position 559 is a I559P substitution.
7. The mRNA of claim 1, further comprising wherein a native furin cleavage site separating gp120 and gp41 subunits of the HIV-1 Env protein is substituted with six arginine residues.
8. A vector comprising the mRNA molecule of claim 1.
9. An isolated host cell comprising the vector of claim 1.
10. An immunogenic composition comprising the mRNA of claim 1, and a pharmaceutically acceptable carrier.
11. A method for generating an immune response to HIV-1 Env in a subject, comprising administering to the subject an amount of the mRNA of claim 1 effective to generate the immune response.
12. The method of claim 11, comprising a prime-boost administration of the mRNA.
13. The method of claim 11, wherein the subject is at risk of or has an HIV-1 infection.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031] The prefusion mature closed conformation of gp120 and gp41 was established from the crystal structure presented in Example 1 and was fit without modification to EMDB-5779 with density from PGV04 fabs computationally removed. The prefusion partially open intermediate conformation was modeled by a rigid body fitting of gp120 to EMDB-2484 with density from VRC03 Fabs computationally removed. α7 of gp41 was extended into the unoccupied density at the N-terminus of the helix using the mature closed structure as a starting model. The prefusion receptor-bound intermediate was modeled by fitting the CD4-bound gp120 core crystal structure (PDB ID 3JWD) to the CD4-bound EMDB-5455 map. V3 of the crystal structure (PDB ID 3H11) was aligned to the core and the V1V2 crystal structure (PDB ID 3U4E) was fit to the remaining density. α7 of gp41 was extended through an alignment with crystal structures of postfusion gp41 (PDB IDs 2X7R, 2EZO). Postfusion gp120 is in the same conformation as the prefusion receptor-bound intermediate and the postfusion gp41 structure was derived from an alignment of SIV and HIV postfusion crystal structures (PDB IDs 2X7R, 2EZO).
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041] : Buried area percentage, one bar per 10%.
[0042]
[0043]
[0044] : Buried area percentage, one bar per 10%.
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
SEQUENCES
[0072] The nucleic and amino acid sequences are shown using standard letter abbreviations for nucleotide bases, and amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an XML file in the form of the file named “4239-93056-13 Sequence Listing.xml” (4,035,499 bytes), which was created on Sep. 20, 2022, which is incorporated by reference herein.
[0073] Table 13 in Example 15 provides a list of sequences and additional information concerning the sequences.
STRUCTURAL COORDINATES
[0074] The atomic coordinates of an asymmetric unit of the crystal structure of a trimeric HIV-1 Env ectodomain (BG505.SOSIP.664) bound to PGT122 and 35O22 Fabs in the prefusion mature closed conformation (as described in Example 1) are recited in Table 1 submitted as an ASCII text named “Table_1.txt” (˜2 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014, and have been deposited with the Protein Data Bank as Acc. No. 4TVP. Table 1 submitted in U.S. Provisional Application No. 62/046,059, and Protein Data Bank Ace. No. 4TVP, are incorporated by reference herein.
[0075] The atomic coordinates of the crystal structure of an HIV-1 Env ectodomain trimer provided in Table 1, without the PGT122 and 35O22 Fabs, are recited in Table 2 submitted as an ASCII text named “Table_2.txt” (˜2 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014. Table 2 provided in U.S. Provisional Application No. 62/046,059 is incorporated by reference herein.
[0076] The atomic coordinates of an asymmetric unit of the crystal structure of an unliganded trimeric HIV-1 Env ectodomain in the prefusion mature closed conformation (as described in Example 2) are recited in Table 3 submitted as an ASCII text named “Table_3.txt” (˜0.7 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014, and have been deposited with the Protein Data Bank as Acc. No. 47MJ. Table 3 submitted in U.S. Provisional Application No. 62/046,059, and Protein Data Bank Acc. No. 47MJ, are incorporated by reference herein.
[0077] The atomic coordinates of the crystal structure of an unliganded trimeric HIV-1 Env ectodomain in the prefusion mature closed conformation (as described in Example 2) are recited in Table 4 submitted as an ASCII text named “Table_4.txt” (˜2 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014. Table 4 provided in U.S. Provisional Application No. 62/046,059 is incorporated by reference herein.
DETAILED DESCRIPTION
[0078] The HIV-1 Env trimer undergoes a dramatic structural rearrangement between its prefusion mature closed conformation and the CD4-bound open conformation (see Example 1, below). As shown in
[0079] Thus, the membrane distal and membrane proximal aspects of the HIV-1 Env ectodomain trimer in its prefusion mature closed conformation include several distinct structural elements that are absent from the corresponding regions of the HIV-1 Env ectodomain trimer in its CD4-bound open conformation. Amino acid positions (and sequences) corresponding to these regions are indicated in
[0080] Notably, in a previously identified HIV-1 Env ectodomain trimer (BG505.SOSIP, described in more detail in Example 1), CD4 triggered recognition by ineffective antibodies so that their average binding was tighter than that of broadly neutralizing antibodies (see Example 2,
[0081] Accordingly, recombinant HIV-1 Env proteins are provided that are stabilized or “locked” in the prefusion mature closed conformation. Using structure-guided design, positions of the HIV-1 Env protein were targeted for modification (e.g., amino acid substitution) to hinder or prevent the HIV-1 Env ectodomain trimer from transitioning from the prefusion mature closed conformation to CD4-bound open conformations. These recombinant HIV-1 Env ectodomain trimers resist transition to the CD4-bound open state of HIV-1 Env, and thus will retain the prefusion mature closed conformation when used as an immunogen to generate an immune response to HIV-1 Env in a subject expressing CD4, such as a human.
I. Summary of Terms
[0082] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes X, published by Jones & Bartlett Publishers, 2009; and Meyers et al. (eds.), The Encyclopedia of Cell Biology and Molecular Medicine, published by Wiley-VCH in 16 volumes, 2008; and other similar references.
[0083] As used herein, the singular forms “a,” “an,” and “the,” refer to both the singular as well as plural, unless the context clearly indicates otherwise. For example, the term “an antigen” includes single or plural antigens and can be considered equivalent to the phrase “at least one antigen.” As used herein, the term “comprises” means “includes.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated. Although many methods and materials similar or equivalent to those described herein can be used, particular suitable methods and materials are described herein. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. To facilitate review of the various embodiments, the following explanations of terms are provided:
[0084] 17b: A monoclonal antibody that specifically binds to a CD4-induced epitope on the HIV-1 Env ectodomain trimer, that is, CD4 binding causes a conformation change in the HIV-1 Env ectodomain trimer that exposes the 17b epitope. Thus, 17b mAb is a “CD4-induced” antibody. The 17b antibody does not specifically bind to the HIV-1 Env ectodomain trimer in its prefusion mature closed conformation. The person of ordinary skill in the art is familiar with monoclonal antibody 17b and with methods of producing this antibody (see, for example, Kwong et al., J. Biol. Chem., 274, 4115-4123, 1999, which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the 17b antibody are known and have been deposited in GenBank as Nos. 1G9N_H (17b V.sub.H) and 1G9N_L (17b V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
[0085] 35O22: A neutralizing monoclonal antibody that specifically binds to an epitope on the membrane-proximal region of HIV-1 Env including residues of both gp120 and gp41. The amino acid sequences of the heavy and light variable regions of the 35O22 antibody are set forth as SEQ ID NOs: 2099 and 2100, respectively, and can be used to generate an antibody with the 35O22 antigen binding domain.
[0086] 447-52D: A monoclonal antibody that specifically binds to the V3 loop of HIV-1 Env. The person of ordinary skill in the art is familiar with monoclonal antibody 447-52D and with methods of producing this antibody (see, for example, Stanfield et al., Structure, 12, 193-204, which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the 447-52D antibody are known and have been deposited in the Protein Data Bank as Nos. 1Q1J_H (447-52D V.sub.H) and 1Q1J_L (447-52D V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
[0087] Adjuvant: A vehicle used to enhance antigenicity. In some embodiments, an adjuvant can include a suspension of minerals (alum, aluminum hydroxide, or phosphate) on which antigen is adsorbed; or water-in-oil emulsion, for example, in which antigen solution is emulsified in mineral oil (Freund incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages). Immunostimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants. Adjuvants include biological molecules (a “biological adjuvant”), such as costimulatory molecules. Exemplary adjuvants include IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, OX-40L, 4-1BBL and toll-like receptor (TLR) agonists, such as TLR-9 agonists. In some embodiments, the Adjuplex™ (Advanced BioAdjuvants) can be used with any of the recombinant HIV-1 Env ectodomain trimers to elicit an immune response to HIV-1 Env. The person of ordinary skill in the art is familiar with adjuvants (see, e.g., Singh (ed.) Vaccine Adjuvants and Delivery Systems. Wiley-Interscience, 2007). Adjuvants can be used in combination with the disclosed immunogens.
[0088] Administration: The introduction of a composition into a subject by a chosen route. Administration can be local or systemic. For example, if the chosen route is intravenous, the composition (such as a composition including a disclosed immunogen) is administered by introducing the composition into a vein of the subject. Exemplary routes of administration include, but are not limited to, oral, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, and intravenous), sublingual, rectal, transdermal (for example, topical), intranasal, vaginal, and inhalation routes.
[0089] Agent: Any substance or any combination of substances that is useful for achieving an end or result; for example, a substance or combination of substances useful for inhibiting HIV infection in a subject. Agents include proteins, nucleic acid molecules, compounds, small molecules, organic compounds, inorganic compounds, or other molecules of interest. An agent can include a therapeutic agent (such as an anti-retroviral agent), a diagnostic agent or a pharmaceutical agent. In some embodiments, the agent is a protein agent (such as a recombinant HIV-1 Env polypeptide or immunogenic fragment thereof), or an anti-viral agent. The skilled artisan will understand that particular agents may be useful to achieve more than one result.
[0090] Amino acid substitutions: The replacement of one amino acid in a polypeptide with a different amino acid or with no amino acid (i.e., a deletion). In some examples, an amino acid in a polypeptide is substituted with an amino acid from a homologous polypeptide, for example, and amino acid in a recombinant Clade A HIV-1 Env polypeptide can be substituted with the corresponding amino acid from a Clade B HIV-1 Env polypeptide.
[0091] Antibody: An immunoglobulin, antigen-binding fragment, or derivative thereof, that specifically binds and recognizes an analyte (antigen) such as HIV-1 gp120, an antigenic fragment thereof, or a dimer or multimer of the antigen. The term “antibody” is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired antigen-binding activity.
[0092] Non-limiting examples of antibodies include, for example, intact immunoglobulins and variants and fragments thereof known in the art that retain binding affinity for the antigen. Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′).sub.2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments. Antibody fragments include antigen binding fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies (see, e.g., Kontermann and Dubel (Ed), Antibody Engineering, Vols. 1-2, 2.sup.nd Ed., Springer Press, 2010).
[0093] Typically, a naturally occurring immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. Immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable domain genes. There are two types of light chain, lambda (k) and kappa (x). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE.
[0094] Light and heavy chain variable regions contain a “framework” region interrupted by three hypervariable regions, also called “complementarity-determining regions” or “CDRs” (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991). The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three-dimensional space. The CDRs are primarily responsible for binding to an epitope of an antigen.
[0095] A “monoclonal antibody” is an antibody produced by a single clone of B-lymphocytes or by a cell into which nucleic acid encoding the light and heavy chains of a single antibody have been transfected, or a progeny thereof. Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells. These fused cells and their progeny are termed “hybridomas.” In some examples monoclonal antibodies are isolated from a subject. Monoclonal antibodies can have conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions. (See, for example, Harlow & Lane, Antibodies, A Laboratory Manual, 2.sup.nd ed. Cold Spring Harbor Publications, New York (2013).)
[0096] Antigen: A compound, composition, or substance that can stimulate the production of antibodies or a T cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous antigens, such as the disclosed HIV antigens. Examples of antigens include, but are not limited to, polypeptides, peptides, lipids, polysaccharides, combinations thereof (such as glycopeptides) and nucleic acids containing antigenic determinants, such as those recognized by an immune cell. In some examples, antigens include peptides derived from a pathogen of interest, such as HIV. An antigen can include one or more epitopes.
[0097] Anti-retroviral agent: An agent that specifically inhibits a retrovirus from replicating or infecting cells. Non-limiting examples of antiretroviral drugs include entry inhibitors (e.g., enfuvirtide), CCR5 receptor antagonists (e.g., aplaviroc, vicriviroc, maraviroc), reverse transcriptase inhibitors (e.g., lamivudine, zidovudine, abacavir, tenofovir, emtricitabine, efavirenz), protease inhibitors (e.g., lopivar, ritonavir, raltegravir, darunavir, atazanavir), maturation inhibitors (e.g., alpha interferon, bevirimat and vivecon).
[0098] Anti-retroviral therapy (ART): A therapeutic treatment for HWV infection involving administration of at least one anti-retroviral agents (e.g., one, two, three or four anti-retroviral agents) to an HIV infected individual during a course of treatment. Non-limiting examples of antiretroviral agents include entry inhibitors (e.g., enfuvirtide), CCR5 receptor antagonists (e.g., aplaviroc, vicriviroc, maraviroc), reverse transcriptase inhibitors (e.g., lamivudine, zidovudine, abacavir, tenofovir, emtricitabine, efavirenz), protease inhibitors (e.g., lopivar, ritonavir, raltegravir, darunavir, atazanavir), maturation inhibitors (e.g., alpha interferon, bevirimat and vivecon). One example of an ART regimen includes treatment with a combination of tenofovir, emtricitabine and efavirenz. In some examples, ART include Highly Active Anti-Retroviral Therapy (HAART).
[0099] Atomic coordinates or structure coordinates: Mathematical coordinates derived from mathematical equations related to the patterns obtained on diffraction of a monochromatic beam of X-rays by the atoms (scattering centers) such as an antigen, or an antigen in complex with an antibody. In some examples that antigen can be HWV-1 Env polypeptide (for example stabilized in a prefusion conformation by binding to a prefusion-specific antibody, or by introduction of stabilizing modifications) in a crystal. The diffraction data are used to calculate an electron density map of the repeating unit of the crystal. The electron density maps are used to establish the positions of the individual atoms within the unit cell of the crystal. In one example, the term “structure coordinates” refers to Cartesian coordinates derived from mathematical equations related to the patterns obtained on diffraction of a monochromatic beam of X-rays, such as by the atoms of a HIV-1 Env polypeptide in crystal form.
[0100] Those of ordinary skill in the art understand that a set of structure coordinates determined by X-ray crystallography is not without standard error. For the purpose of this disclosure, any set of structure coordinates that have a root mean square deviation of protein backbone atoms (N, Cα, C and O) of less than about 1.0 Angstroms when superimposed, such as about 0.75, or about 0.5, or about 0.25 Angstroms, using backbone atoms, shall (in the absence of an explicit statement to the contrary) be considered identical.
[0101] Cavity-filling amino acid substitution: An amino acid substitution that fills a cavity within the protein core of the HIV-1 Env ectodomain trimer. Cavities are essentially voids within a folded protein where amino acids or amino acid side chains are not present. In several embodiments, a cavity filling amino acid substitution is introduced to fill a cavity in the HIV-1 Env ectodomain trimer core present in the prefusion mature closed conformation of HIV-1 Env ectodomain trimer that collapses (e.g., has reduced volume) upon transition to the CD4-bound open conformation.
[0102] CD4: Cluster of differentiation factor 4 polypeptide; a T-cell surface protein that mediates interaction with the MHC class II molecule. CD4 also serves as the primary receptor site for HIV on T-cells during HIV infection. CD4 is known to bind to gp120 from HIV-1 Env. The sequence of the CD4 precursor has a hydrophobic signal peptide, an extracellular region of approximately 370 amino acids, a highly hydrophobic stretch with significant identity to the membrane-spanning domain of the class II MHC beta chain, and a highly charged intracellular sequence of 40 resides (Maddon, Cell 42:93, 1985). The amino acid sequence of human CD4 is deposited in GenBank as No. P01730.1. Several embodiments utilize soluble CD4 (sCD4), which includes the extracellular domain of CD4 (without the signal peptide), approximately CD4 amino acids 26-390 (e.g., SEQ ID NO: 2118). Soluble CD4 can be obtained commercially (e.g., from Mybiosource); methods of its production are well known in the art.
[0103] CD4-induced antibody: An antibody that binds to an epitope present on the CD4-bound open conformation of the HIV-1 Env ectodomain trimer, but not present on the mature closed conformation of the HIV-1 Env ectodomain trimer. An example of a CD4-induced antibody is 17b mAb.
[0104] Conditions sufficient to form an immune complex: Conditions which allow an antibody or antigen binding fragment thereof to bind to its cognate epitope to a detectably greater degree than, and/or to the substantial exclusion of, binding to substantially all other epitopes. Conditions sufficient to form an immune complex are dependent upon the format of the binding reaction and typically are those utilized in immunoassay protocols or those conditions encountered in vivo. See Harlow & Lane, Antibodies, A Laboratory Manual, 2.sup.nd ed. Cold Spring Harbor Publications, New York (2013) for a description of immunoassay formats and conditions. The conditions employed in the methods are “physiological conditions” which include reference to conditions (e.g., temperature, osmolarity, pH) that are typical inside a living mammal or a mammalian cell. While it is recognized that some organs are subject to extreme conditions, the intra-organismal and intracellular environment normally lies around pH 7 (e.g., from pH 6.0 to pH 8.0, more typically pH 6.5 to 7.5), contains water as the predominant solvent, and exists at a temperature above 0° C. and below 50° C. Osmolarity is within the range that is supportive of cell viability and proliferation.
[0105] Conservative variants: “Conservative” amino acid substitutions are those substitutions that do not substantially affect or decrease a function of a protein, such as the ability of the protein to induce an immune response when administered to a subject. The term conservative variation also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid. Furthermore, one of ordinary skill will recognize that individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids (for instance less than 5%, in some embodiments less than 1%) in an encoded sequence are conservative variations where the alterations result in the substitution of an amino acid with a chemically similar amino acid.
[0106] Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another:
[0107] 1) Alanine (A), Serine (S), Threonine (T);
[0108] 2) Aspartic acid (D), Glutamic acid (E);
[0109] 3) Asparagine (N), Glutamine (Q);
[0110] 4) Arginine (R), Lysine (K);
[0111] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and
[0112] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
[0113] Non-conservative substitutions are those that reduce an activity or function of the recombinant Env protein, such as the ability to induce an immune response when administered to a subject. For instance, if an amino acid residue is essential for a function of the protein, even an otherwise conservative substitution may disrupt that activity. Thus, a conservative substitution does not alter the basic function of a protein of interest.
[0114] Circular permutant: A modified recombinant protein in which the connections between different regions of a protein tertiary structure is modified, so that the relative order of different regions in the primary sequence is altered, but the placement of the regions in the tertiary structure is preserved. For example, with a 4-stranded antiparallel sheet, with strand A, B, C and D, which has the following N and C termini and connectivity:
[0115] Nterm-strand A-linker-strand B-linker-strand C-linker-strand D-Cterm, circular permutants of the 4 strands, A, B, C and D by altering linker connection between strands can include: [0116] Permutation with N- and C-termini altered:
[0117] Nterm-strand C-linker-strand D-linker-strand A-linker-strand B-Cterm [0118] Permutation with N terminus preserved:
[0119] Nterm-strand A-linker-strand D-linker-strand C-linker-strand B-C term [0120] Permutation with C terminus preserved:
[0121] Nterm-strand C-linker-strand B-linker-strand A-linker-strand D-C term.
[0122] Contacting: Placement in direct physical association; includes both in solid and liquid form, which can take place either in vivo or in vitro. Contacting includes contact between one molecule and another molecule, for example the amino acid on the surface of one polypeptide, such as a peptide, that contacts another polypeptide. Contacting can also include contacting a cell for example by placing a polypeptide in direct physical association with a cell.
[0123] Control: A reference standard. In some embodiments, the control is a negative control sample obtained from a healthy patient. In other embodiments, the control is a positive control sample obtained from a patient diagnosed with HIV infection. In still other embodiments, the control is a historical control or standard reference value or range of values (such as a previously tested control sample, such as a group of HIV patients with known prognosis or outcome, or group of samples that represent baseline or normal values).
[0124] A difference between a test sample and a control can be an increase or conversely a decrease. The difference can be a qualitative difference or a quantitative difference, for example a statistically significant difference. In some examples, a difference is an increase or decrease, relative to a control, of at least about 5%, such as at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 500%, or greater than 500%.
[0125] Degenerate variant: In the context of the present disclosure, a “degenerate variant” refers to a polynucleotide encoding a polypeptide (such as a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof) that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences encoding a peptide are included as long as the amino acid sequence of the peptide encoded by the nucleotide sequence is unchanged.
[0126] Detecting: To identify the existence, presence, or fact of something. General methods of detecting are known to the skilled artisan and may be supplemented with the protocols and reagents disclosed herein. For example, included herein are methods of detecting the level of a protein in a sample or a subject.
[0127] Epitope: An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic, such that they elicit a specific immune response, for example, an epitope is the region of an antigen to which B and/or T cells respond. An antibody can bind to a particular antigenic epitope, such as an epitope on HIV-1 Env.
[0128] Expression: Transcription or translation of a nucleic acid sequence. For example, a gene is expressed when its DNA is transcribed into an RNA or RNA fragment, which in some examples is processed to become mRNA. A gene may also be expressed when its mRNA is translated into an amino acid sequence, such as a protein or a protein fragment. In a particular example, a heterologous gene is expressed when it is transcribed into an RNA. In another example, a heterologous gene is expressed when its RNA is translated into an amino acid sequence. The term “expression” is used herein to denote either transcription or translation. Regulation of expression can include controls on transcription, translation, RNA transport and processing, degradation of intermediary molecules such as mRNA, or through activation, inactivation, compartmentalization or degradation of specific protein molecules after they are produced.
[0129] Expression control sequences: Nucleic acid sequences that regulate the expression of a heterologous nucleic acid sequence to which it is operatively linked. Expression control sequences are operatively linked to a nucleic acid sequence when the expression control sequences control and regulate the transcription and, as appropriate, translation of the nucleic acid sequence. Thus expression control sequences can include appropriate promoters, enhancers, transcription terminators, a start codon (ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons. The term “control sequences” is intended to include, at a minimum, components whose presence can influence expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. Expression control sequences can include a promoter.
[0130] A promoter is a minimal sequence sufficient to direct transcription. Also included are those promoter elements which are sufficient to render promoter-dependent gene expression controllable for cell-type specific, tissue-specific, or inducible by external signals or agents; such elements may be located in the 5′ or 3′ regions of the gene. Both constitutive and inducible promoters are included (see for example, Bitter et al., Methods in Enzymology 153:516-544, 1987). For example, when cloning in bacterial systems, inducible promoters such as μL of bacteriophage lambda, plac, ptrp, ptac (ptrp-lac hybrid promoter) and the like may be used. In one embodiment, when cloning in mammalian cell systems, promoters derived from the genome of mammalian cells (such as metallothionein promoter) or from mammalian viruses (such as the retrovirus long terminal repeat; the adenovirus late promoter; the vaccinia virus 7.5K promoter) can be used. Promoters produced by recombinant DNA or synthetic techniques may also be used to provide for transcription of the nucleic acid sequences.
[0131] A polynucleotide can be inserted into an expression vector that contains a promoter sequence which facilitates the efficient transcription of the inserted genetic sequence of the host. The expression vector typically contains an origin of replication, a promoter, as well as specific nucleic acid sequences that allow phenotypic selection of the transformed cells.
[0132] Expression vector: A vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
[0133] Heterologous: Originating from a different genetic source. A nucleic acid molecule that is heterologous to a cell originated from a genetic source other than the cell in which it is expressed. In one specific, non-limiting example, a heterologous nucleic acid molecule encoding a recombinant HIV-1 Env polypeptide is expressed in a cell, such as a mammalian cell. Methods for introducing a heterologous nucleic acid molecule in a cell or organism are well known in the art, for example transformation with a nucleic acid, including electroporation, lipofection, particle gun acceleration, and homologous recombination.
[0134] F105: A monoclonal antibody that specifically binds to a conformational epitope on HIV-1 Env that is not present on the prefusion mature closed conformation. The F105 antibody does not specifically bind to HIV-1 Env in its prefusion mature closed conformation. The person of ordinary skill in the art is familiar with monoclonal antibody F105 and with methods of producing this antibody (see, for example, Posner et al. J Acquired Immune Defic Syndr 6:7-14, 1993; which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the F105 antibody are known and have been deposited in the Protein Data Bank (PDB) as No. 1U6A_H (F105 V.sub.H) and 1U6A-L (F105 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
[0135] Ferritin: A protein that stores iron and releases it in a controlled fashion. The protein is produced by almost all living organisms. Ferritin polypeptides assemble into a globular protein complex of 24 protein subunits, each of the 24 subunits includes a single ferritin polypeptide. In some examples, ferritin is used to form a nanoparticle presenting antigens on its surface, for example, an HIV antigen.
[0136] Foldon domain: An amino acid sequence that naturally forms a trimeric structure. In some examples, a Foldon domain can be included in the amino acid sequence of a disclosed recombinant protein so that the antigen will form a trimer. In one example, a Foldon domain is the T4 Foldon domain including the amino acid sequence set forth as (GYIPEAPRDGQAYVRKDGEWVLLSTF (SEQ ID NO: 578). Several embodiments include a Foldon domain that can be cleaved from a purified protein, for example by incorporation of a thrombin cleave site adjacent to the Foldon domain that can be used for cleavage purposes.
[0137] Glycosylation site: An amino acid sequence on the surface of a polypeptide, such as a protein, which accommodates the attachment of a glycan. An N-linked glycosylation site is triplet sequence of NX(S/T) in which N is asparagine, X is any residues except proline, and (S/T) is a serine or threonine residue. A glycan is a polysaccharide or oligosaccharide. Glycan may also be used to refer to the carbohydrate portion of a glycoconjugate, such as a glycoprotein, glycolipid, or a proteoglycan.
[0138] Homologous proteins: Proteins that have a similar structure and function, for example, proteins from two or more species or viral strains that have similar structure and function in the two or more species or viral strains. For example a HIV-1 Env protein from a Clade A virus is a homologous protein to a HIV-1 Env protein from Clade B virus. Homologous proteins share similar protein folding characteristics and can be considered structural homologs.
[0139] Homologous proteins typically share a high degree of sequence conservation, such as at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence conservation, and a high degree of sequence identity, such as at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity.
[0140] Host cells: Cells in which a vector can be propagated and its DNA expressed. The cell may be prokaryotic or eukaryotic. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term “host cell” is used.
[0141] Human Immunodeficiency Virus (HIV): A retrovirus that causes immunosuppression in humans (HIV disease), and leads to a disease complex known as the acquired immunodeficiency syndrome (AIDS). “HIV disease” refers to a well-recognized constellation of signs and symptoms (including the development of opportunistic infections) in persons who are infected by an HIV virus, as determined by antibody or western blot studies. Laboratory findings associated with this disease include a progressive decline in T cells. HIV includes HIV type 1 (HIV-1) and HIV type 2 (HIV-2). Related viruses that are used as animal models include simian immunodeficiency virus (SIV), and feline immunodeficiency virus (FIV). Treatment of HIV-1 with HAART has been effective in reducing the viral burden and ameliorating the effects of HIV-1 infection in infected individuals.
[0142] HIV-1 broadly neutralizing antibody: An antibody that reduces the infectious titer of HIV-1 by binding to and inhibiting the function of related HIV-1 antigens, such as antigens that share at least 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with antigenic surface of the antigen. In some embodiments, broadly neutralizing antibodies to HIV are distinct from other antibodies to HIV in that they neutralize a high percentage (such as at least 50% or at least 80%) of the many types of HIV in circulation. Non-limiting examples of HIV-1 broadly neutralizing antibodies include PGT122, VRC01, and 35O22.
[0143] HIV envelope protein (Env): The HIV envelope protein is initially synthesized as a precursor protein of 845-870 amino acids in size, designated gp160. Individual gp160 polypeptides form a homotrimer and undergo glycosylation within the Golgi apparatus as well as processing to remove the signal peptide, and cleavage by a cellular protease between approximately positions 511/512 to generate separate gp120 and gp41 polypeptide chains, which remain associated as gp120-gp41 protomers within the homotrimer. The ectodomain (that is, the extracellular portion) of the HIV-1 Env trimer undergoes several structural rearrangements from a prefusion mature (cleaved) closed conformation that evades antibody recognition, through intermediate conformations that bind to receptors CD4 and co-receptor (either CCR5 or CXCR4), to a postfusion conformation. The HIV-1 Env ectodomain includes the gp120 protein (approximately HIV-1 Env positions 31-511) and the gp41 ectodomain (approximately HIV-1 Env positions 512-644). An HIV-1 Env ectodomain trimer includes a protein complex of three HIV-1 Env ectodomains. Mature gp120 includes approximated HIV-1 Env residues 31-511, contains most of the external, surface-exposed, domains of the HIV-1 Env trimer, and it is gp120 which binds both to cellular CD4 receptors and to cellular chemokine receptors (such as CCR5). A mature gp120 polypeptide is an extracellular polypeptide that interacts with the gp41 ectodomain to form an HIV-1 Env protomer that trimerizes to form the HIV-1 Env trimer. The mature gp120 wild-type polypeptide is heavily N-glycosylated, giving rise to an apparent molecular weight of 120 kD. Native gp120 includes five conserved regions (C1-C5) and five regions of high variability (V1-V5). See
[0144] Variable region 1 and Variable Region 2 (V1/V2 domain) of gp120 are comprised of ˜50-90 residues which contain two of the most variable portions of HIV-1 (the V1 domain and the V2 loop), and one in ten residues of the V1/V2 domain are N-glycosylated. Despite the diversity and glycosylation of the V1/V2 domain, a number of broadly neutralizing human antibodies have been identified that target this region, including PG9 and PGT122. In some examples the V1/V2 domain includes gp120 positions 126-196. Variable region 3 (V3) of gp120 includes approximately 35-45 amino acids. In some examples the V1/V2 domain includes gp120 positions 296-331. Mature gp41 includes approximately HIV-1 Env residues 512-860, and includes cytosolic-, transmembrane- and ecto-domains. The gp41 ectodomain (including approximately HIV-1 Env residues 512-644) can interact with gp120 to form an HIV-1 Env protomer that trimerizes to form the HIV-1 Env trimer. See
[0145] The numbering used in the disclosed HIV-1 Env proteins and fragments thereof is relative to the HXB2 numbering scheme as set forth in Numbering Positions in HIV Relative to HXB2CG Bette Korber et al., Human Retroviruses and AIDS 1998: A Compilation and Analysis of Nucleic Acid and Amino Acid Sequences. Korber et al., Eds. Theoretical Biology and Biophysics Group, Los Alamos National Laboratory, Los Alamos, N. Mex., which is incorporated by reference herein in its entirety.
[0146] In one example, an HIV-1 Env protein is from the BG505 strain of HIV, which is a Clade A HIV-1 virus isolated from a six-week old HIV-1 infected infant. The amino acid sequence of BG505 Env protein is known (see, e.g., GenBank accession no. ABA61516, incorporated by reference herein as present in the database on Jun. 20, 2014), and set forth as SEQ ID NO: 2.
[0147] HIV-1 Env ectodomain trimer prefusion mature closed conformation: A structural conformation adopted by the ectodomain of the HIV-1 Env ectodomain trimer after cellular processing to a mature prefusion state with distinct gp120 and gp41 polypeptide chains, and before specific binding to the CD4 receptor. In the prefusion mature closed conformation, the HIV-1 Env ectodomain trimer includes a V1V2 domain “cap” at its membrane distal apex, with the V1V2 domain of each Env protomer in the trimer coming together at the membrane distal apex. At the membrane proximal aspect, the HIV-1 Env ectodomain trimer includes distinct α6 and α7 helices. CD4 binding to the Env trimer causes changes in the conformation of the HIV-1 Env ectodomain trimer, including disruption of the V1V1 domain cap, which “opens” as each V1V2 domain moves outward from the longitudinal axis of the Env trimer, and formation of the HR1 helix, which includes both the α6 and α7 helices (which are no longer distinct, see
[0148] HIV-1 Env ectodomain trimer stabilized in a prefusion mature closed conformation: A HIV-1 Env ectodomain trimer having a prefusion mature closed conformation and including one or more amino acid substitutions, deletions, or insertions compared to a native HIV-1 Env sequence that provide for increased retention of the prefusion mature closed conformation upon CD4 binding compared to a corresponding native HIV-1 Env sequence. In some embodiments, the HIV-1 Env ectodomain trimer can include one or more cysteine substitutions that allow formation of a non-natural disulfide bond that stabilizes the HIV-1 Env ectodomain trimer in its prefusion mature closed conformation.
[0149] A HIV-1 Env ectodomain trimer stabilized in the prefusion mature closed conformation has at least 90% (such as at least 95% or at least 99%) reduced transition to the CD4-bound open conformation upon CD4 binding compared to a corresponding native HIV-1 Env sequence. The “stabilization” of the prefusion mature closed conformation by the one or more amino acid substitutions, deletions, or insertions can be, for example, energetic stabilization (for example, reducing the energy of the prefusion mature closed conformation relative to the CD4-bound open conformation) and/or kinetic stabilization (for example, reducing the rate of transition from the prefusion mature closed conformation to the prefusion mature closed conformation). Additionally, stabilization of the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation can include an increase in resistance to denaturation compared to a corresponding native HIV-1 Env sequence.
[0150] Methods of determining if a HIV-1 Env ectodomain trimer is in the prefusion mature closed conformation are provided herein, and include (but are not limited to) negative stain electron microscopy and antibody binding assays using a prefusion mature closed conformation specific antibody, such as VRC26 or PGT145. Methods of determining if a HIV-1 Env ectodomain trimer is in the CD4-bound open conformation are also provided herein, and include (but are not limited to) negative stain electron microscopy and antibody binding assays using a CD4-bound open conformation specific antibody, such as 17b, which binds to a CD4-induced epitope. Transition from the prefusion mature closed conformation upon CD4 binding can be assayed, for example, by incubating a HIV-1 Env ectodomain trimer of interest that is in the prefusion mature closed conformation with a molar excess of CD4, and determining if the HIV-1 Env ectodomain trimer retains the prefusion mature closed conformation (or transitions to the CD4-bound open conformation) by negative stain electron microscopy analysis, or antigenic analysis.
[0151] HIV-1 gp140: A recombinant HIV Env polypeptide including gp120 and the gp41 ectodomain, but not the gp41 transmembrane or cytosolic domains. HIV-1 gp140 polypeptides can trimerize to form a soluble HIV-1 Env ectodomain trimer.
[0152] HIV-1 gp145: A recombinant HIV Env polypeptide including gp120, the gp41 ectodomain, and the gp41 transmembrane domain. HIV-1 gp145 polypeptides can trimerize to form membrane bound HIV-1 Env ectodomain trimers.
[0153] HXB2 numbering system: A reference numbering system for HIV protein and nucleic acid sequences, using the HIV-1 HXB2 strain sequences as a reference for all other HIV-1 strain sequences. The person of ordinary skill in the art is familiar with the HXB2 numbering system, and this system is set forth in “Numbering Positions in HIV Relative to HXB2CG,” Bette Korber et al., Human Retroviruses and AIDS 1998: A Compilation and Analysis of Nucleic Acid and Amino Acid Sequences. Korber B, Kuiken C L, Foley B, Hahn B, McCutchan F, Mellors J W, and Sodroski J, Eds. Theoretical Biology and Biophysics Group, Los Alamos National Laboratory, Los Alamos, N. Mex., which is incorporated by reference herein in its entirety. Unless context indicates otherwise, the numbering used in HIV-1 polypeptides disclosed herein is relative to the HXB2 numbering scheme. For reference, the amino acid sequence of HIV-1 Env of HXB2 is set forth as SEQ ID NO: 1 (GENBANK® Accession No. K03455, incorporated by reference herein as present in the database on Jun. 20, 2014).
[0154] Immune response: A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In one embodiment, the response is specific for a particular antigen (an “antigen-specific response”). In one embodiment, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. In another embodiment, the response is a B cell response, and results in the production of specific antibodies. “Priming an immune response” refers to pre-treatment of a subject with an adjuvant to increase the desired immune response to a later administered immunogenic agent. “Enhancing an immune response” refers to co-administration of an adjuvant and an immunogenic agent, wherein the adjuvant increases the desired immune response to the immunogenic agent compared to administration of the immunogenic agent to the subject in the absence of the adjuvant.
[0155] Immunogen: A protein or a portion thereof that is capable of inducing an immune response in a mammal, such as a mammal infected or at risk of infection with a pathogen. Administration of an immunogen can lead to protective immunity and/or proactive immunity against a pathogen of interest. In some examples, an immunogen comprises a recombinant HIV-1 Env ectodomain trimer as disclosed herein.
[0156] Immunogenic composition: A composition comprising an immunogenic polypeptide, or a nucleic acid molecule or vector encoding an immunogenic polypeptide that induces a measurable CTL response against the immunogenic polypeptide, or induces a measurable B cell response (such as production of antibodies) against the immunogenic polypeptide. In one example, an “immunogenic composition” is a composition that includes a disclosed recombinant HIV-1 Env ectodomain trimer or immunogenic fragment thereof, that induces a measurable CTL response against an HIV-1 virus, or induces a measurable B cell response (such as production of antibodies) against a HIV-1. It further refers to isolated nucleic acids encoding an antigen, such as a nucleic acid that can be used to express the antigen (and thus be used to elicit an immune response against this peptide).
[0157] For in vitro use, an immunogenic composition may comprise or consist of the isolated protein or nucleic acid molecule encoding the protein. For in vivo use, the immunogenic composition will typically include the protein or nucleic acid molecule in a pharmaceutically acceptable carrier and may also include other agents, such as an adjuvant. Any particular protein, such as a disclosed recombinant HIV-1 Env ectodomain trimer or a nucleic acid encoding the protein, can be readily tested for its ability to induce a CTL or B cell response by art-recognized assays. Immunogenic compositions can include adjuvants, which are well known to one of skill in the art.
[0158] Immunogenic polypeptide: A polypeptide which comprises an allele-specific motif, an epitope or other sequence such that the polypeptide will bind an MHC molecule and induce an immune response, such as a cytotoxic T lymphocyte (“CTL”) response, and/or a B cell response (for example, antibody production), and/or a T-helper lymphocyte response against the antigen from which the immunogenic polypeptide is derived.
[0159] Isolated: An “isolated” biological component (such as a protein, for example a disclosed immunogen or nucleic acid encoding such an antigen) has been substantially separated or purified away from other biological components, such as other biological components in which the component naturally occurs, such as other chromosomal and extrachromosomal DNA, RNA, and proteins. Proteins, peptides and nucleic acids that have been “isolated” include proteins purified by standard purification methods. The term also embraces proteins or peptides prepared by recombinant expression in a host cell as well as chemically synthesized proteins, peptides and nucleic acid molecules. Isolated does not require absolute purity, and can include protein, peptide, or nucleic acid molecules that are at least 50% isolated, such as at least 75%, 80%, 90%, 95%, 98%, 99%, or even 99.9% isolated. The HIV-1 Env proteins herein that are stabilized in a prefusion mature closed conformation can be isolated from HIV-1 Env proteins in a prefusion CD4 bound conformation, for example, can be at least 80% isolated, at least 90%, 95%, 98%, 99%, or even 99.9% isolated from HIV-1 Env proteins in a prefusion CD4 bound conformation.
[0160] K.sub.D: The dissociation constant for a given interaction, such as a polypeptide ligand interaction or an antibody antigen interaction. For example, for the bimolecular interaction of an antibody or antigen binding fragment and an immunogen (such as HIV-1 Env polypeptide) it is the concentration of the individual components of the bimolecular interaction divided by the concentration of the complex.
[0161] Linker: A bi-functional molecule that can be used to link two molecules into one contiguous molecule, for example, to link a carrier molecule to a immunogenic polypeptide. Non-limiting examples of peptide linkers include glycine-serine linkers, such as a (GGGGS), linker or a 10 amino acid glycine-serine linker. Unless context indicates otherwise, reference to “linking” a first polypeptide and a second polypeptide (or to two polypeptides “linked” together) refers to covalent linkage by peptide bond, or (if a peptide linker is involved) covalent linkage of the first and second polypeptides to the N and C termini of a peptide linker. Thus, reference to a gp120 polypeptide “linked” to a gp41 ectodomain by a peptide linker indicates that the gp120 polypeptide and the gp41 ectodomain are linked to opposite ends of the peptide linker by peptide bonds. Typically, such linkage is accomplished using molecular biology techniques to genetically manipulate DNA encoding the first polypeptide linked to the second polypeptide by the peptide linker.
[0162] The terms “conjugating,” “joining,” “bonding,” can refer to making two molecules into one contiguous molecule; for example, joining two polypeptides into one contiguous polypeptide, or covalently attaching a carrier molecule or other molecule to an immunogenic polypeptide, such as an recombinant HIV-1 Env ectodomain as disclosed herein. The conjugate can be either by chemical or recombinant means. “Chemical means” refers to a reaction, for example, between the immunogenic polypeptide moiety and the carrier molecule such that there is a covalent bond formed between the two molecules to form one molecule.
[0163] Neutralizing antibody: An antibody which reduces the infectious titer of an infectious agent by binding to a specific antigen on the infectious agent. In some examples the infectious agent is a virus. In some examples, an antibody that is specific for HIV-1 Env neutralizes the infectious titer of HIV. A “broadly neutralizing antibody” is an antibody that binds to and inhibits the function of related antigens, such as antigens that share at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identity antigenic surface of antigen. With regard to an antigen from a pathogen, such as a virus, the antibody can bind to and inhibit the function of an antigen from more than one class and/or subclass of the pathogen. For example, with regard to a human immunodeficiency virus, the antibody can bind to and inhibit the function of an antigen, such as HIV-1 Env from more than one clade. In one embodiment, broadly neutralizing antibodies to HIV are distinct from other antibodies to HIV in that they neutralize a high percentage of the many types of HIV in circulation.
[0164] Native protein, sequence, or di-sulfide bond: An polypeptide, sequence or di-sulfide bond that has not been modified, for example by selective mutation. For example, selective mutation to focus the antigenicity of the antigen to a target epitope, or to introduce a di-sulfide bond into a protein that does not occur in the native protein. Native protein or native sequence are also referred to as wild-type protein or wild-type sequence. A non-native di-sulfide bond is a disulfide bond that is not present in a native protein, for example a di-sulfide bond that forms in a protein due to introduction of one or more cysteine residues into the protein by genetic engineering.
[0165] Nucleic acid: A polymer composed of nucleotide units (ribonucleotides, deoxyribonucleotides, related naturally occurring structural variants, and synthetic non-naturally occurring analogs thereof) linked via phosphodiester bonds, related naturally occurring structural variants, and synthetic non-naturally occurring analogs thereof. It will be understood that when a nucleotide sequence is represented by a DNA sequence (i.e., A, T, G, C), this also includes an RNA sequence (i.e., A, U, G, C) in which “U” replaces “T.”
[0166] “Nucleotide” includes, but is not limited to, a monomer that includes a base linked to a sugar, such as a pyrimidine, purine or synthetic analogs thereof, or a base linked to an amino acid, as in a peptide nucleic acid (PNA). A nucleotide is one monomer in a polynucleotide. A nucleotide sequence refers to the sequence of bases in a polynucleotide.
[0167] Conventional notation is used herein to describe nucleotide sequences: the left-hand end of a single-stranded nucleotide sequence is the 5′-end; the left-hand direction of a double-stranded nucleotide sequence is referred to as the 5′-direction. The direction of 5′ to 3′ addition of nucleotides to nascent RNA transcripts is referred to as the transcription direction. The DNA strand having the same sequence as an mRNA is referred to as the “coding strand;” sequences on the DNA strand having the same sequence as an mRNA transcribed from that DNA and which are located 5′ to the 5′-end of the RNA transcript are referred to as “upstream sequences;” sequences on the DNA strand having the same sequence as the RNA and which are 3′ to the 3′ end of the coding RNA transcript are referred to as “downstream sequences.”
[0168] “cDNA” refers to a DNA that is complementary or identical to an mRNA, in either single stranded or double stranded form.
[0169] “Encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA produced by that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and non-coding strand, used as the template for transcription, of a gene or cDNA can be referred to as encoding the protein or other product of that gene or cDNA. Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns.
[0170] Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter, such as the CMV promoter, is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
[0171] PGT121, PGT122, and PGT123: A family of neutralizing monoclonal antibodies that specifically bind to the V1/V2 and V3 regions of HIV-1 Env and can inhibit HIV-1 infection of target cells. The person of ordinary skill in the art is familiar with the PGT121, PGT122, and PGT123 mAbs and with methods of producing them (see, for example, Walker et al., Nature, 477:466-470, 2011, and Int. Pub. No. WO 2012/030904, each of which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the PGT121, PGT122, and PGT123 antibodies are known and have been deposited in GenBank as Nos. AEN14390.1 (PGT121 V.sub.H), AEN14407.1 (PGT121 V.sub.L), JN201895.1 (PGT122 V.sub.H), JN201912.1 (PGT122 V.sub.L), JN201896.1 (PGT123 V.sub.H), and JN201913.1 (PGT123 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014)
[0172] PGT141, PGT142, PGT143, and PGT145: A family of broadly neutralizing monoclonal antibodies that specifically bind to the V1/V2 domain of the HIV-1 Env ectodomain trimer in its prefusion mature closed conformation, and which can inhibit HIV-1 infection of target cells. The person of ordinary skill in the art is familiar with the PGT141, PGT142, PGT143, and PGT145 mAbs and with methods of producing them (see, for example, Walker et al., Nature, 477:466-470, 2011, and Int. Pub. No. WO2012/030904, each of which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the PGT141, PGT142, PGT143, PGT144, and PGT145 mAbs are known and have been deposited in GenBank as Nos. JN201906.1 (PGT141 V.sub.H), JN201923.1 (PGT141 V.sub.L), JN201907.1 (PGT142 V.sub.H), JN201924.1 (PGT142 V.sub.L), JN201908.1 (PGT143 V.sub.H), JN201925.1 (PGT143 V.sub.L), JN201909.1 (PGT144 V.sub.H), JN201926.1 (PGT144 V.sub.L), JN201910.1 (PGT145 V.sub.H), and JN201927.1 (PGT145 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
[0173] PGT151: A broadly neutralizing monoclonal antibody that specifically bind to the gp120/gp41 interface of HIV-1 Env in its prefusion mature (cleaved) conformation, and which can inhibit HIV-1 infection of target cells. The person of ordinary skill in the art is familiar with the PGT151 antibody and with methods of producing this antibody (see, for example, Blattner et al., Immunity, 40, 669-680, 2014, and Falkowska et al., Immunity, 40, 657-668, 2014, each of which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the PGT151 mAb are known and have been deposited in GenBank as Nos. KJ700282.1 (PGT151 V.sub.H) and KJ700290.1 (PGT151 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
[0174] Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, Pa., 19th Edition, 1995, describes compositions and formulations suitable for pharmaceutical delivery of the disclosed immunogens.
[0175] In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (e.g., powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate. In particular embodiments, suitable for administration to a subject the carrier may be sterile, and/or suspended or otherwise contained in a unit dosage form containing one or more measured doses of the composition suitable to induce the desired anti-HIV-1 immune response. It may also be accompanied by medications for its use for treatment purposes. The unit dosage form may be, for example, in a sealed vial that contains sterile contents or a syringe for injection into a subject, or lyophilized for subsequent solubilization and administration or in a solid or controlled release dosage.
[0176] Polypeptide: Any chain of amino acids, regardless of length or post-translational modification (e.g., glycosylation or phosphorylation). “Polypeptide” applies to amino acid polymers including naturally occurring amino acid polymers and non-naturally occurring amino acid polymer as well as in which one or more amino acid residue is a non-natural amino acid, for example an artificial chemical mimetic of a corresponding naturally occurring amino acid. A “residue” refers to an amino acid or amino acid mimetic incorporated in a polypeptide by an amide bond or amide bond mimetic. A polypeptide has an amino terminal (N-terminal) end and a carboxy terminal (C-terminal) end. “Polypeptide” is used interchangeably with peptide or protein, and is used herein to refer to a polymer of amino acid residues. A protein can include multiple polypeptide chains; for example, mature HIV-1 Env includes gp120 and gp41 polypeptide chains. Additionally, a single contiguous polypeptide chain of amino acid residues can include multiple polypeptides. For example, a single chain HIV-1 Env can include a gp120 polypeptide linked to a gp41 polypeptide by a peptide linker.
[0177] In many instances, one or more polypeptides can fold into a specific three-dimensional structure including surface-exposed amino acid residues and non-surface-exposed amino acid residues. In some instances a protein can include multiple polypeptides that fold together into a functional unit. For example, the HIV-1 Env protein is composed of three gp120-gp41 protomers that trimerize in to a multimeric protein. “Surface-exposed amino acid residues” are those amino acids that have some degree of exposure on the surface of the protein, for example such that they can contact the solvent when the protein is in solution. In contrast, non-surface-exposed amino acids are those amino acid residues that are not exposed on the surface of the protein, such that they do not contact solution when the protein is in solution. In some examples, the non-surface-exposed amino acid residues are part of the protein core.
[0178] A “protein core” is the interior of a folded protein, which is substantially free of solvent exposure, such as solvent in the form of water molecules in solution. Typically, the protein core is predominately composed of hydrophobic or apolar amino acids. In some examples, a protein core may contain charged amino acids, for example aspartic acid, glutamic acid, arginine, and/or lysine. The inclusion of uncompensated charged amino acids (a compensated charged amino can be in the form of a salt bridge) in the protein core can lead to a destabilized protein. That is, a protein with a lower T.sub.m then a similar protein without an uncompensated charged amino acid in the protein core. In other examples, a protein core may have a cavity within the protein core. Cavities are essentially voids within a folded protein where amino acids or amino acid side chains are not present. Such cavities can also destabilize a protein relative to a similar protein without a cavity. Thus, when creating a stabilized form of a protein, it may be advantageous to substitute amino acid residues within the core in order to fill cavities present in the wild-type protein.
[0179] Polypeptide modifications: Polypeptides and peptides, such as the recombinant HIV-1 Env proteins disclosed herein can be modified by a variety of chemical techniques to produce derivatives having essentially the same activity as the unmodified peptides, and optionally having other desirable properties. For example, carboxylic acid groups of the protein, whether carboxyl-terminal or side chain, may be provided in the form of a salt of a pharmaceutically-acceptable cation or esterified to form a C.sub.1-C.sub.16 ester, or converted to an amide of formula NR.sub.1R.sub.2 wherein R.sub.1 and R.sub.2 are each independently H or C.sub.1-C.sub.16 alkyl, or combined to form a heterocyclic ring, such as a 5- or 6-membered ring. Amino groups of the peptide, whether amino-terminal or side chain, may be in the form of a pharmaceutically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric and other organic salts, or may be modified to C.sub.1-C.sub.16 alkyl or dialkyl amino or further converted to an amide.
[0180] Hydroxyl groups of the peptide side chains can be converted to C.sub.1-C.sub.16 alkoxy or to a C.sub.1-C.sub.16 ester using well-recognized techniques. Phenyl and phenolic rings of the peptide side chains can be substituted with one or more halogen atoms, such as F, Cl, Br or I, or with C.sub.1-C.sub.16 alkyl, C.sub.1-C.sub.16 alkoxy, carboxylic acids and esters thereof, or amides of such carboxylic acids. Methylene groups of the peptide side chains can be extended to homologous C.sub.2-C.sub.4 alkylenes. Thiols can be protected with any one of a number of well-recognized protecting groups, such as acetamide groups. Those skilled in the art will also recognize methods for introducing cyclic structures into the peptides of this disclosure to select and provide conformational constraints to the structure that result in enhanced stability. For example, a C- or N-terminal cysteine can be added to the peptide, so that when oxidized the peptide will contain a disulfide bond, generating a cyclic peptide. Other peptide cyclizing methods include the formation of thioethers and carboxyl- and amino-terminal amides and esters.
[0181] Prime-boost vaccination: An immunotherapy including administration of a first immunogenic composition (the primer vaccine) followed by administration of a second immunogenic composition (the booster vaccine) to a subject to induce an immune response. The primer vaccine and/or the booster vaccine include a vector (such as a viral vector, RNA, or DNA vector) expressing the antigen to which the immune response is directed. The booster vaccine is administered to the subject after the primer vaccine; the skilled artisan will understand a suitable time interval between administration of the primer vaccine and the booster vaccine, and examples of such timeframes are disclosed herein. In some embodiments, the primer vaccine, the booster vaccine, or both primer vaccine and the booster vaccine additionally include an adjuvant. In one non-limiting example, the primer vaccine is a DNA-based vaccine (or other vaccine based on gene delivery), and the booster vaccine is a protein subunit or protein nanoparticle based vaccine.
[0182] Protein nanoparticle: A multi-subunit, protein-based polyhedron shaped structure. The subunits are each composed of proteins or polypeptides (for example a glycosylated polypeptide), and, optionally of single or multiple features of the following: nucleic acids, prosthetic groups, organic and inorganic compounds. Non-limiting examples of protein nanoparticles include ferritin nanoparticles (see, e.g., Zhang, Y. Int. J. Mol. Sci., 12:5406-5421, 2011, incorporated by reference herein), encapsulin nanoparticles (see, e.g., Sutter et al., Nature Struct. and Mol. Biol., 15:939-947, 2008, incorporated by reference herein), Sulfur Oxygenase Reductase (SOR) nanoparticles (see, e.g., Urich et al., Science, 311:996-1000, 2006, incorporated by reference herein), lumazine synthase nanoparticles (see, e.g., Zhang et al., J. Mol. Biol., 306: 1099-1114, 2001) or pyruvate dehydrogenase nanoparticles (see, e.g., Izard et al., PNAS 96: 1240-1245, 1999, incorporated by reference herein). Ferritin, encapsulin, SOR, lumazine synthase, and pyruvate dehydrogenase are monomeric proteins that self-assemble into a globular protein complexes that in some cases consists of 24, 60, 24, 60, and 60 protein subunits, respectively. In some examples, ferritin, encapsulin, SOR, lumazine synthase, or pyruvate dehydrogenase monomers are linked to a recombinant HIV-1 Env ectodomain and self-assemble into a protein nanoparticle presenting the recombinant HIV-1 Env ectodomain on its surface, which can be administered to a subject to stimulate an immune response to the antigen.
[0183] Recombinant: A recombinant nucleic acid is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination can be accomplished, for example, the artificial manipulation of isolated segments of nucleic acids, for example using genetic engineering techniques. A recombinant protein is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. In several embodiments, a recombinant protein is encoded by a heterologous (for example, recombinant) nucleic acid that has been introduced into a host cell, such as a bacterial or eukaryotic cell. The nucleic acid can be introduced, for example, on an expression vector having signals capable of expressing the protein encoded by the introduced nucleic acid or the nucleic acid can be integrated into the host cell chromosome.
[0184] Root mean square deviation (RMSD): The square root of the arithmetic mean of the squares of the deviations from the mean. In several embodiments, RMSD is used as a way of expressing deviation or variation from the structural coordinates of a reference three dimensional structure. This number is typically calculated after optimal superposition of two structures, as the square root of the mean square distances between equivalent C. atoms.
[0185] Sample (or biological sample): A biological specimen containing genomic DNA, RNA (including mRNA), protein, or combinations thereof, obtained from a subject. Examples include, but are not limited to, peripheral blood, tissue, cells, urine, saliva, tissue biopsy, fine needle aspirate, surgical specimen, and autopsy material.
[0186] Sequence identity: The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs, orthologs, or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
[0187] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.
[0188] Once aligned, the number of matches is determined by counting the number of positions where an identical nucleotide or amino acid residue is present in both sequences. The percent sequence identity is determined by dividing the number of matches either by the length of the sequence set forth in the identified sequence, or by an articulated length (such as 100 consecutive nucleotides or amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100. For example, a peptide sequence that has 1166 matches when aligned with a test sequence having 1554 amino acids is 75.0 percent identical to the test sequence (1166 1554*100=75.0). The percent sequence identity value is rounded to the nearest tenth. For example, 75.11, 75.12, 75.13, and 75.14 are rounded down to 75.1, while 75.15, 75.16, 75.17, 75.18, and 75.19 are rounded up to 75.2. The length value will always be an integer.
[0189] Homologs and variants of a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
[0190] For sequence comparison of nucleic acid sequences, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters are used. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482, 1981, by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443, 1970, by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444, 1988, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4.sup.th ed, Cold Spring Harbor, N.Y., 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013). One example of a useful algorithm is PILEUP. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, J. Mol. Evol. 35:351-360, 1987. The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151-153, 1989. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., Nuc. Acids Res. 12:387-395, 1984.
[0191] Another example of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and the BLAST 2.0 algorithm, which are described in Altschul et al., J. Mol. Biol. 215:403-410, 1990 and Altschul et al., Nucleic Acids Res. 25:3389-3402, 1977. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (ncbi.nlm.nih.gov). The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11, alignments (B) of 50, expectation (E) of 10, M=5, N=−4, and a comparison of both strands. The BLASTP program (for amino acid sequences) uses as defaults a word length (W) of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915, 1989). An oligonucleotide is a linear polynucleotide sequence of up to about 100 nucleotide bases in length.
[0192] As used herein, reference to “at least 80% identity” (or similar language) refers to “at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% identity” to a specified reference sequence. As used herein, reference to “at least 90% identity” (or similar language) refers to “at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% identity” to a specified reference sequence.
[0193] Single chain HIV-1 Env ectodomain: A recombinant polypeptide including gp120 and the gp41 ectodomain in a single polypeptide chain. Single chain HWV-1 Env ectodomains can trimerize to form a trimeric HIV-1 Env ectodomain. A single chain HIV-1 Env ectodomain does not include the furin cleavage site separating gp120 and gp41; therefore, when produced in cells, the Env ectodomain is not cleaved into separate gp120 and gp41 ectodomain polypeptides. For example, the gp120 and gp41 proteins can be linked by a peptide linker, or directly linked. In some embodiments, a single chain HIV-1 Env ectodomain includes a circular permuted HIV-1 Env ectodomain. Single chain HIV-1 Env ectodomains are of particular interest for DNA or vector encoded immunogens, as it can be beneficial in these immunogen format to not need to rely on the presence of furin (or furin-like) protease in a host cell for maturation of separate gp120/gp41 polypeptides.
[0194] Signal Peptide: A short amino acid sequence (e.g., approximately 18-25 amino acids in length) that directs newly synthesized secretory or membrane proteins to and through membranes (for example, the endoplasmic reticulum membrane). Signal peptides are typically located at the N-terminus of a polypeptide and are removed by signal peptidases after the polypeptide has crossed the membrane. Signal peptide sequences typically contain three common structural features: an N-terminal polar basic region (n-region), a hydrophobic core, and a hydrophilic c-region). Exemplary signal peptide sequences are set forth as residues 1-30 of SEQ ID NO: 1 (HXB2 Env signal peptide) and SEQ ID NO: 2 (BG505 Env signal peptide).
[0195] Specifically bind: When referring to the formation of an antibody:antigen protein complex, or a protein:protein complex, refers to a binding reaction which determines the presence of a target protein, peptide, or polysaccharide (for example a glycoprotein), in the presence of a heterogeneous population of proteins and other biologics. Thus, under designated conditions, an particular antibody or protein binds preferentially to a particular target protein, peptide or polysaccharide (such as an antigen present on the surface of a pathogen, for example gp120) and does not bind in a significant amount to other proteins or polysaccharides present in the sample or subject. Specific binding can be determined by methods known in the art. A first protein or antibody specifically binds to a target protein when the interaction has a K.sub.D of less than 10.sup.−6 Molar, such as less than 10.sup.−7 Molar, less than 10.sup.−8 Molar, less than 10.sup.−9, or even less than 10.sup.−10 Molar. In some embodiments, an antibody does not specifically bind to a disclosed recombinant HIV-1 Env ectodomain trimer if the binding interaction of the antibody to trimer has a K.sub.D of more than 10.sup.−6 when assayed at stoichiometry of at least one antibody Fab per protomer in the trimer.
[0196] Subject: Living multi-cellular vertebrate organisms, a category that includes human and non-human mammals. In an example, a subject is a human. In a particular example, the subject is a newborn infant. In an additional example, a subject is selected that is in need of inhibiting of an HIV infection. For example, the subject is either uninfected and at risk of HIV infection or is infected in need of treatment.
[0197] T Cell: A white blood cell critical to the immune response. T cells include, but are not limited to, CD4.sup.+ T cells and CD8.sup.+ T cells. A CD4.sup.+ T lymphocyte is an immune cell that expresses CD4 on its surface. These cells, also known as helper T cells, help orchestrate the immune response, including antibody responses as well as killer T cell responses. Th1 and Th2 cells are functional subsets of helper T cells. Th1 cells secrete a set of cytokines, including interferon-gamma, and whose principal function is to stimulate phagocyte-mediated defense against infections, especially related to intracellular microbes. Th2 cells secrete a set of cytokines, including interleukin (IL)-4 and IL-5, and whose principal functions are to stimulate IgE and eosinophillmast cell-mediated immune reactions and to downregulate Th1 responses.
[0198] Therapeutically effective amount: The amount of agent, such as a disclosed immunogen or immunogenic composition that is sufficient to prevent, treat (including prophylaxis), reduce and/or ameliorate the symptoms and/or underlying causes of a disorder or disease, for example to prevent, inhibit, and/or treat HIV-1 infection. In some embodiments, a therapeutically effective amount is sufficient to reduce or eliminate a symptom of a disease, such as HIV-1 infection. For instance, this can be the amount necessary to inhibit or prevent viral replication or to measurably alter outward symptoms of the viral infection. In general, this amount will be sufficient to measurably inhibit virus replication or infectivity.
[0199] In one example, a desired response is to inhibit or reduce or prevent HWV infection. The HIV infected cells do not need to be completely eliminated or reduced or prevented for the composition to be effective. For example, administration of a therapeutically effective amount of the agent can decrease the number of HWV infected cells (or prevent the infection of cells) by a desired amount, for example by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or even at least 100% (elimination or prevention of detectable HWV infected cells), as compared to the number of HIV infected cells in the absence of the composition.
[0200] It is understood that to obtain a protective immune response against a pathogen can require multiple administrations of the immunogenic composition. Thus, a therapeutically effective amount encompasses a fractional dose that contributes in combination with previous or subsequent administrations to attaining a protective immune response. For example, a therapeutically effective amount of an agent can be administered in a single dose, or in several doses, for example daily, during a course of treatment (such as a prime-boost vaccination treatment). However, the therapeutically effective amount can depend on the subject being treated, the severity and type of the condition being treated, and the manner of administration. A unit dosage form of the agent can be packaged in a therapeutic amount, or in multiples of the therapeutic amount, for example, in a vial (e.g., with a pierceable lid) or syringe having sterile components.
[0201] Transmembrane domain: An amino acid sequence that inserts into a lipid bilayer, such as the lipid bilayer of a cell or virus or virus-like particle. A transmembrane domain can be used to anchor an antigen to a membrane. In some examples a transmembrane domain is a HIV-1 Env transmembrane domain. Exemplary HIV-1 Env transmembrane domains are familiar to the person of ordinary skill in the art, and provided herein, for example as SEQ ID NOs: 758, 760, and 762.
[0202] Treating or preventing a disease: Inhibiting the full development of a disease or condition, for example, in a subject who is at risk for a disease such as HIV-1 infection or acquired immunodeficiency syndrome (AIDS). “Treatment” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. The term “ameliorating,” with reference to a disease or pathological condition, refers to any observable beneficial effect of the treatment. The beneficial effect can be evidenced, for example, by a delayed onset of clinical symptoms of the disease in a susceptible subject, a reduction in severity of some or all clinical symptoms of the disease, a slower progression of the disease, a reduction in the viral load, an improvement in the overall health or well-being of the subject, or by other parameters well known in the art that are specific to the particular disease. A “prophylactic” treatment is a treatment administered to a subject who does not exhibit signs of a disease or exhibits only early signs for the purpose of decreasing the risk of developing pathology.
[0203] The term “reduces” is a relative term, such that an agent reduces a response or condition if the response or condition is quantitatively diminished following administration of the agent, or if it is diminished following administration of the agent, as compared to a reference agent. Similarly, the term “prevents” does not necessarily mean that an agent completely eliminates the response or condition, so long as at least one characteristic of the response or condition is eliminated. Thus, an immunogenic composition that reduces or prevents an infection or a response, can, but does not necessarily completely, eliminate such an infection or response, so long as the infection or response is measurably diminished, for example, by at least about 50%, such as by at least about 70%, or about 80%, or even by about 90% of (that is to 10% or less than) the infection or response in the absence of the agent, or in comparison to a reference agent.
[0204] Tyrosine Sulfation: Addition of a sulfate group to a tyrosine residue in a protein. In cells, tyrosine sulfation is a post translational modification where a sulfate group is added to a tyrosine residue of a protein molecule in the Golgi or endoplasmic reticulum. Tyrosine sulfation can be catalyzed by a tyrosyl-protein sulfotransferase (TPST), such as TPST1 or TPST2. The reaction catalyzed by TPST is a transfer of sulfate from the universal sulfate donor 3′-phosphoadenosine-5′-phosphosulfate (PAPS) to the side-chain hydroxyl group of a tyrosine residue. Tyrosine sulfation can also be accomplished in vitro, for example by incubating a peptide containing one or more tyrosine residues with a TBST enzyme (such as TBST1 or TBST2) under appropriate conditions. Methods of sulfating a tyrosine residue on a protein are known (see, e.g., U.S. Pub. No. 5,541,095, 2009/0042738, 2006/0009631, 2003/0170849, 2006/0115859, Liu et al., Mol. Biosyst., 7:38-47, 2011, and Choe and Farzan, Methods in Enzymology, 461: 147-170, 2009) each of which is incorporated by reference herein).
[0205] Under conditions sufficient for: A phrase that is used to describe any environment that permits a desired activity.
[0206] Vaccine: A pharmaceutical composition that elicits a prophylactic or therapeutic immune response in a subject. In some cases, the immune response is a protective immune response. Typically, a vaccine elicits an antigen-specific immune response to an antigen of a pathogen, for example a viral pathogen, or to a cellular constituent correlated with a pathological condition. A vaccine may include a polynucleotide (such as a nucleic acid encoding a disclosed antigen), a peptide or polypeptide (such as a disclosed antigen), a virus, a cell or one or more cellular constituents. In one specific, non-limiting example, a vaccine reduces the severity of the symptoms associated with HIV infection and/or decreases the viral load compared to a control. In another non-limiting example, a vaccine reduces HIV-1 infection compared to a control.
[0207] Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. Recombinant DNA vectors are vectors having recombinant DNA. A vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector can also include one or more selectable marker genes and other genetic elements known in the art. Viral vectors are recombinant nucleic acid vectors having at least some nucleic acid sequences derived from one or more viruses. A replication deficient viral vector is a vector that requires complementation of one or more regions of the viral genome required for replication due to a deficiency in at least one replication-essential gene function. For example, such that the viral vector does not replicate in typical host cells, especially those in a human patient that could be infected by the viral vector in the course of a therapeutic method.
[0208] Virus-like particle (VLP): A non-replicating, viral shell, derived from any of several viruses. VLPs are generally composed of one or more viral proteins, such as, but not limited to, those proteins referred to as capsid, coat, shell, surface and/or envelope proteins, or particle-forming polypeptides derived from these proteins. VLPs can form spontaneously upon recombinant expression of the protein in an appropriate expression system. Methods for producing particular VLPs are known in the art. The presence of VLPs following recombinant expression of viral proteins can be detected using conventional techniques known in the art, such as by electron microscopy, biophysical characterization, and the like. Further, VLPs can be isolated by known techniques, e.g., density gradient centrifugation and identified by characteristic density banding. See, for example, Baker et al. (1991) Biophys. J. 60:1445-1456; and Hagensee et al. (1994) J. Virol. 68:4503-4505; Vincente, J Invertebr Pathol., 2011; Schneider-Ohrum and Ross, Curr. Top. Microbiol. Immunol, 354: 53073, 2012).
[0209] VRC01: A neutralizing monoclonal antibody that specifically binds to the CD4 binding site on HIV-1 Env and can inhibit HIV-1 infection of target cells. The person of ordinary skill in the art is familiar with the VRC01 mAb and with methods of its use and production (see, for example, Wu et al., Science, 329(5993):856-861, 2010, and PCT publication WO2012/154312, each of which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the VRC01 mAb are known and have been deposited in GenBank as Nos. ADF47181.1 (VRC01 V.sub.H) and ADF47184.1 (VRC01 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014)
[0210] VRC26: A neutralizing monoclonal antibody that specifically binds to the V1/V2 domain of HIV-1 Env trimer in its prefusion mature closed conformation, and which can inhibit HIV-1 infection of target cells. As used herein, “VRC26” refers to the VRC26.09 antibody, which is one of several clonal variants isolated from donor CAP256. The person of ordinary skill in the art is familiar with the VRC26.09 mAb and with methods of its use and production (see, for example, Doria-Rose et al., Nature, 509, 55-62, 2014, which is incorporated by reference herein). The amino acid sequences of the heavy and light variable regions of the VRC26 mAb are known and have been deposited in GenBank as Nos. KJ134874 (VRC26.09 V.sub.H) and KJ134886 (VRC26.09 V.sub.L), each of which is incorporated by reference herein as present in the database on Jun. 20, 2014).
II. Description of Several Embodiments
A. Native HIV-1 Sequences
[0211] HIV can be classified into four groups: the “major” group M, the “outlier” group O, group N, and group P. Within group M, there are several genetically distinct clades (or subtypes) of HIV-1. The disclosed recombinant HIV-1 Env proteins can be derived from any type of HIV, such as groups M, N, O, or P, or clade, such as clade A, B, C, D, F, G, H, J, or K, and the like. HIV-1 Env proteins from the different HIV clades, as well as nucleic acid sequences encoding such proteins and methods for the manipulation and insertion of such nucleic acid sequences into vectors, are known (see, e.g., HIV Sequence Compendium, Division of AIDS, National Institute of Allergy and Infectious Diseases (2013); HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html); see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4.sup.th ed, Cold Spring Harbor, N.Y., 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013). Exemplary native HIV-1 Env protein sequences are available in the HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html), further, Table 5 provides sequences for Exemplary native HIV-1 Env proteins.
TABLE-US-00001 TABLE 5 Exemplary Native HIV-1 Env sequences Strain Clade Env sequence HXB2 B SEQ ID NO: 1 BG505 A SEQ ID NO: 2 CAP256.SU C SEQ ID NO: 51 BB201.B42 A SEQ ID NO: 81 KER2018.11 A SEQ ID NO: 107 CH070.1 BC SEQ ID NO: 174 ZM233.6 C SEQ ID NO: 745 Q23.17 A SEQ ID NO: 746 A244 AE SEQ ID NO: 747 WITO.33 B SEQ ID NO: 748 ZM53.12 C SEQ ID NO: 749 CNE58 C SEQ ID NO: 750 3301_V1_C24 AC SEQ ID NO: 751 T250-4 AE SEQ ID NO: 2114 JRFL B SEQ ID NO: 2115
[0212] In several embodiments, a disclosed immunogen can include a modification (e.g., cysteine substitutions that can form a disulfide bond to stabilize the HIV1 Env protein in a prefusion closed mature conformation) from a native HIV-1 Env protein sequence that has been determined to produce broadly neutralizing antibodies in a human subject, for example broadly neutralizing antibodies that specifically bind the V1V2 domain of HIV-1 Env. For example, in some embodiments, an HIV-1 Env (or fragment thereof) sequence from a CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strain of HIV-1 is mutated to include one or more of the disclosed amino acid substitutions to generate a recombinant HIV Env protein (or fragment thereof, such as a gp140 or gp145 protein) that is stabilized in a prefusion mature closed conformation. For example, in some non-limiting embodiments, cysteine substitutions at positions 201 and 433, and the SOSIP mutations, are made to a gp140 sequence from a CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strain of HIV-1 to generate the recombinant HIV-1 Env ectodomain that can form a trimer stabilized in the prefusion mature closed conformation.
[0213] In view of the conservation and breadth of knowledge of HIV-1 Env sequences, the person of ordinary skill in the art can easily identify corresponding HIV-1 Env amino acid positions between different HIV-1 Env strains and subtypes. The HXB2 numbering system has been developed to assist comparison between different HIV amino acid and nucleic acid sequences. The person of ordinary skill in the art is familiar with the HXB2 numbering system (see, e.g., Korber et al, Human Retroviruses and AIDS 1998: A Compilation and Analysis of Nucleic Acid and Amino Acid Sequences. Korber B, Kuiken C L, Foley B, Hahn B, McCutchan F, Mellors J W, and Sodroski J, Eds. Theoretical Biology and Biophysics Group, Los Alamos National Laboratory, Los Alamos, N. Mex., which is incorporated by reference herein in its entirety). The numbering of amino acid substitutions disclosed herein is made according to the HXB2 numbering system, unless context indicates otherwise.
B. Recombinant HIV-1 Env Ectodomains Stabilized in a Prefusion Mature Closed Conformation
[0214] Isolated immunogens are disclosed herein that include a recombinant HIV-1 Env ectodomain trimer or immunogenic fragment thereof that is modified from a native form (e.g., by introduction of one or more amino acid substitutions) to be stabilized in the prefusion mature closed conformation.
[0215] The HIV-1 Env ectodomain trimer can include a prefusion mature closed conformation wherein the V1V2 domain of each Env ectodomain protomer in the trimer comes together at the membrane distal apex. At the membrane proximal aspect, the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation includes distinct α6 and α7 helices; the α7 helix does not start until after residue 570. For example, in the prefusion mature closed conformation, the interprotomer distance between residues 200 and 313 can be less than 5 Angstroms.
[0216] In several embodiments, the immunogen includes a recombinant HIV-1 Env ectodomain trimer, which can include, for example, a trimeric complex of recombinant HIV-1 Env ectodomains that are stabilized in the prefusion mature closed conformation by one or more amino acid substitutions. The recombinant HIV-1 Env ectodomain trimer typically includes a protein complex of gp120-gp41 ectodomain protomers. The gp120-gp41 protomer can include separate gp120 and gp41 polypeptide chains, or can include gp120 and gp41 polypeptide chains that are linked (e.g., by a peptide linker) to form a single polypeptide chain (e.g., as described in the “single chain” section below). In several embodiments, the recombinant HIV-1 Env ectodomain trimer is membrane anchored and can include a trimeric complex of recombinant HIV-1 Env ectodomains that are linked to a transmembrane domain (e.g., a gp145 protein including a gp120 protein and a gp41 ectodomain and transmembrane domain).
[0217] The recombinant HIV-1 Env ectodomain includes a gp120 protein and a gp41 ectodomain. The gp120 protein typically does not include a signal peptide (for example, the gp120 protein typically does not include gp120 residues 1-30), as the signal peptide is proteolytically cleaved during cellular processing. Additionally, the gp41 ectodomain includes the extracellular portion of gp41 (e.g., positions 512-664). In embodiments including a soluble recombinant HIV-1 Env ectodomain, the gp41 ectodomain is not linked to a transmembrane domain or other membrane anchor. However, in embodiments including a membrane anchored recombinant HIV-1 Env ectodomain the gp41 ectodomain can be linked to a transmembrane domain (such as, but not limited to, an HIV-1 Env transmembrane domain).
[0218] In several embodiments, the recombinant HIV-1 Env ectodomain includes a gp120 polypeptide and a gp41 ectodomain, wherein
[0219] the n-terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 1-35;
[0220] the c-terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 503-511;
[0221] the n-terminal residue of the gp41 ectodomain is one of HIV-1 Env positions 512-522; and/or
[0222] the c-terminal residue of the gp41 ectodomain is one of HIV-1 Env positions 624-705.
[0223] In one non-limiting example, the recombinant HIV-1 Env ectodomain includes a gp120 polypeptide and a gp41 ectodomain, wherein the n-terminal residue of the gp120 polypeptide is HIV-1 Env position 31; the c-terminal residue of the gp120 polypeptide is HIV-1 Env position 511; the n-terminal residue of the gp41 polypeptide is HIV-1 Env position 512; and/or the c-terminal residue of the gp41 polypeptide is HIV-1 Env position 664. In some embodiments, the C-terminal residue of the recombinant HIV-1 Env ectodomain is position 683 (the entire ectodomain, terminating just before the transmembrane domain). In additional embodiments, the C-terminal residue of the recombinant HIV-1 Env ectodomain is position 707 (the entire ectodomain, terminating just after the transmembrane domain).
[0224] Native HIV-1 Env sequences include a furin cleavage site (e.g., REKR, SEQ ID NO: 572) between positions 508 and 512 (HXB2 numbering), that separates gp120 and gp41. Any of the disclosed recombinant HIV-1 Env ectodomains can further include an enhanced cleavage site between gp120 and gp41 proteins. The enhanced cleavage cite can include, for example, substitution of six arginine resides for the four residues of the native cleavage site (e.g., REKR (SEQ ID NO: 572) to RRRRRR (SEQ ID NO: 573). As used herein, reference to “R6” indicates that a HIV Env protein includes the RRRRRR (SEQ ID NO: 573) substitution for the native furin cleavage site. It will be understood that protease cleavage of the furin or enhanced cleavage site separating gp120 and gp41 can remove a few amino acids from either end of the cleavage site.
[0225] Stabilization of the recombinant HIV-1 Env ectodomain trimer or immunogenic fragment in the prefusion mature closed conformation prevents transition of the HIV-1 Env ectodomain to the CD-bound open conformation. Thus, the disclosed recombinant HIV-1 Env ectodomain trimers can be specifically bound by an antibody that is specific for the mature closed conformation of HIV-1 Env (e.g., VRC26, PGT151, PGT122, or PGT145), but are not specifically bound by an antibody specific for the CD4-bound open conformation, of HIV-1 Env (e.g., 17b mAb in the presence of sCD4). In one example, the recombinant HIV-1 Env ectodomain trimer is not specifically bound by an antibody specific for a CD4-induced epitope on the recombinant HIV-1 Env ectodomain trimer, such as the 17b antibody. Methods of determining if a recombinant HIV-1 Env ectodomain trimer includes a CD4-induced epitope are known in the art and disclosed herein (See Examples 1 and 2). For example, the antibody binding assay can be conducted in the presence of a molar excess of soluble CD4 as described in Sanders et al. (Plos Pathogens, 9, e1003618, 2013).
[0226] In several embodiments, the recombinant HIV-1 Env ectodomain trimers can be specifically bound by an antibody that specifically binds to the V1V2 domain on a HIV-1 Env trimer, but not an Env monomer. Exemplary antibodies with such antigen binding characteristics include the PGT141, PGT142, PGT143, PGT144, PGT145, and VRC26 antibodies. Additional examples include the PG9, PG16, and CH01-CH04 antibodies. Accordingly, in some embodiments the recombinant HIV-1 Env ectodomain trimer specifically binds to an antibody (such as a PGT141, PGT142, PGT143, PGT144, PGT145, and VRC26 antibody) that specifically binds to the V1V2 domain of a HIV-1 Env in its trimeric, but not monomeric, form with a dissociation constant of less than 10.sup.−6 Molar, such as less than 10.sup.−7 Molar, less than 10.sup.−8 Molar, or less than 10.sup.−9 Molar. Specific binding can be determined by methods known in the art. The determination of specific binding may readily be made by using or adapting routine procedures, such as ELISA, immunocompetition, surface plasmon resonance, or other immunosorbant assays (described in many standard texts, including Harlow and Lane, Using Antibodies: A Laboratory Manual, CSHL, New York, 1999).
[0227] The recombinant HIV-1 Env ectodomain trimers or immunogenic fragments are stabilized in the prefusion mature closed conformation by one or more amino acid substitutions. Thus, the recombinant HIV-1 Env ectodomain trimers or immunogenic fragments are not stabilized by non-specific crosslinking, for example glutaraldehyde crosslinking of membrane bound HIV-1 Env trimers.
[0228] In several embodiments, the recombinant HIV-1 Env ectodomain trimer is soluble in aqueous solution. In some embodiments, the recombinant HIV-1 Env ectodomain trimer dissolves to a concentration of at least 0.5 mg/ml (such as at least 1.0 mg/ml, 1.5 mg/ml, 2.0 mg/ml, 3.0 mg/ml, 4.0 mg/ml or at least 5.0 mg/ml) in phosphate buffered saline (pH 7.4) at room temperature (e.g., 20-22 degrees Celsius) and remains dissolved for at least for at least 12 hours (such as at least 24 hours, at least 48 hours, at least one week, at least two weeks, or more time). In one embodiment, the phosphate buffered saline includes NaCl (137 mM), KCl (2.7 mM), Na.sub.2HPO.sub.4 (10 mM), KH.sub.2PO.sub.4 (1.8 mM) at pH 7.4. In some embodiments, the phosphate buffered saline further includes CaCl.sub.2 (1 mM) and MgCl.sub.2 (0.5 mM). The person of skill in the art is familiar with methods of determining if a protein remains in solution over time. For example, the concentration of the protein dissolved in an aqueous solution can be tested over time using standard methods.
[0229] In some embodiments, the recombinant HIV-1 Env ectodomain trimer, when incubated in an aqueous solution, forms a population of recombinant HIV-1 Env ectodomain trimers stabilized in a prefusion mature closed conformation, wherein at least 70% (such as at least 80%, or at least 90% or at least 95% or at least 98%) of the recombinant HIV-1 Env ectodomain trimers in the population specifically bind to an antibody that specifically binds to the V1V2 domain of a trimer, but not monomeric HIV-1 Env (such as a PGT141, PGT142, PGT143, PGT144, PGT145, and VRC26 antibody) after
[0230] (a) incubation for one hour in 350 mM NaCl pH 7.0, at 50° C.;
[0231] (b) incubation for one hour in 350 mM NaCl pH 3.5, at 25° C.;
[0232] (c) incubation for one hour in 350 mM NaCl pH 10, at 25° C.;
[0233] (d) incubation for one hour in 10 mM osmolarity, pH 7.0, at 25° C.;
[0234] (e) incubation for one hour in 3000 mM osmolarity, pH 7.0, at 25° C.;
[0235] (g) a combination of two or more of (a)-(e); or
[0236] a combination of (a) and (b); (a) and (c); (a) and (d); (a) and (e); (b) and (d); (b) and (e); (c) and (d); (c) and (e); (a), (b), and (d); (a), (c), and (d); (a), (b), and (e); or (a), (c), and (e).
[0237] In some embodiments, the recombinant HIV-1 Env ectodomain trimer, when incubated in an aqueous solution, forms a population of recombinant HIV-1 Env ectodomain trimers stabilized in a prefusion mature closed conformation, wherein at least 70% (such as at least 80%, or at least 90% or at least 95% or at least 98%) of the recombinant HIV-1 Env ectodomain trimers in the population specifically bind to an antibody that specifically binds to the V1V2 domain of a trimer, but not monomeric HIV-1 Env (such as a PGT141, PGT142, PGT143, PGT144, PGT145, and VRC26 antibody) ten freeze-thaw cycles in 350 mM NaCl pH 7.0.
[0238] Several embodiments include a multimer of the recombinant HIV-1 Env ectodomain trimer or immunogenic fragment thereof, for example, a multimer including 2, 3, 4, 5, 6, 7, 8, 9, or 10, or more of the recombinant HIV-1 Env ectodomain trimers or immunogenic fragment thereof.
[0239] It is understood in the art that some variations can be made in the amino acid sequence of a protein without affecting the activity of the protein. Such variations include insertion of amino acid residues, deletions of amino acid residues, and substitutions of amino acid residues. These variations in sequence can be naturally occurring variations or they can be engineered through the use of genetic engineering technique known to those skilled in the art. Examples of such techniques are found in see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4.sup.th ed, Cold Spring Harbor, N.Y., 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013, both of which are incorporated herein by reference in their entirety.
[0240] The recombinant HIV-1 Env ectodomain can include modifications of the native HIV-1 sequence, such as amino acid substitutions, deletions or insertions, glycosylation and/or covalent linkage to unrelated proteins (e.g., a protein tag), as long as the recombinant HIV-1 Env ectodomain can form a trimer that is stabilized in the prefusion mature closed conformation. HIV-1 Env proteins from the different Clades, as well as nucleic acid sequences encoding such proteins and methods for the manipulation and insertion of such nucleic acid sequences into vectors, are disclosed herein and known in the art.
[0241] In some embodiments a recombinant HWV-1 Env ectodomain included in the disclosed trimers includes a gp120 polypeptide and a gp41 ectodomain including amino acid sequences at least 75% (for example at least 85%, 90%, 95%, 96%, 97%, 98% or 99%) sequence identity to a corresponding native HIV-1 gp120 or gp41 ectodomain polypeptide sequence (e.g., a native gp120 or gp41 ectodomain protein sequence from a clade A, B, C, D, F, G, H, J or K HIV-1 Env protein), such a native HIV-1 sequence available in the HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html) or a native HIV-1 Env polypeptide sequence set forth in Table 5, and include the one or more amino acid substitutions that stabilize the protein in the prefusion mature closed conformation.
[0242] In additional embodiments, a recombinant HIV-1 Env ectodomain included in the disclosed trimers includes a gp120 polypeptide and/or a gp41 ectodomain including one or more amino acid substitutions compared to a corresponding native HIV-1 Env sequence. For example, in some embodiments, the gp120 polypeptide, gp41 ectodomain, or both, can include up to 20 (such as up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19) amino acid substitutions compared to a native HIV-1 gp140 polypeptide sequence (e.g., a native gp120 or gp41 ectodomain protein sequence from a clade A, B, C, D, F, G, H, J or K HIV-1 Env protein), such a native HIV-1 sequence available in the HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html) or a native HIV-1 Env polypeptide sequence set forth in Table 5, and include the one or more amino acid substitutions that stabilize the protein in the prefusion mature closed conformation. The simplest modifications involve the substitution of one or more amino acids for amino acids having similar biochemical properties. These so-called conservative substitutions are likely to have minimal impact on the activity of the resultant protein.
[0243] The recombinant HIV-1 Env ectodomain included in the disclosed trimers can be derivatized or linked to another molecule (such as another peptide or protein). In general, the recombinant HIV-1 Env ectodomain is derivatized such that the binding to broadly neutralizing antibodies to a trimer of the recombinant HIV-1 ectodomain, such as PGT122, is not affected adversely by the derivatization or labeling. For example, the recombinant HIV-1 Env ectodomain can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as an antibody or protein or detection tag.
[0244] The stabilizing modifications provided herein are targeted modifications that stabilize the recombinant HIV-1 Env ectodomain trimer in the prefusion mature closed conformation. Guided by the structural features identified in the prefusion mature closed conformation, several modes of stabilizing the HIV-1 Env ectodomain trimer in this conformation are available, including (but not limited to) amino acid substitutions that introduce one or more non-natural disulfide bonds, fill cavities within the HIV-1 ectodomain trimer, prevent structural rearrangements, introduce N-linked glycosylation sites, and combinations thereof. Corresponding mutations are discussed in more detail below:
Reference to Table 13
[0245] Several stabilizing mutations are provided that can be included on a HIV-1 ectodomain to generate a trimeric HIV-1 ectodomain stabilized in the prefusion mature closed conformation. These mutations include, but are not limited to, those provided in Table 13. In several embodiments, the recombinant HIV-1 Env ectodomain trimer includes a HIV-1 Env ectodomain including the amino acid substitutions set forth in any one row of column 5, column 6, or columns 5 and 6, of Table 13. In additional embodiments, the recombinant HIV-1 Env ectodomain trimer includes a HIV-1 Env ectodomain including an amino acid sequence at least 80% identical to any one of the modified HIV-1 Env Ectodomain sequences listed in Table 13. In further embodiments, the recombinant HIV-1 Env ectodomain trimer includes a HIV-1 Env ectodomain including the amino acid sequence of any one of the modified HWV-1 Env Ectodomain sequences listed in of Table 13
[0246] Some of the sequences of recombinant HIV-1 ectodomains provided herein include the sequence of protease cleavage sites (such as thrombin sites), protein tags (such as a His tag, a Strep Tag II, a Avi tag, etc.), signal peptides, that the person of ordinary skill in the art will understand would not be included in an isolated immunogen including a recombinant HIV-1 Env ectodomain immunogen. The person of ordinary skill in the art will recognize such sequences, and when appropriate, understand that these tags or protease cleavage sites are not included in a disclosed recombinant HIV-1 Env protein.
[0247] In some embodiments, the recombinant HWV-1 Env ectodomain trimer includes the SOSIP, R6, 664 and 201C/433C modifications, an asparagine at position 332, and the substitutions listed in column 6 of any one of the rows for SEQ ID NO: 1245-1367 or 1580-1610 of Table 13. In some embodiments, the recombinant HWV-1 Env ectodomain trimer includes the SOSIP, R6, and 664 substitutions, an asparagine at position 332, and the substitutions listed in column 6 of any one of the rows for SEQ ID NO: 1368-1399 or 1580-1610 of Table 13. In several such embodiments, the recombinant HIV-1 Env ectodomain trimer can be based on a JRFL or a BG505 strain of HWV-1. In some embodiments, the gp120/gp41 ectodomains in the recombinant HIV-1 Env ectodomain trimer can comprise an amino acid sequence set forth as any one of SEQ ID NO: 1245-1399 or 1580-1610, or a sequence at least 90% identical thereto.
[0248] In some embodiments, the recombinant HWV-1 Env ectodomain trimer includes the SOSIP, R6, 664, and 201C/433C substitutions, an asparagine at position 332, and is based on a strain of HIV-1 as listed in column 4 of any one of the rows for SEQ ID NO: 26, 1057-1077, 1400-1579 of Table 13. In some embodiments, the gp120/gp41 ectodomains in the recombinant HIV-1 Env ectodomain trimer can comprise an amino acid sequence set forth as any one of SEQ ID NO: 26, 1057-1077, 1400-1579, or a sequence at least 90% identical thereto.
Non-Natural Disulfide Bonds
[0249] In several embodiments, the recombinant HIV-1 Env ectodomain trimer includes one or more non-natural disulfide bonds that stabilize the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation. A non-natural disulfide bond is one that does not occur in a native HIV-1 Env protein, and is introduced by protein engineering (e.g., by including one or more substituted cysteine residues that form the non-natural disulfide bond). For example, in some embodiments, any of the disclosed recombinant HIV-1 Env ectodomain trimers can be stabilized in a prefusion mature closed conformation by any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 non-natural disulfide bonds.
[0250] The cysteine residues that form the disulfide bond can be introduced into a native HIV-1 sequence by one or more amino acid substitutions. For example, in some embodiments, a single amino acid substitution introduces a cysteine that forms a disulfide bond with a cysteine residue present in the native HIV-1 sequence. Alternately, two cysteine residues can be introduced into a native HIV-1 Env ectodomain sequence to form the disulfide bond. The location of the cysteine (or cysteines) of the non-natural disulfide bond can be determined by the person of ordinary skill in the art using the disclosed structure of the HIV-1 ectodomain trimer in a prefusion mature closed conformation.
[0251] For example, the amino acid positions of the cysteines are typically within a sufficiently close distance for formation of a disulfide bond in the prefusion mature closed conformation of the HIV-1 Env protein trimer. Methods of using three-dimensional structure data to determine if two residues are within a sufficiently close distance to one another for disulfide bond formation are known (see, e.g., Peterson et al., Protein engineering, 12:535-548, 1999 and Dombkowski, Bioinformatics, 19:1852-1853, 3002 (disclosing DISULFIDE BY DESIGN™), each of which is incorporated by reference herein). Residues can be selected manually, based on the three dimensional structure of the HIV-1 Env trimer in a prefusion mature closed conformation provided herein, or a software, such as DISULFIDEBYDESIGN™, can be used. Without being bound by theory, ideal distances for formation of a disulfide bond are generally considered to be about ˜5.6 Å for Cα-Cα distance, ˜2.02 Å for Sγ-Sγ distance, and 3.5-4.25 Å for Cβ-Cβ distance (using the optimal rotomer). The person of ordinary skill in the art will appreciate that variations from these distances are included when selecting residues in a three dimensional structure that can be substituted for cysteines for introduction of a disulfide bond. For example, in some embodiments the selected residues have a Cα-Cα distance of less than 7.0 Å and/or a Cβ-Cβ distance of less than 4.7 Å. In some embodiments the selected residues have a Cα-Cα distance of from 2.0-8.0 Å and/or a Cβ-Cβ distance of from 2.0-5.5 Å. In several embodiments, the amino acid positions of the cysteines are within a sufficiently close distance for formation of a disulfide bond in the prefusion mature closed conformation, but not the CD4-bound open conformation of the HIV-1 Env protein.
[0252] For example, the person of ordinary skill in the art can determine the relative position of a particular amino acid between the prefusion mature closed and CD4-bound conformations of the HIV-1 Env ectodomain by comparing the prefusion mature closed structures disclosed in the Examples and the structural coordinates provided in Tables 1-4, with the previously identified CD4-bound conformation described in Example 1. Methods of determining relative position of a particular amino acid between the two protein structures (e.g., between the three dimensional structures prefusion mature closed- and CD4-bound-HIV-1 Env protein) are known. For example the person of ordinary skill in the art can use known superimposition methods to compare the two structures (e.g., methods using the LSQKAB program (Kabsch W. Acta. Cryst. A32 922-923 (1976)).
[0253] In several embodiments, the recombinant HIV-1 Env protein is stabilized in a prefusion mature closed conformation by a disulfide bond between a cysteine introduced at an amino acid position that changes conformation, and a cysteine introduced into an amino acid position that does not change conformation, between the prefusion mature closed conformation and the CD4-bound conformation of HIV-1 Env. For example, in some embodiments, the recombinant HIV-1 Env protein is stabilized in a prefusion mature closed conformation by a disulfide bond between a pair of cysteines, wherein the first cysteine is in an amino acid position of the HIV-1 Env protein that has a root mean square deviation of at least 5 (such as at least 6, at least 7, at least 8, at least 9 or at least 10) angstroms between the three-dimensional structure of the HIV-1 Env protein prefusion mature closed and CD4-bound conformations, and the second cysteine is in an amino acid position of the HIV-1 Env protein that has a root mean square deviation of less than 4 (such as less than 3, 2, or 1) angstroms between the three-dimensional structure of the HIV-1 Env protein prefusion mature closed and CD4-bound conformations.
[0254] In additional embodiments, the recombinant HIV-1 Env protein is stabilized in a prefusion mature closed conformation by a disulfide bond between cysteines that are introduced at amino acid positions that both change conformation between the prefusion mature closed and CD4-bound conformations. For example, in some embodiments, the recombinant HIV-1 Env protein includes amino acid substitutions introducing a pair of cysteines, wherein the first cysteine and the second cysteine are at amino acid positions of the HIV-1 Env protein that both have a root mean square deviation of at least 5 (such as at least 6, at least 7, at least 8, at least 9 or at least 10) angstroms between the three-dimensional structure of the prefusion mature closed and CD4-bound conformations of the HIV-1 Env protein.
[0255] In several embodiments the recombinant HIV-1 Env ectodomain included in the trimer includes one or more amino acid substitutions that stabilize the V1V2 domain “cap” and/or V3 domain in the prefusion mature closed conformation.
[0256] For example, in some embodiments, the recombinant HIV-1 Env ectodomain included in the trimer includes a non-natural disulfide bond between a first cysteine in a position of the β2 sheet and a second cysteine in a gp120 positions of the β21 sheet of the HIV-1 ectodomain in the mature closed conformation as disclosed herein (see
[0257] In some embodiments, the gp120 polypeptide in the recombinant HIV-1 Env ectodomain can include a non-natural disulfide bond between a pair of cysteine substitutions at one of gp120 positions 179-180 and one of gp120 positions 420-423; one of gp120 positions 190-210 and one of gp120 positions 425-437; one of gp120 positions 198-202 and one of gp120 positions 428-437; one of gp120 positions 179-180 and one of gp120 positions 421-423; or one of gp120 positions 195-201 to one of gp120 positions 423-433, wherein the non-natural disulfide bond stabilizes the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0258] In some embodiments, the gp120 polypeptide in the recombinant HIV-1 Env ectodomain can include a pair of cysteine substitutions that can form a disulfide bond to stabilize a trimer of the recombinant HIV-1 Env ectodomain in the mature closed conformation. Exemplary gp120 positions that can be mutated to cysteine, as well as exemplary mutations (in the context of the BG505 swrain), and an exemplary sequence including the indicated mutations are provided in Table 6.
TABLE-US-00002 TABLE 6 Non-natural gp120-gp120 disulfide bonds. Exemplary Env Exemplary positions Substitutions Intra- or (HXB2 (HXB2 Inter- Exemplary numbering) numbering) protomer? Comment SEQ ID NO 36 and 496 V36C/V496C Intra Stabilize gp120 N and C termini 649 36 and 498 V36C/P498C Intra Stabilize gp120 N and C termini 650 37 and 497 T37C/A497C Intra Stabilize gp120 N and C termini 651 38 and 496 V38C/V496C Intra Stabilize gp120 N and C termini 652 36 and 608 V36C/V608C Intra stabilize V1V2 mature closed conformation 82 55 and 77 A55C/T77C Intra Inhibit α0 formation 683 57 and 77 D57C/T77C Intra Inhibit α0 formation 98 58 and 77 A58C/T77C Intra Inhibit α0 formation 97 66 and 209 V66C/S209C Intra Inhibit α0 formation 101 68 and 208 V68C/V208C Intra Inhibit α0 formation 100 68 and 209 V68C/S209C Intra Inhibit α0 formation 99 120 and 315 V120C/Q315C Intra stabilize V1V2 mature closed conformation 70 122 and 125 L122C/L125C Intra stabilize V1V2 mature closed conformation 64 122 and 203 L122C/Q203C Intra stabilize V1V2 mature closed conformation 77, 785 122 and 317 L122C/F317C Intra Locking the V3 to gp120 to prevent exposure/opening 789 122 and 433 L122C/A433C Intra stabilize V1V2 mature closed conformation 162 124 and 164 P124C/T164C Inter stabilize V1V2 mature closed conformation 71 124 and 166 P124C/R166C Inter stabilize V1V2 mature closed conformation 20 128 and 165 T128C/L165C Inter stabilize V1V2 mature closed conformation 128 and 167 T128C/T167C Inter stabilize V1V2 mature closed conformation 72 163 and 170 T163C/Q170C Intra Stabilize V1V2 662 164 and 197 E164C/N197C Inter stabilize V1V2 mature closed conformation 19 164 and 308 S164C/H308C Intra Locking the V3 to V1V2 to prevent exposure/opening 794 172 and 307 E172C/I307C Intra Locking the V3 to V1V2 to prevent exposure/opening 791 174 and 318 S174C/A319C Intra stabilize V1V2 mature closed conformation 8 174 and 319 S174C/T319C Intra Locking the V3 to V1V2 to prevent exposure/opening 793 175 and 320 L175C/T320C Intra stabilize V1V2 mature closed conformation 9, 795 176 and 180 F176C/D180C Intra stabilize V1V2 mature closed conformation 57 180 and 421 D180C/K421C Intra stabilize V1V2 mature closed conformation 28 180 and 423 D180C/I423C Intra stabilize V1V2 mature closed conformation 21 195 and 423 N195C/I423C Intra stabilize V1V2 mature closed conformation 22 195 and 433 N195C/A433C Intra stabilize V1V2 mature closed conformation 23, 777 199 and 431 S199C/G431C Intra stabilize V1V2 mature closed conformation 25 199 and 433 S199C/A433C Intra stabilize V1V2 mature closed conformation 24, 778 200 and 313 A200C/P313C Inter stabilize V1V2 mature closed conformation 12 200 and 432 A200C/Q432C Intra Stabilize β21 to V1V2 653 201 and 433 I201C/A433C Intra stabilize V1V2 mature closed conformation 26, 773 202 and 434 T202C/M434C Intra Stabilize β21 to V1V2 654 202 and 433 T202C/A433C Intra Stabilize β21 to V1V2 656 203 and 317 Q203C/F317C Intra Locking the V3 to gp120 to prevent exposure/opening 788 204 and 434 A204C/M434C Intra stabilize V1V2 mature closed conformation 63 204 and 436 A204C/A436C Intra stabilize V1V2 mature closed conformation 58 206 and 318 P206C/Y318C Intra Locking the V3 to gp120 to prevent exposure/opening 792 212 and 252 P212C/K252C intra stabilize V1V2 mature closed conformation 60 225 and 245 I225C/V245C Intra Stabilizes V1V1 646 225 and 488 I225C/V488C Intra Stabilize V1V2 mature closed conformation 659 257 and 375 T257C/S375C Intra Stabilize V1V2 mature closed conformation 682 294 and 333 I294C/V333C Intra Stabilize core 664 298 and 329 R298C/A329C Intra stabilize V1V2 mature closed conformation 74 304 and 440 R304C/Q440C Intra Stabilize prefusion close conformation (through V3) 743, 779, 787 318 and 437 Y318C/P437C Intra stabilize V1V2 mature closed conformation 53, 790 320 and 438 T320C/P438C Intra stabilize V1V2 mature closed conformation 27, 796 364 and 372 S364C/T372C Intra stabilize V1V2 mature closed conformation 80 370 and 426 E370C/M426C Intra stabilize strand β20 to core gp120 170 380 and 426 G380C/M426C Intra stabilize strand β20 to core gp120 171 382 and 424 F382C/I424C Intra stabilize V1V2 mature closed conformation 73 425 and 433 N425C/A433C Intra stabilize V1V2 mature closed conformation (stabilize 69, 783 β20 to β21) 425 and 430 N425C/I430C Intra Stabilizes CD4 binding loop (stabilize β20 to β21) 52
[0259] In one non-limiting embodiment, the recombinant HIV-1 Env ectodomain can include cysteine substitutions at positions 201 and 433 (e.g., I201C and A433C substitutions). In additional embodiments, the recombinant HIV-1 Env ectodomain can include cysteine substitutions at positions 201 and 433 (e.g., I201C and A433C substitutions) and further include one or more additional mutations as disclosed herein. Exemplary additional mutations include those disclosed herein that stabilize the V1V2 domain, the V3 domain, or the CD4 binding site in the prefusion mature closed conformation, or a mutation that stabilizes gp41 in the prefusion mature closed conformation, such as a mutation that inhibits HR1 or HR2 formation or fusion peptide extension. Non-limiting examples of mutations that can be combined with the cysteine substitutions at positions 201 and 433 include the SOS, IP, SOSIP mutations, as well as any of the mutations listed in Table 9, below.
Cavity Filling Amino Acid Substitutions
[0260] Comparison of the structure of the mature closed conformation of the HIV-1 Env ectodomain trimer (e.g., in complex with PGT122 and 35O22 Fabs as disclosed herein) to the structure of the CD4-bound conformation of HIV-9 Env identifies several internal cavities or pockets in the mature closed conformation that collapse when the HIV-1 Env ectodomain trimer transitions from the prefusion closed conformation to the CD4-bound open conformation. These cavities include those listed in Table 8, below.
[0261] Accordingly, in several embodiments, the recombinant HIV-1 Env ectodomain trimer can be stabilized in the mature closed conformation by one or more amino acid substitutions that reduce the volume of an internal cavity that collapses in the CD4-bound conformation of the HIV-1 Env ectodomain trimer. For example, cavities can be filled by substituting amino acids with large side chains for those with small side chains. The cavities can be intra-protomer cavities, or inter-protomer cavities. The person of ordinary skill in the art can use methods provided herein to compare the structures of the mature closed and CD34-bound conformations of HIV-1 Env to identify suitable cavities, and amino acid substitutions for filling the identified cavities. Exemplary cavities, amino acid substitutions for reducing the volume of these cavities are provided in Table 8.
[0262] Exemplary HIV-1 Env positions for introducing cavity filling amino acid substitutions that stabilize the prefusion mature closed conformation of the HIV-1 Env ectodomain trimer are provided in Table 8, as are corresponding amino acid substitutions with reference to the BG505 strain, and an exemplary sequence including the indicated substitution.
TABLE-US-00003 TABLE 8 Exemplarity cavity-filling amino acid substitutions Exemplary substitution Exemplary Exemplary Position residues substitution(s) SEQ ID NO Cavity Location (CL) and stabilizing mechanism (SM) 39 W, M, I, F Y39F, Y39W 47-48 CL: gp120/gp41 interface SM: fill cavity and add hydrophobic interactions at the gp120- gp41 interactive surface 50 F, Y, L, I, M, V, W T50W 181 CL: gp120/gp41 interface SM: stabilize gp120/gp41 interface 53 W F53W 197 CL: gp120-gp41 interface, near N-term of β-2 SM: Fill cavity between gp120 and gp41 to stabilize gp41 disordered region and gp120/gp41 interaction 55 F A55F 678 CL: gp120 C1 with F substitution to stabilize gp120 N terminus 61 W Y61W 195 CL: Middle of α1 SM: Fill cavity between gp120 and gp41; prevent CD4-induced α0 formation/α1 disruption 68 F, W, Y, L, I, M V68L 196 CL: Loop between α-1 and β0 SM: Fill cavities that are otherwise filled by CD4 induced α0 formation 70 F, Y, W A70F, A70Y 143, 144 CL: Close to A70, α0/α7 SM: Extension of hydrophobic/aromatic patch-gp41/gp120 stabilization 75 W, F, M V75W, V75F, 90, 91, CL: gp120/gp41 interface V75M 92 SM: stabilize gp120/gp41 interface 77 F T77F 676 CL: gp120 C1 with F substitution to stabilize gp120 N terminus 110 F, Y, L, I, M, V, W S110W 178 CL: trimer axis/gp41 interface boundary SM: stabilize prefusion axis interactions/gp41 interface/prevent helix movement 111 F, Y, W L111Y, L111F, 145, 146, CL: gp120 C1, Close to A70, α0/α7 L111W 697 SM: Extension of hydrophobic/aromatic patch-gp41/gp120 stabilization (α7/α0, cavity close to A70), Substitute W to stabilize gp120 terminus 114 F, Y, L, I, M, V, W Q114W 179 CL: trimer axis/gp41 interface boundary SM: stabilize prefusion axis interactions/gp41 interface/prevent helix movement 115 F, W, Y, L, I, M, V S115W 139 CL: C-term of α1 SM: Reduces cavity at top of α1, which shifts conformation in CD4-bound state 117 F, Y, L, I, H, R, K117E, K117W 175, 176 CL: trimer axis E, D, M, V, W SM: stabilize prefusion axis interactions 118 F, W, Y, L, I, M, V P118W 140 CL: SM: Reduces cavity near top (c-term) of α1, which shifts conformation in CD4-bound state 120 F, Y, L, I, H, R, E, V120W 128 CL: Under V1V2 cap at N-term of β2 D, M, V, W SM: stabilize V1V2 mature closed conformation/prevent bridging sheet formation, β2 extends in CD4-bound state, this stabilizes small hydrophobic pocket in ground state 121 F, Y, L, I, H, R, E, K121E 177 CL: trimer axis D, M, V SM: stabilize prefusion axis interactions 123 F, Y, L, M, V, W T123W 172 CL: trimer axis SM: stabilize prefusion axis interactions 125 F, W, Y, L, I, M, V L125W, L125F 131, 685 CL: Cavity near N-term of V1V2 domain and V3 near residue 127 and 126-196 disulfide of V1V2 SM: Removal of ground state destabilization/flexibility cavity filling, stabilize V1/V2/V3 136 W N136W 686 CL: gp120 V1. Substitute W to stabilize V1/V2/V3 139 F, M, I, Y, T; T139W 45 CL: interface of V1V2 and V3 loops SM: Stabilize interactions between V1V2 and V3 loops in the mature closed state 151 F, W, Y, L, I, M, V R151E, 132 CL: near V1 loop at position 153 SM: Adding hydrophobic patch at V1 loop to V3 loop 153 F, W E153F, E153W 707, 708 CL: V1V2-V3/gp120core interface, 154 F, W L154F, L154W 709, 710 CL: gp120 V1/V2. Substitute F, Y or W, stabilize V1/V2/V3 159 W, Y F159W, F159Y 133, 30 CL: Primary hydrophobic pocket between V1V2 and V3 near residue 159 SM: Stabilize hydrophobic core of V1V2-V3 interactions 161 F, W, Y, L, I M161W 135 CL: Hydrophobic patch at Cterm of V1V2 strand B SM: Stabilize V1V2 strand B to V3 near trimeric interface 164 F, W E164F, E164W 711, 712 CL: inter-protomer, Substitute F or W, 173 Y173W 703 CL: gp120 V1/V2/V3. 173: Substitute W or F 175 F, W L175F, L175W 705, 706 CL: V1V2-V3 interface, Substitute F or W, 176 W F176W 733 CL: gp120 V1/V2. Substitute Y or W, stabilize V1/V2/V3 177 W Y177W 198 CL: C-term of beta C SM: Fills cavity between V3 and gp120 core to stabilize closed V1V2 cap 179 F, Y, M, I, W L179W 46 CL: V1V2 loop gp120 core interface SM: Stabilize V1V2 loop-gp120 core interaction in mature closed state 180 180: L, V, I, M D180L 123 CL: V1V2 interaction near residue 180 with V3 and base of β21 SM: stabilize v1v2 to v3 along with destabilizing β21 from adopting CD4-bound-conformation 191 W, F Y191W, Y191F 4, 5 CL: SM: Stabilize V1V2 cap 198 F T198F 713 CL: V1V2-gp120 core interface 201 F, Y, L, M, V I201W 173 CL: parallel β # SM: prevent bridging sheet formation 202 F, W T202F, T202W 714 CL: V1V2-gp120 core interface, Substitute F or W, 203 F, W, Y, L, I, M, V Q203V 129 CL: Under V1V2 cap at N-term of β2 SM: stabilize prefusion cap/prevent bridging sheet formation, β2 extends in CD4-bound state, this stabilizes small hydrophobic pocket in ground state 204 F, W A204F, A204W 716, 724 CL: V1V2-gp120 core interface, Substitute F or W, 208 W, Y, F, M V208W, 93-96 CL: between α1 and strand leading to bridging sheet in the V208Y, V208F, CD4-bound conformation V208 SM: Destabilize CD4-bound conformation 209 R S209R, 196 CL: Loop between β3 and β4 SM: Fill cavity otherwise filled by CD4 induced α0 formation 220 F, Y, L, I, M, V, W P220W 180 CL: SM: stabilize gp41 interface 223 Y, W F223W 31, 780 CL: near β5 SM: stabilize gp120/gp41 interface 245 F V245F 700 CL: gp120 C2. Substitute F to stabilize gp120 V1/V2/V3, interprotomer 246 F, W, Y, L, I, M, V Q246W 197 CL: gp120-gp41 interface, near middle of β8 SM: Fill a cavity between gp120 and gp41 to stabilize gp41 disordered region and gp120/gp41 interaction 254 F V254F 670 CL: gp120 C2 with F substitution to stabilize gp120 260 F L260F 671 CL: gp120 C2 with F substitution to stabilize gp120 261 F L261F 672 CL: gp120 C2 with F substitution to stabilize gp120, interprotomer 263 W G263W 673 CL: gp120 C2 with W substitution to stabilize gp120, interprotomer 302 F, W N302F, N302W 725, 726 CL: V3-V1V2/gp120 core interface 309 F, W, Y, L, M I309W 136 CL: Hydrophobic patch at C-term of V1V2 strand B SM: Stabilize V1V2 strand B to V3 near trimeric interface 317 W, Y F317W 134 CL: Primary hydrophobic pocket between V1V2 and V3 near position 159 SM: Stabilize hydrophobic core of V1V2-V3 interactions 323 W I323W 690 CL: gp120 V3. Substitute F to stabilize V1/V2/V3 326 M, W, F, Y, R I326R, I326F 45, 691 CL: at the interface of V1V2 and V3 loops SM: Stabilize interactions between V1V2 and V3 loops in the mature closed state 328 328: F, W, Y, L, I, Q328W 132 CL: near V3 loop M, V SM: Adding hydrophobic patch at V1 loop to V3 loop 332 F, Y, W I332F 198 CL: C-term of beta V3B, SM: Fills cavity between V3 and gp120 core to stabilize closed V1V2 cap 380 F G380F 667 CL: gp120 C4 with F substitution to stabilize gp120 421 421: F, W, Y K421W, 123 CL: V1V2 interaction near residue 180 with V3 and base of β21 SM: This will stabilize v1v2 to v3 along with destabilizing β21 from adopting CD4-bound-conformation 423 F, Y, L, M, V, W I423F, I423W 173, 717, CL: gp120core-V1V2 interface, parallel β # 718 SM: prevent bridging sheet formation 426 G, V, I, L, F, Y, W, M426W, 54, 75, CL: CD4 binding site R, K, P M426A, 78, 83 SM: Constrains CD4 binding loop, Blocks transition to CD4 M426F, bound conformation M426P 429 F, Y, L, I, M, V, W R429W 182 CL: under parallel β# SM: prevent bridging sheet formation 431 Any G431P 68, 782 CL: CD4 binding site SM: sterically interferes with CD4 binding specifically without affecting antibody binding 432 F, W Q432F, Q432W 719, 720 CL: stabilize unliganded conformation of bridging sheet region 436 M, F, W A436M, A436F, 721, 722, CL: stabilize unliganded conformation of bridging sheet region A436W 723 437 F P437F 668 CL: gp120 C terminus with F substitution and stabilize gp120 C terminus 473 Any G473A, G473S, 65-67, CL: CD4 binding site G473Y 781 SM: sterically interferes with CD4 binding specifically without affecting antibody binding 478 F N478F 660 CL: gp120 C terminus substituted with F and stabilize gp120 C terminus 522 Y F522Y 34 CL: near N-tern of fusion peptide SM: Fusion Peptide Cavity Fill 523 F L523F 33 CL: near N-tern of fusion peptide SM: Fusion Peptide Cavity Fill 530 W M530W 29 CL: gp41-tryptophan clasp SM: stabilize interactions within gp41-tryptophan clasp 534 I, W, F, A, M, V S534V, S534A 47-48 CL: gp120/gp41 interface SM: fill cavity and add hydrophobic interactions at the gp120- gp41 interactive surface 544 F, Y, W L544Y 32 CL: gp41 tip of α6 SM: stabilize gp120/gp41 interface
[0263] The recombinant HIV-1 Env ectodomain included in the trimer can include any one of the cavity filling substitution at one of the HIV-1 Env positions listed in Table 8. The recombinant HIV-1 Env ectodomain can also include a combination of two or more (e.g., 3, 4, 5, 6, 7, or 8) of the cavity filling substitutions provided in Table 8 to stabilize the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation.
Additional Substitutions
[0264] In some embodiments, the recombinant HIV-1 Env ectodomain can include one or more amino acid substitutions that destabilize the C14-bound open conformation of the H6-Env ectodomain timer (and thereby prevent transition of the trimer from the prefusion closed conformation to the CD4-bound open conformation).
[0265] For example, in some embodiments the recombinant HIV-1 Env ectodomain can include an amino acid substitution that introduces a proline residue in the β21 sheet (e.g., positions 430-435), such as a proline substitution at position 432 or 433.
[0266] Exemplary HIV-1 Env positions for introducing an amino acid substitutions that destabilizes the CD4-bound open conformation of the HIV-1 Env ectodomain timer are provided in Table 7, as are corresponding amino acid substitutions with reference to the BG505 strain, and an exemplary sequence including the indicated substitution.
TABLE-US-00004 TABLE 7 Destabilization of CD4-induced- and stabilization of prefusion mature conformations Exem- Substi- Exem- plary tution plary substi- compared SEQ tution to BG505 ID NO 112I W112I Stabilize V1V2 116 112M W112M Stabilize V1V2 117 120T V120T Stabilize V1V2 149 122K L122K Stabilize V1V2 150 120P V120P Stabilize V1V2 148 202P T202P Stabilize V1V2 147 427I W427I Stabilize prefusion closed conformation 118 427M W427M Stabilize prefusion closed conformation 119 429N R429N Stabilize prefusion closed conformation 120 429L R429L Stabilize prefusion closed conformation 116 432P Q432P Destabilizes CD4-bound conformation 7, 775 432E Q432E Destabilizes CD4-bound conformation 42 432D Q432D Destabilizes CD4-bound conformation 43 433P A433P Destabilizes CD4-bound conformation 6, 774 434P 434P Destabilizes CD4-bound conformation 44 435P 435P Destabilizes CD4-bound conformation 45 436P 436P Destabilizes CD4-bound conformation 46 437A P437A Destabilizes CD4-bound conformation 47 438A P438A Destabilizes CD4-bound conformation 48 474A D474A Stabilize prefusion closed conformation 118 476A R476A Stabilize prefusion closed conformation 124
[0267] In several embodiments, the recombinant HIV-1 Env ectodomain can include one or more (e.g., 2, 3, 4, 5, 6, 7, or 8) of the amino acid substitutions as listed in Table 7 to destabilize the CD4-induced conformation of the HIV-1 ectodomain trimer (and thereby stabilize the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation). Additionally, any of the substitutions shown in Table 7 can be combined with the other stabilizing substitutions described herein to stabilize the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation.
[0268] In some embodiments, the recombinant HIV-1 Env ectodomain includes one or more amino acid substitutions that destabilize the formation of the α0 helix. As described in Example 1, the α0 helix (˜ residues 64-74) is present in the CD4-bound open conformation, but not the prefusion mature closed conformation, of trimeric HIV-1 Env. In some embodiments, the recombinant HIV-1 Env ectodomain includes a proline amino acid substitution at position 66 or 67, or both positions 66 and 67 (such as a H66P and/or N67P substitution) that disrupts formation of the α0 helix in the recombinant HIV-1 Env ectodomain trimer. Exemplary sequences including these mutations are set forth as SEQ ID NOs: 102-104.
[0269] In some embodiments, the recombinant HIV-1 Env ectodomain includes a non-natural disulfide bond between a pair of cysteine substitutions at one of positions 57-58 and position 77, or between position 66 or 68 and one of positions 207-209, wherein the non-natural disulfide bond destabilizes or disrupts formation of the α0 helix in the recombinant HIV-1 ectodomain. In some embodiments, the recombinant HIV-1 Env ectodomain can include a non-natural disulfide bond between a pair of cysteine substitutions at one or more of the following sets positions: 55 and 77, 57 and 77, 58 and 77, 66 and 207, 66 and 208, 66 and 209, 68 and 209, and 68 and 208, wherein the non-natural disulfide bond disrupts formation of the α0 helix in the recombinant HIV-1 ectodomain. In some embodiments, the recombinant HIV-1 Env ectodomain can include one or more of the following sets of amino acid substitutions: A55C and T77C, D57C and T77C, A58C and T77C, V66C and K207C, V66C and S209C, V68C and S209C, and V68C and V208C. Exemplary sequences including these mutations are set forth as SEQ ID NOs: 87, 98-101, and 683.
[0270] In more embodiments, the recombinant HIV-1 Env ectodomain can include a proline amino acid substitution at position 66 or 67, or both positions 66 and 67 (such as a H66P and/or N66P substitutions), and further include a pair of cysteine substitutions at positions 57 and 77, 58 and 77, 68 and 208, or 68 and 209, the combination of which disrupts formation of the α0 helix in the recombinant HIV-1 ectodomain. For example, in some embodiments, the recombinant HIV-1 Env ectodomain can include one of the following sets of amino acid substitutions: D57C/T77C, H66P, N67P; A58C/T77C, H66P, N67P; V68C/S209C, H66P, N67P; V68C/V208C, H66P, N67P; or V68C/S209C, H66P, N67P. Exemplary HIV-1 Env ectodomain sequences including these mutations are set forth as SEQ ID NOs: 105-108 and 109.
Stabilizing Gp41
[0271] In additional embodiments, the recombinant HIV-1 Env ectodomain can include one or more disulfide bonds that stabilize gp41 in the mature closed prefusion conformation. Exemplary mutations include those that can form a non-natural gp120-gp41 disulfide bond or a non-natural gp41-gp41 disulfide bond. Exemplary HIV-1 Env positions that can be mutated to cysteine to form such stabilizing disulfide bonds, as well as exemplary mutations (in the context of the BG505 strain), and sequences including the indicated mutations are provided in Table 9, below.
TABLE-US-00005 TABLE 9 Non-natural gp120-gp41 and gp41 disulfide bonds Intra- or Exemplary Env Exemplary Inter- Exemplary positions Substitutions protomer? Comment SEQ ID NO gp120-gp41 disulfide bonds 41 and 540 G41C/Q540C Intra Stabilize α6/Prevent HR1 formation 14 41 and 541 G41C/A541C Intra Stabilize α6/Prevent HR1 formation 199, 200, 201 43 and 526 P43C/A526C Intra Stabilize α6/Prevent HR1 formation 15 51 and 574 T51C/K574C Intra Stabilize α7/Prevent HR1 formation 151 53 and 574 F53C/K574C Intra Stabilize α7/Prevent HR1 formation 152 51 and 578 T51C/A578C Intra Stabilize α7/Prevent HR1 formation 153 43and 540 P43C/Q540C Intra Stabilize α6/Prevent HR1 formation 18 88 and 527 N88C/G527C Intra Stabilize fusion peptide 17 107 and 574 D107C/K574C Intra Stabilize α7/Prevent HR1 formation 166 220 and 578 P220C/A578C Intra Stabilize α7/Prevent HR1 formation 10 221 and 582 A221C/A582C Intra Stabilize α7/Prevent HR1 formation 11, 16 428 and 560 Q428C/E560C Inter Stabilize α6/α7 linker/Prevent HR1 163 formation 428 and 561 Q428C/A561C Inter Stabilize α6/α7 linker/Prevent HR1 164 formation 428 and 562 Q428C/Q562C Inter Stabilize α6/α7 linker/Prevent HR1 165 formation 498 and 610 498C/W610C Intra Prevent HR1/2 formation 13 36 and 606 V36C/T606C Intra Prevent HR1 formation 647 37 and 606 T37C/T606C Intra] Prevent HR1 formation 648 41 and 537 G41C/L537C Intra Prevent HR1 formation 734 41 and 541 G41C/A541C Intra Prevent HR1 formation 736 43 and 526 P43C/A526C Intra Prevent HR1 formation 737 73 and 572 A73C/G572C Intra Prevent HR1 formation 738 84 and 521 I84C/G521C Intra Prevent HR1 formation 739 89 and 527 V89C/G527C Intra Prevent HR1 formation 740 73 and 572 A73C/G572C Intra Prevent HR1 formation 741 84 and 521 I84C/G521C Intra Prevent HR1 formation 742 89 and 527 V89C/G527C Intra Prevent HR1 formation 743 gp41 disulfide bonds 550 and 575 Q550C/Q579C Intra Prevent HR1 formation 167, 169 551 and 575 Q551C/Q575C Intra Prevent HR1 formation 168
[0272] Any one or more of the pairs of cysteine substitutions listed in Table 9 can be included on a recombinant HIV-1 Env ectodomain to generate a recombinant HIV-1 Env ectodomain trimer stabilized in the prefusion mature closed conformation. Further, the recombinant HIV-1 Env ectodomain can include any one or more of the pairs of cysteine substitutions listed in Table 9 in combination with any of the other stabilizing mutations disclosed herein to generate a recombinant HIV-1 Env ectodomain that can form a trimer stabilized in the prefusion mature closed conformation.
[0273] Additionally, the recombinant HIV-1 Env ectodomain can include the SOS (501C and 605C), IP (559P), and/or SOSIP (501C, 605C, 559P) substitutions in combination with any of the stabilizing mutations disclosed herein to generate a recombinant HIV-1 Env ectodomain that can form a trimer stabilized in the prefusion mature closed conformation.
Exemplary Combinations
[0274] In several embodiments, any two or more of the HIV-1 Env mutations disclosed herein can combined to generate the recombinant HIV-1 Env ectodomain that can form a trimer stabilized in the prefusion mature closed conformation.
[0275] For example, in some embodiments, the recombinant HIV-1 Env ectodomain can include a non-natural disulfide bond that stabilizes the protein in a PGT122-bound conformation (e.g., with a V1V2 domain in a mature closed conformation; such as a non-natural disulfide bond between one or more of positions 201 and 433) and further include one or more amino acid substitutions that stabilize gp41 in a mature closed conformation (e.g., with distinct α6 and α7 helices; such as substitutions listed in Table 9, such as 41C/540C substitutions or a SOS, IP, SOSIP substitution). In further embodiments, the recombinant HIV-1 Env ectodomain can include a non-natural disulfide bond that stabilizes the protein in a PGT122-bound conformation (e.g., with a V1V2 domain in a mature closed conformation; such as a non-natural disulfide bond between one or more of positions 201 and 433) and includes one or more mutations that destabilize the CD4 binding domain, such as a substitution at position 473, and/or includes a cavity filling substitution, and further includes one or more amino acid substitutions that stabilize gp41 in a mature closed conformation (e.g., with distinct α6 and α7 helices; such as substitutions listed in Table 9, such as 41C/540C substitutions or a SOS, IP, SOSIP substitution).
[0276] In some embodiments, the recombinant HIV-1 Env ectodomain includes a pair of cysteine substitutions at one of positions 198-202 and one of positions 428-437 that form a non-natural disulfide bond, and further includes one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. In a non-limiting embodiment, the recombinant HIV-1 Env ectodomain includes 201C, 433C, 501C, 605C, and 559P substitutions (such as I201C, A433C, A501C, T605C, and I559P substitutions).
[0277] In some embodiments, the recombinant HIV-1 Env ectodomain includes a pair of cysteine substitutions at one of positions 174 and 319, 195 and 433, 199 and 433, 199 and 431, 201 and 433, 221 and 582, or 304 and 440, that form a non-natural disulfide bond, and further includes one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. In a non-limiting embodiment, the recombinant HIV-1 Env ectodomain includes 201C, 433C, 501C, 605C, and 559P substitutions (such as I201C, A433C, A501C, T605C, and I559P substitutions). In some such embodiments, the recombinant HIV-1 Env ectodomain can further includes a tryptophan substitution at position 223, or a proline substitution at position 432 or 433.
[0278] In more embodiments, the recombinant HIV-1 Env ectodomain includes two pairs of cysteine substitutions at one of positions (i) 195 and 433, and 304 and 440; (ii) 195 and 433, and 174 and 319; (iii) 199 and 433, and 304 and 440; (iv) 199 and 433, and 174 and 319; (v) 201 and 433, and 304 and 440; (vi) 201 and 433, and 174 and 319; that form two non-natural disulfide bonds, and can further includes one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. In a non-limiting embodiment, the recombinant HIV-1 Env ectodomain includes 201C, 433C, 501C, 605C, and 559P substitutions (such as I201C, A433C, A501C, T605C, and I559P substitutions). In some such embodiments, the recombinant HIV-1 Env ectodomain can further includes a tryptophan substitution at position 223, or a proline substitution at position 432 or 433. Exemplary immunogens include those with a BG505gp140.6R.SOSIP.664 background sequence further including 1201C/A433C and R304C/Q440C substitutions; S199C/A433C and R304C/Q440C substitutions; I201C/A433C and V120C/Q315C substitutions; G473P and V120C/Q315C substitutions; G473Y and V120C/Q315C substitutions; G473P and R304C/Q440C substitutions; G473Y and R304C/Q440C substitutions; N425C/A433C and V120C/Q315C substitutions; and I201C/A433C and V120C/Q315C substitutions.
[0279] In additional embodiments, the recombinant HIV-1 Env ectodomain can include a combination of two or more non-natural disulfide bonds between pairs of cysteine substitutions as described above that (e.g., as listed in Table 6). Non-limiting examples of combinations of two or more non-natural disulfide bonds between pairs of cysteine substitutions are provided in Table 10. In some embodiments, the recombinant HIV-1 Env ectodomain can include one or more pairs of cysteine substitutions as described above that form a non-natural disulfide bond (e.g., as listed in Table 6), or a combination of pairs of cysteine substitutions as listed in Table 10, and further includes one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations.
TABLE-US-00006 TABLE 10 Exemplary combinations of cysteine substitutions to generate non-natural disulfide bonds Exemplary Positions Exemplary substitutions SEQ ID NO 200C/313C, 51C/574C A200C/P313C, T51C/K574C 151 200C/313C, 53C/574C A200C/P313C, F53C/K574C 152 200C/313C, 51C/578C A200C/P313C, T51C/A578C 153 128C/165C, 200C/313C, T128C/L165C, A200C/P313C, 154 51C/574C T51C/K574C 128C/165C, 200C/313C, T128C/L165C, A200C/P313C, 155 53C/574C F53C/K574C 128C/165C, 200C/313C, T128C/L165C, A200C/P313C, 156 51C/578C T51C/A578C
[0280] In some embodiments, the recombinant HIV-1 Env ectodomain can include a non-natural disulfide bond that stabilizes the protein in a PGT122-bound conformation (e.g., with a V1V2 domain in a mature closed conformation; such as a non-natural disulfide bond between one or more of positions 128 and 167, 174 and 318, 175 and 319, 204 and 434, 204 and 436, or 318 and 437) and further includes one or more mutations that destabilize the CD4 binding domain, such as a substitution at position 473 (such as a G473A substitution). For example, in some embodiments, the recombinant HIV-1 Env ectodomain can include one of the following sets of amino acid substitutions: T128C/T167C and G473A, S174C/A318C and G473A, L175C/A319C and G473A, A204C/M434C and G473A, A204C/A436C and G473A, or Y318C/P437C and G473A. In additional such embodiments, the recombinant HIV-1 Env ectodomain can further include one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. Exemplary gp140 sequences including such substitutions are set forth as SEQ ID NOs: 53, 55, 56, 58, 59, 72.
[0281] In additional embodiments, the recombinant HIV-1 Env ectodomain can include a cavity filling substitution as described above, and further includes an amino acid substitution that destabilizes the CD4-induced conformation of HIV-1 Env, such as a A433P substitution. In additional such embodiments, the recombinant HIV-1 Env ectodomain can further include one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. In a non-limiting embodiment, the recombinant HIV-1 Env ectodomain includes 433P, 501C, 605C, and 559P substitutions (such as A433P, A501C, T605C, and I559P substitutions).
[0282] In additional embodiments, the recombinant HIV-1 Env ectodomain includes a combination of two or more of the stabilizing substitutions described herein. For example, the recombinant HIV-1 Env ectodomain can include 429L and 427M (e.g., R429L and W427M substitutions), 437A and 438A (e.g., P437A and P438A substitutions), or 474A and 476A (e.g., D474A and R476A substitutions). In additional such embodiments, the recombinant HIV-1 Env ectodomain can further include one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. Exemplary sequences including these substitutions include those provided as SEQ ID NOs: 49, 115, and 122. Additionally, any of the above cavity filling substitutions can be combined with the other stabilizing substitutions described herein to stabilize the HIV-1 Env ectodomain trimer in the prefusion mature closed conformation. For example, in some embodiments, the recombinant HIV-1 Env ectodomain includes a cavity filling substitution as described above, such as at one or more of gp120 positions 50, 110, 114, 117, 117, 120, 121, 121, 123, 159, 220, 426, 220, 429, and further includes substitutions to introduce a non-natural disulfide bond, such as I201C/A433C substitutions. In some non-limiting embodiments, the recombinant HIV-1 Env ectodomain includes a non-natural disulfide bond between I201C and A433C substitutions and further includes one of a T50W, S110W, Q114W, K117W, K117E, V120W, K121W, K121E, T123W, F159Y, M426W, P220W, or R429W cavity filling amino acid substitution. In some embodiments, the recombinant HIV-1 Env ectodomain includes a cavity filling substitution at position 193 (e.g., L193F), and further includes substitutions to introduce a non-natural disulfide bond between positions 195 and 423, such as N195C/I423C substitutions; an exemplary sequence is set forth as SEQ ID NO: 688. In some embodiments, the recombinant HIV-1 Env ectodomain includes a cavity filling substitution at position 431 (e.g., G431F), and further includes substitutions to introduce a non-natural disulfide bond between positions 202 and 434, such as T202C/M434C substitutions; an exemplary sequence is set forth as SEQ ID NO: 655. In some non-limiting embodiments, the recombinant HIV-1 Env ectodomain includes a non-natural disulfide bond between I201C and A433C substitutions and further includes one of a T50W, S110W, Q114W, K117W, K117E, V120W, K121W, K121E, T123W, F159Y, M426W, P220W, or R429W cavity filling amino acid substitution. In additional such embodiments, the recombinant HIV-1 Env ectodomain can further include one or more amino acid substitutions that stabilize gp41 as described above (e.g., as listed in Table 9, such as 41C/540C substitutions), and/or can further include the SOS, IP, SOSIP mutations. Exemplary recombinant HIV-1 Env ectodomain sequences including such substitutions are set forth as SEQ ID NOs: 120, 183-194.
[0283] In several embodiments, the recombinant HIV-1 Env ectodomain can include a combination of substitutions as set forth in Table 11, that include at least one cavity filling substitution.
TABLE-US-00007 TABLE 11 Exemplarity cavity-filling amino acid substitutions Exemplary Exemplary Exemplary Position substitutions Substitutions SEQ ID NO Cavity Location (CL) and stabilizing mechanism (SM) 120, 203 201: V120W, Q203V 129 CL: Under V1V2 cap at N-term of β2 F, W, Y, L, I, M; SM: stabilize prefusion cap/prevent bridging sheet formation, 203: β2 extends in CD4-bound state, this stabilizes small F, W, Y, L, I, M, V hydrophobic pocket in ground state 39, 534 39: W, M, I, F Y39F, S534V; 47-48 CL: gp120/gp41 interface 534: I, W, F, A, M, Y39W, S534A SM: fill cavity and add hydrophobic interactions at the gp120- V gp41 interactive surface 39, 534 + 39: W, M, I, F; Y39F, S534V, 49 CL: gp120/gp41 interface T37V, 534: I, W, F, A, M, T37V, T499V SM: fill cavity and add hydrophobic interactions at the gp120- T499V V gp41 interactive surface 39, 534 + 39: W, M, I, F; Y39F, Y40F, 50 CL: gp120/gp41 interface Y40F, 534: I, W, F, A, M, S534V, T37V, SM: fill cavity and add hydrophobic interactions at the gp120- T37V, V T499V gp41 interactive surface T499V 53, 246 246: F, W, Y, L, I, F53W, Q246W 197 CL: gp120-gp41 interface, N-term of β2, middle of β8 M, V SM: Fill a cavity between gp120 and gp41 to stabilize gp41 disordered region and gp120/gp41 interaction 68, 209, 68: F, W, Y, L, I, M V68L, S209R 196 CL: Loop between α1 and β0 and loop between β3 and β4 SM: Fill cavities that are otherwise filled by CD4 induced α0 formation 125, F, W, Y, L, I, M, V L125W_deltaP124 131 CL: Cavity between N-term of V1V2 domain and V3 near delP124 residue 127 and 126-196 disulfide of V1V2 SM: Removal of ground state destabilization/flexibility cavity filling/proline removal 139, 326 139: F. M, I, Y, T139W, I326R 45 CL: at the interface of V1V2 and V3 loops T; SM: Stabilize interactions between V1V2 and V3 loops in the 326: M, W, F, mature closed state Y, R 151, 153, 153: F, W, Y, L, I, R151E, E153W, 132 CL: V1 loop at position 153 328 M, V; Q328W SM: Adding hydrophobic patch at V1 loop to V3 loop 328: F, W, Y, L, I, M, V 177, 323 323: F, Y, W Y177W, I332F 198 CL: C-term of beta C, C-term of beta V3B, SM: Fills cavity between V3 and gp120 core to stabilize closed V1V2 cap 180, 421, 421: F, W, Y; 180: D180L, K421W 123 CL: V1V2 interaction near residue 180 with V3 and base of L, V, I, M β21 SM: This will stabilize v1v2 to v3 along with destabilizing β21 from adopting CD4-bound-conformation 201, 423 F, Y, L, M, V I201W, I423W 173 CL: parallel β # SM: prevent bridging sheet formation 223, 544 223: Y, W F223W, L544Y 32 CL: gp41 tip of α6 544: F, Y, W SM: stabilize gp120/gp41 interface L125, 195 W L125W, I195W 701 CL: V1V2-V3 interface near 126-196 disulfide bond 176, 323 176: Y, W; 323: F176W/I323Y 730 CL: gp120 V1/V2/V3, stabilize V1/V2/V3 F, Y, W 176, 154 176: Y, W; 154: F176W/L154W 731 CL: gp120 V1/V2, stabilize V1/V2/V3 F, Y, W 159, 154 159: Y, W; 154: F159Y/L154W 732 CL: gp120 V1/V2, stabilize V1/V2/V3 F, Y, W I251, 260 F I251F/L260F 658 CL: Engineering hydrophobic core between gp120 V2/V3 with double F substitution to stabilize V1/V2/V3
[0284] In some embodiments, the recombinant HIV-1 Env ectodomain comprises gp120-gp41 protomers comprising the SOSIP and 201C/433C substitutions and further comprising a cavity filling substitution (such as a Y F, or M substitution) at anyone of positions: 70; 75; 110; 111; 112; 115; 117; 118; 120; 153; 154; 159; 164; 172; 175; 176; 179; 191; 193; 194; 198; 202; 204; 208; 223; 304; 307; 309; 315; 316; 323; 423; 427; 430; 432; 432; 436; 544; 580; 583; 159 and 323; 44 and 537; 544 and 223; 544, 537, and 223; 580 and 583; 125 and 194; 134, 175, 322, and 326; 134, 322, and 326; 134, 136, 150, and 326; 154, 300, 302, and 320; 120, 203, and 318; 120 and 315; 177 and 420; 177, 328, and 420; 116, 426, and 432; 426 and 432; 134, 175, 322, 326, 136, and 150; 120, 203, 318, and 315; 154, 300, 302, 320, 177, and 420; or 139, 140, 324, and 325.
[0285] In some embodiments, the recombinant HIV-1 Env ectodomain comprises gp120-gp41 protomers comprising the SOSIP and 201C/433C substitutions and further comprising a substitution to destabilize the CD34-induced conformation, such as a F210A; F210S; Q432P; R429N; R429L; R429L and W427M; T202P; or V120T substitution
[0286] In some embodiments, the recombinant HIV-1 Env ectodomain comprises gp120-gp41 protomers comprising the SOSIP and 201C/433C substitutions and further comprising cysteine substitutions to introduce a non-natural disulfide bond, such as T538C and Q652C; R304C and Q440C; G431GC and S199C; A58C and T77C; D57C and T77C
[0287] In some embodiments, the recombinant HIV-1 Env ectodomain comprises gp120-gp41 protomers Comprising the SOSIP and 201C/433C substitutions and further comprising substitutions to disrupt formation of helix 0, such as W69P; V68P; T71P; N67P; H66P; or N67P and H66P In some embodiments, the recombinant HIV-1 Env ectodomain comprises gp120-gp41 protomers comprising the SOSIP and 201C/433C substitutions and further comprising substitutions to destabilize the gp41 helix bundle, such as I573T; G594N; I573T and G594N; I573T and G594N and K574E; I573T, G594N, and K574T.
N-Linked Glycosylation Sites
[0288] In several embodiments, the recombinant HIV-1 Env ectodomain trimer can includes one or more N-linked glycosylation sites introduced onto the membrane proximal portion of the trimer to mask non-neutralizing epitopes present on this portion of the trimer. Such mutations are typically utilized in soluble embodiments of the recombinant HIV-1 Env ectodomain trimer. To create an N-linked glycosylation site, the sequence Asn-X-Ser/Thr (where X is any amino acid except Pro) can to be introduced. This can be accomplished by substitution of a Ser/Thr amino acid two residues C-terminal to a native Asn residue, or by substitution of an Asn amino acid two residues N-terminal to a native Ser/Thr residue, or by substitution of both an Asn and Ser/Thr residue separated by one non-proline amino acid. In some embodiments, the recombinant HIV-1 Env ectodomain comprises one or more amino acid substitutions that introduce an N-linked glycosylation site at the N-terminus of the gp120 polypeptide, the C-terminus of the gp120 polypeptide, and/or the C-terminus of the gp41 polypeptide. Exemplary amino acid substitutions for introducing one or more such N-linked glycosylation sites are provided under code D of the Table in Table 13, and are provided in Table 12, below:
TABLE-US-00008 TABLE 12 Exemplary N-linked glycan mutants to mask non-neutralizing epitopes. Glycan Exemplary Exemplary position substitutions SEQ ID NO 504 504N/506T 453 661 661N/663T 454 504 and 661 504N/506T, 661N/663T 455 502 K502N/R504T 456 658 Q658N/L660T 457 33 W35T 458 35 W35N 459 35 and 504 W35N, R504N/V506T 460 33 and 661 W35T, L661N/L663T 461 502 and 661 K502N/R504T, L661N/L663T 462
Antibody Stabilization
[0289] In additional embodiments, the disclosed immunogens can include a recombinant HIV-1 Env ectodomain trimer covalently linked (e.g., by a non-natural disulfide bond) to one or more neutralizing antibodies, such as the VRC01, PGT122, or 35O22 antibodies. Linkage to the neutralizing antibody can increase the stability of the immunogen in the prefusion mature closed conformation.
35O22
[0290] In some embodiments, the recombinant HIV-1 Env ectodomain trimer includes a recombinant HIV-1 Env ectodomain including a cysteine substitution that can form a non-natural disulfide bond with a cysteine residue in the heavy or light chain variable region of the 35O22 monoclonal antibody. For example, in some embodiments, the HIV-1 ectodomain includes a cysteine substitution at position 90, which can form a non-natural disulfide bond with a cysteine at position 80 (kabat numbering) of the 35O22 heavy chain variable region. In some embodiments, the HIV-1 ectodomain includes a cysteine substitution at position 238, which can form a non-natural disulfide bond with a cysteine at position 77 (kabat numbering) of the 35O22 heavy chain variable region. In some embodiments, the HIV-1 ectodomain includes a cysteine substitution at position 529, which can form a non-natural disulfide bond with a cysteine at position 111 (kabat numbering) of the 35O22 heavy chain variable region. In some embodiments, the HIV-1 ectodomain includes a cysteine substitution at position 624, which can form a non-natural disulfide bond with a cysteine at position 109 or 112 (kabat numbering) of the 35O22 heavy chain variable region. In some embodiments, the HIV-1 ectodomain includes a cysteine substitution at position 625, which can form a non-natural disulfide bond with a cysteine at position 109 (kabat numbering) of the 35O22 heavy chain variable region. Exemplary sequences for use in such embodiments are provided under code C of the Table in Table 13. For example, exemplary recombinant HIV-1 Env ectodomain sequences including such cysteine substitutions are set forth as SEQ ID NOs: 401-405, and 411. Additionally, exemplary 35O22 heavy chain variable region sequences for use in such embodiments are set forth as SEQ ID NOs: 406-410.
VRC01
[0291] In some embodiments, the recombinant HIV-1 Env ectodomain trimer includes a recombinant HIV-1 Env ectodomain including a cysteine substitution that can form a non-natural disulfide bond with a cysteine residue in the heavy or light chain variable region of the VRC01 monoclonal antibody. In some embodiments, the recombinant HIV-1 Env ectodomain trimer includes a recombinant HIV-1 Env ectodomain including a cysteine substitution at position 449 (e.g., a G459C substitution, HXB2 numbering) that can form a non-natural disulfide bond with a heavy chain variable region of a VRC01 monoclonal antibody comprising a cysteine substitution at heavy chain position 60 or 61 (kabat numbering). Exemplary sequences for use in such embodiments are provided under code C of the Table in Table 13. For example, exemplary recombinant HIV-1 Env ectodomain sequences including a position 459 cysteine substitution are set forth as SEQ ID NOs: 412-436. Exemplary VRC01 heavy and light chain sequences for use in such embodiments (e.g., including heavy chain variable region with a cysteine substitution at position 60 or 61) are set forth as SEQ ID NOs: 437-448.
PGT122
[0292] In some embodiments, the recombinant HIV-1 Env ectodomain trimer includes a recombinant HIV-1 Env ectodomain including a cysteine substitution that can form a non-natural disulfide bond with a cysteine residue in the heavy or light chain variable region of the PGT122 monoclonal antibody. In some embodiments, the recombinant HIV-1 Env ectodomain trimer includes a recombinant HIV-1 Env ectodomain including a cysteine substitution at position 323 (e.g., a I323C substitution, HXB2 numbering) that can form a non-natural disulfide bond with a heavy chain variable region of a PGT122 monoclonal antibody comprising a cysteine substitution at heavy chain position 29 or 67 (kabat numbering). Exemplary sequences for use in such embodiments are provided under code C of the Table in Table 13. For example, exemplary recombinant HIV-1 Env ectodomain sequences including a position 323 cysteine substitution are set forth as SEQ ID NOs: 449-450. Exemplary VRC01 heavy and light chain sequences for use in such embodiments (e.g., including heavy chain variable region with a cysteine substitution at position 29 or 67) are set forth as SEQ ID NOs: 451-452.
Chimeric Env Ectodomains
[0293] In some embodiments, the recombinant HIV-1 Env ectodomain stabilized in the prefusion mature closed conformation can include sequences from multiple strains of HIV-1. For example, the recombinant HIV-1 Env ectodomain can include a gp120 sequence from a first HIV-1 strain and a gp41 sequence from a heterologous HIV-1 strain, or a particular structural domain (such as the V1V2 domain) from a HIV-1 strain of interest (such as CAP256.SU, a BB201.B42, a KER2018.11, a CH070.1, a ZM233.6, a Q23.17, a A244, a T250-4, or a WITO.33) with the remainder of the HIV-1 Env ectodomain from a heterologous HIV-1 strain (such as BG505). The chimeric HIV-1 Env ectodomain can further include any of the amino acid substitutions described herein, for example the 201C/433C, SOSIP, and DS substitutions for stabilization in the prefusion mature closed conformation. In the context of inducing an immune response in a subject that can control infection across multiple HIV-1 strains, the use of immunogens based on diverse HIV-1 strains can overcome the intrinsic sequence diversity of HIV-1 Env. Exemplary sequences of recombinant HIV-1 Env ectodomains linked to a nanoparticle subunit are provided under code H in Table 13 included in Example 15.
[0294] Exemplary sequences of chimeric HIV-1 Env ectodomain trimers that include the V1V2 domain sequence (positions 126-196) of the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strains of HIV-1, with the remainder including BG505.SOSIP.DS.368R sequence, are provided as follows: Q23.17 V1V2 chimera (SEQ ID NO: 2126), ZM233.6 V1V2 chimera (SEQ ID NO: 2125), WITO.33 V1V2 chimera (SEQ ID NO: 2128), A244 V1V2 chimera (SEQ ID NO: 2127), BB201.B42 V1V2 chimera (SEQ ID NO: 2122), KER2018.11 V1V2 chimera (SEQ ID NO: 2123), CH070.1 V1V2 chimera (SEQ ID NO: 2124), CAP256.SU V1V2 chimera (SEQ ID NO: 2121), and T-250-4 V1V2 chimera (SEQ ID NO: 2129).
Platform
[0295] As described in the Examples, prefusion mature gp41 wraps its hydrophobic core around extended N- and C-termini-strands of gp120 (see
[0296] In some embodiments, the recombinant Env ectodomain includes N- and C-terminal regions of gp120 as well as the gp41 ectodomain from a first HIV-1 strain (such as BG505, for example, with SOSIP substitutions), and the remainder of gp120 from a heterologous HIV-1 strain. In some embodiments, the heterologous HIV-1 strain can be a subtype A (such as B1369.9A, MB201.A1, QH209.14M.A2), subtype B (such as AC10.29), subtype C (such as 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, CNE58, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9), subtype CRF AC (such as 3301.V1.C24, 6545.V4.C1), subtype CFR AE (such as 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8) and subtype CRF BC (such as CH038.12, CH117.4) strain of HIV-1.
[0297] In some embodiments, the recombinant HIV-1 Env ectodomain can include a gp41 ectodomain, an N-terminal region of the gp120 polypeptide comprising a β-4 strand and a C-terminal region of the gp120 polypeptide comprising a β26 strand from a first strain of HIV-1 (such as BG505), and all or a portion of the remaining residues of the gp120 polypeptide are from one or more heterologous HIV-1 strains. The heterologous strain can be, for example, one of CAP256.SU (SEQ ID NO: 51), a BB201.B42 (SEQ ID NO: 81), a KER2018.11 (SEQ ID NO: 107), a CH070.1 (SEQ ID NO: 174), a ZM233.6 (SEQ ID NO: 745), a Q23.17 (SEQ ID NO: 746), a A244 (SEQ ID NO: 747), a T250-4 (SEQ ID NO: 2114), a WITO.33 (SEQ ID NO: 748), a 426c (with N276D, N460D, N463D, SEQ ID NO: 2144, a d45-01dG5 (2145), or a JRFL (SEQ ID NO: 2115) strain of HIV-1. In additional embodiments, the N-terminal region of the gp120 polypeptide can further include the β-3 strand from the first HIV-1 strain (such as BG505). In more embodiments the C-terminal region of the gp120 polypeptide can further include the β25 strand or the β25 strand and all or a portion of the α5 helix from the first HIV-1 strain (such as BG505). In more embodiments, the N-terminal region of the gp120 polypeptide can include from 5 to 30 (such as 10, 30, 5-20, 5-25, 5-15, 5-10, 10-20, 20-30, 15-25, or 5, 10, 15, 20, 25) amino acids and/or the C-terminal region of the gp120 polypeptide can include from 5-40 (such as 10-40, 5-30, 5-25, 5-20, 10-20, 20-30, 30-40, 10-30, 20-40, or 5, 10, 15, 20, 25, 30, or 35) amino acids, from the N- or C-terminus of the gp120 polypeptide, respectively, from the first strain of HIV-1 (such as BG505). Any of the stabilizing amino acid substitutions (such as the SOSIP substitutions, and/or the 201C/433C substitutions) can be included in the chimeric HIV-1 Env ectodomain.
[0298] In some embodiments, the recombinant Env ectodomain can include gp120 residues 31-45 and 478-507, and gp41 residues (e.g., 512-664) from the first HIV-1 strain (such as BG505), and the remainder of the gp120 residues in the Env protein can be from a heterologous HIV-1 strain. For example, the recombinant Env ectodomain can include gp120 positions 31-45 and 478-507, and gp41 residues (e.g., 512-664) from the BG505 strain with SOSIP substitution (e.g., as set forth as SEQ ID NO: 3), and the remaining gp120 residues in the Env ectodomain can be from any one of the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, WITO.33, JRFL, 426c (with N276D, N460D, N463D), d45-01dG5, B1369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, CNE58, or CH117.4 strains of HIV-1. Any of the stabilizing amino acid substitutions (such as the SOSIP substitutions, and/or the 201C/433C substitutions) can be included in the chimeric HIV-1 Env ectodomain. Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 379-386, 387, 764-772, and 856-1036. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 379-386, 387, 764-772, and 856-1036, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 379-386, 387, 764-772, and 856-1036. In a preferred embodiment, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 856, 872, 881, 888, 902, 908, 917, 924, 930, 933, 937, 938, 940, 953, 956, 962, 964, 978, 871, 973, 990, 1010, 1025, 1034, or 1098, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 856, 872, 881, 888, 902, 908, 917, 924, 930, 933, 937, 938, 940, 953, 956, 962, 964, 978, 871, 973, 990, 1010, 1025, 1034, or 1098.
Interface Residues
[0299] In more embodiments, the gp120 portion of the recombinant HIV-1 Env ectodomain (from the heterologous HIV-1 strain) can further include one or more substitutions at the gp120-gp41 interface that introduce residues from the first HIV-1 strain. In some embodiments, such substitutions can enhance the stabilization of the HIV-1 ectodomain in the prefusion mature conformation by maintaining native BG505 interaction between the membrane proximal “platform” and the core gp120. In some embodiments, the substitutions at the gp120-gp41 interface that introduce residues from the first HIV-1 strain can include substitutions at gp120 positions 46-54, 70-75, 84-89, 99, 102, 106, 107, 114, 215, 220-224, 226, 244, 471-473, and 476-477 (referred to herein as “Interface Residue Set A”). In some embodiments, the recombinant HIV-1 Env ectodomain includes gp120 residues 31-45 and 478-507, and gp41 residues (e.g., 512-664), from a first HIV-1 strain (such as the BG505 strain), and includes gp120 residues 46-477 from a heterologous strain of HIV-1 (such as the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, WITO.33, JRFL, 426c (with N276D, N460D, N463D), d45-01dG5, B1369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, CNE58, or CH117.4 strain of HIV-1), and further includes substitutions in the gp120 residues from the heterologous strain that introduce residues from the first HIV-1 strain at the Interface Residue Set A positions of gp120. Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 579-586, 588-595, and 1036-1056. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 579-586, 588-595, and 1036-1056, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 579-586, 588-595, and 1036-1056.
Additional Description of Chimeric Domains
[0300] In some embodiments, the chimeric HIV-1 Env ectodomain can further include additional structural domains or elements from the first HIV-1 strain (such as BG505) in place of those of the heterologous strain, for example, strand C of the V1V2 domain (such as gp120 positions 166-173), a V3 domain (such as gp120 positions 296-331), a V2 loop (such as gp120 positions 154-205), a V1 loop (such as gp120 positions 119-153), positions 191-205. In some embodiments, the chimeric HIV-1 Env ectodomain can include from the first HIV-1 strain (such as BG505): a V2 loop and a V3 loop; a Strand C of the V1V2 domain and a V3 domain; positions 191-205 and a Strand C of the V1V2 domain; a V1 loop and a V3 domain; a V1 loop, a Strand C of the V1V2 domain, and a V3 domain; a V1 loop, a V2 loop, and a V3 domain; or a V1V2 domain. Exemplary sequences concerning such chimeric HIV-1 Env ectodomains are provided as SEQ ID NOs: 1727-1764.
Chimeras of Three Strains
[0301] In additional embodiments, the recombinant HIV-1 Env ectodomain trimer can be a chimera having unique antigenic characteristics that provide for binding to mature and unmutated common ancestor (UCA) forms of multiple classes of broadly neutralizing antibodies (e.g., targeting the CD4 binding site and the V1V2 domain). Such recombinant HIV-1 Env ectodomain trimers are of particular interest for use as a “prime” immunogen in a prime-boost immunization protocol for eliciting an immune response to HIV-1 Env.
[0302] For example, in some embodiments, the recombinant HIV-1 Env ectodomain trimer can be a chimera comprising amino acid sequences from three HIV-1 strains, including a membrane proximal “platform” from a first strain, a V1V2 domain from a second strain, and the remainder from a heterologous strain. In a non-limiting example, the V1V2 domain can be from an Env protein (such as one of CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33) that binds to a UCA form of a broadly neutralizing antibody (e.g., VRC26 or PGT145), such as described in Example 13. The remainder sequences of the chimera can also be from an Env protein that binds to a UCA form of a broadly neutralizing antibody (such as 45_01dG5 or 426c with amino acid substitutions to remove N-linked glycan sequons at positions 276, 460, 463), such as a UCA form or a VRC01-class antibody, for example VRC01 gHgL as described in Example 13. The sequences of the first, second, and heterologous strains are further modified to include the one or more amino acid substitutions that stabilize the recombinant HIV-1 Env ectodomain trimer in the prefusion mature closed conformation (such as SOS, IP, and DS substitutions), and can also include additional substitutions as needed, for example, substitutions to increase protease cleavage (such as the R6 substitution), or to increase or decrease the desired number of glycans (such as addition of glycan sequons at positions 504 and 661, and/or at position 332).
[0303] In some embodiments, the recombinant HIV-1 Env ectodomain trimer can be a chimera comprising amino acid sequences from three HIV-1 strains, wherein the recombinant HIV-1 Env ectodomain includes (1) a gp41 ectodomain (such as positions 512-664), an N-terminal region of the gp120 polypeptide comprising a β-4 strand, and a C-terminal region of the gp120 polypeptide comprising a β26 strand, from a first strain of HIV-1 (such as BG505), (2) a V1V2 domain (such as gp120 positions 126-196) of the gp120 polypeptide from a second strain of HIV-1 (such as one of CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33; and (3) the remaining sequence of the gp120 polypeptide from a heterologous strain of HIV-1 (such as 45_01dG5 or 426c with amino acid substitutions to remove N-linked glycan sequons at positions 276, 460, 463). In some such embodiments, the N-terminal region of the gp120 polypeptide can further comprises a β-3 strand from the first HIV-1 strain; and the C-terminal region of the gp120 polypeptide further comprises a β25 strand or a β25 strand and a α5 helix from the first HIV-1 strain. In additional embodiments, the N- and C-terminal regions of the gp120 polypeptide comprise gp120 positions 31-45 and 478-508, respectively. the gp120 polypeptide can further comprises positions 46-54, 70-75, 84-89, 99, 102, 106, 107, 114, 215, 220-224, 226, 244, 471-473, and 476-477 from the first HIV-1 strain. The sequences of the first, second, and heterologous strains are further modified to comprise the one or more amino acid substitutions that stabilize the recombinant HIV-1 Env ectodomain trimer in the prefusion mature closed conformation.
[0304] In some embodiments, the second and heterologous strains are respectively one of: CAP256.SU and 426c; BB201.B42 and 426c; KER2018.11 and 426c; CH070.1 and 426c; ZM233.6 and 426c; Q23.17 and 426c; A244 and 426c; T250-4 and 426c; WITO.33 and 426c; CAP256.SU and 45_O1dG5; BB201.B42 and 45_01dG5; KER2018.11 and 45_01dG5; CH070.1 and 45_01dG5; ZM233.6 and 45_01dG5; Q23.17 and 45_01dG5; A244 and 45_01dG5; T250-4 and 45_01dG5; or WITO.33 and 45_01dG5; and wherein the 426c strain further comprises amino acid substitutions to remove the N-linked glycan sequons at positions 276, 460, 463. The sequences of the first, second, and heterologous strains are further modified to include the one or more amino acid substitutions that stabilize the recombinant HIV-1 Env ectodomain trimer in the prefusion mature closed conformation (such as SOS, IP, and DS substitutions), and can also include additional substitutions as needed,
[0305] In some embodiments, the second HIV-1 strain (providing the V1V2 domain) can be one of B1369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, CNE58, CH117.4, CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, WITO.33, or JRFL. For example, the second HIV-1 strain can be one of CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, WITO.33, and JRFL.
[0306] Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 2146-2159. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, or 2159, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, or 2159.
Residue Set B
[0307] In more embodiments, the gp120 portion of the recombinant HIV-1 Env ectodomain (from the heterologous HIV-1 strain) can include additional substitutions to alter the antigenicity of the ectodomain. In some embodiments, the substitutions at the gp120-gp41 interface that introduce residues from the first HIV-1 strain can include substitutions at gp120 positions 133-134, 164, 169, 308, and 316 (referred to herein as “Residue Set B”). In some embodiments, the recombinant HIV-1 Env ectodomain includes gp120 residues 31-45 and 478-507, and gp41 residues (e.g., 512-664), from a first HIV-1 strain (such as the BG505 strain with SOSIP substitutions set forth as SEQ ID NO: 3), and includes gp120 residues 46-477 from a heterologous strain of HIV-1 (such as the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, WITO.33, B1369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, CNE58, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, or CH117.4 strain of HIV-1), and further includes substitutions in the gp120 residues from the heterologous strain that introduce residues from the first HIV-1 strain at the Residue Set B positions of gp120. Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 1114-1142. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 1114-1142, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 1114-1142.
Residue Set C
[0308] In more embodiments, the gp120 portion of the recombinant HIV-1 Env ectodomain (from the heterologous HIV-1 strain) can include additional substitutions to alter the antigenicity of the ectodomain. In some embodiments, the substitutions at the gp120-gp41 interface that introduce residues from the first HIV-1 strain can include substitutions at gp120 positions 49, 133-134, 149-152, 164, 169, 188, 190, 211, 223, 252, 281, 293, 308, 316, 336, 340, 352, 360, 362-363, 369, 372, 393, 410, 432, 442, 444, 446, 474, and 476 (referred to herein as “Residue Set C”). In some embodiments, the recombinant HIV-1 Env ectodomain includes gp120 residues 31-45 and 478-507, and gp41 residues (e.g., 512-664), from a first HIV-1 strain (such as the BG505 strain with SOSIP substitutions set forth as SEQ ID NO: 3), and includes gp120 residues 46-477 from a heterologous strain of HIV-1 (such as the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, WITO.33, B1369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, CNE58, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, or CH117.4 strain of HIV-1), and further includes substitutions in the gp120 residues from the heterologous strain that introduce residues from the first HIV-1 strain at the Residue Set C positions of gp120. Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 1143-1171. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 1143-1171, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 1143-1171.
Residue Set D
[0309] In more embodiments, the gp120 portion of the recombinant HIV-1 Env ectodomain (from the heterologous HIV-1 strain) can include additional substitutions to alter the antigenicity of the ectodomain. In some embodiments, the substitutions at the gp120-gp41 interface that introduce residues from the first HIV-1 strain can include substitutions at gp120 positions of Residue Set C and also gp120 positions 46, 60, 62-63, 84-85, 87, 99, 102, 130, 132, 135, 153, 158, 160-161, 165-167, 171-173, 175, 177-178, 181, 184-185, 189, 202, 232, 234, 236, 240, 268-271, 275, 277, 287, 289, 292, 295, 297, 305, 315, 317, 319, 322, 328, 330, 332-335, 337, 339, 343-347, 350-351, 357, 371, 375, 379, 387, 389, 394, 411, 412-413, 415, 424, 426, 429, 440, 460-461, 465, 475, and 477 (referred to herein as “Residue Set D”). In some embodiments, the recombinant HIV-1 Env ectodomain includes gp120 residues 31-45 and 478-507, and gp41 residues (e.g., 512-664), from a first HIV-1 strain (such as the BG505 strain with SOSIP substitutions set forth as SEQ ID NO: 3), and includes gp120 residues 46-477 from a heterologous strain of HIV-1 (such as the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, WITO.33, BI369.9A, MB201.A1, QH209.14M.A2, 0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, CNE58, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9, 3301.V1.C24, 6545.V4.C1, 620345.c1, C1080.c3, C4118.09, CNE55, TH966.8, AC10.29, CH038.12, or CH117.4 strain of HIV-1), and further includes substitutions in the gp120 residues from the heterologous strain that introduce residues from the first HIV-1 strain at the Residue Set C and Residue Set D positions of gp120. Non-limiting examples of sequences of such chimeric HIV-1 Env ectodomains (that may also include one or more amino acid substitutions, such as 201C/433C and SOSIP substitutions to stabilize the HIV-1 ectodomain in the prefusion mature closed conformation) are provided herein as SEQ ID NOs: 1172-1200. Thus, in some embodiments, the recombinant HIV-1 Env protein includes an amino acid sequence set forth as any one of SEQ ID NOs: 1172-1200, or an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 1172-1200.
Additional Substitutions
[0310] The chimeric recombinant HIV-1 Env ectodomain can be mutated to include one or more of the disclosed amino acid substitutions to generate a chimeric recombinant HIV Env protein (or fragment thereof, such as a gp140 or gp145 protein) that is stabilized in a prefusion mature closed conformation. For example, in some non-limiting embodiments, cysteine substitutions at positions 201 and 433, and the SOSIP mutations, are made to a recombinant HIV-1 Env ectodomain including a V1V2 domain from a CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strain of HIV-1 to generate the recombinant HIV-1 Env ectodomain that can form a trimer stabilized in the prefusion mature closed conformation. In some embodiments, the N-terminal residue of the transplanted V1V2 domain can include one of Env positions 120-130 and the C-terminal residue of the transplanted V1V2 domain can include one of Env positions 195-205. In one non-limiting example, the transplanted V1V2 domain includes HIV-1 Env positions 126-196. Exemplary sequences of HIV-1 ectodomains including a transplanted V1V2 domain are provided under code H of the Table in Table 13 and as SEQ ID NOs: 379-386, or 511-518.
[0311] Sequences from additional HIV-1 strains (such as a third, fourth or fifth strain) can be incorporated into the chimeric HIV-1 Env ectodomain. For example, any of the chimeric HIV-1 Env ectodomains disclosed herein can be further modified to include all or portions of the V1V2 domain (such as strand C of the V1V2 domain, for example, HIV-1 Env positions 166-173) from a heterologous HIV-1 strain (such as CAP256 SU). In a non-limiting embodiment, SEQ ID NO: 382 (CNE58_SU-strandC_bg505-NCgp120+gp41.SOSIP) provided herein includes gp41 and gp120 N- and C-terminal regions (31-45 and 478-507, respectively) from BG505.SOSIP.664, with residues 166-173 (V1V2 strand C) from CAP256 SU, and the rest of gp120 from CNE58.
[0312] Any of the chimeric HIV-1 Env ectodomain trimers provided herein can comprise gp120-gp41 protomers that are single chain Env ectodomains, including a single polypeptide chain including the gp120 polypeptide linked to the gp41 ectodomain by a heterologous peptide linker.
[0313] In some embodiments, the gp120/gp41 protomers in the chimeric HIV-1 Env ectodomain can comprise an amino acid sequence set forth as any one of SEQ ID NOs: 1580-1610, 1648-1650, 1657-1659, 1663-1673, 1676-2098, or an amino acid sequence at least 90% identical thereto.
[0314] In any of the disclosed embodiments that include a chimeric V1V2 domain, the V1V2 domain can comprise or consist of gp120 positions 126-196 (HXB2 numbering).
Single Chain HIV-1 Env Proteins
[0315] In some embodiments, the recombinant HIV-1 Env ectodomain is a single chain HIV-1 Env protein, which includes a single polypeptide chain including the gp120 polypeptide and the gp41 ectodomain. Native HIV-1 Env sequences include a furin cleavage site at position 511 (e.g., REKR.sub.511), which is cleaved by a cellular protease to generate the gp120 and gp41 polypeptides. The disclosed single chain proteins do not include the furin cleavage site separating the gp120 and gp41 polypeptides; therefore, when produced in cells, the Env polypeptide is not cleaved into separate gp120 and gp41 polypeptides.
[0316] Single chain HIV-1 proteins can be generated by mutating the furin cleavage site to prevent cleave and formation of separate gp120 and gp41 polypeptide chains. In several embodiments, the gp120 and gp41 polypeptides in the single chain HIV-1 Env protein are joined by a linker, such as a peptide linker. Examples of peptide linkers that can be used include glycine, serine, and glycine-serine linkers, such as a G, S, GG, GS, SG, GGG, or GSG linker or any of the linkers set forth as SEQ ID NOs: 519-542. In some embodiments, the peptide liker can comprise a 10 amino acid glycine-serine peptide linker, such as a peptide linker comprising the amino acid sequence set forth as SEQ ID NOs: 528 (GGSGGGGSGG). In some embodiments, the single chain HIV-1 protein can include a heterologous peptide linker between one of HIV-1 Env residues 507 and 512, 503 and 519, 504 and 519, 503 and 522, or 504 and 522. In some embodiments, the single chain HIV-1 protein can include a heterologous peptide linker between HIV-1 Env residues 507 and 512.
[0317] Any amino acid substitution or insertion can be used that effectively prevents furin (or other protease) cleavage of HIV-1 Env into separate gp120 and gp41 polypeptide chains, and also allows folding of the HIV-1 Env ectodomain into its prefusion mature closed conformation.
[0318] Any of the stabilizing mutations (or combinations thereof) disclosed herein can be included in the single chain HIV-1 Env protein as long as the single chain HIV-1 Env protein retains the HIV-1 Env prefusion mature closed conformation. For example, in some embodiments, the single chain HIV-1 Env protein can include cysteine substitutions at positions 201 and 433 that form a disulfide bond and one or more of the pairs of cysteine substitutions listed in Table 9, or the single chain HIV-1 Env protein can include cysteine substitutions at positions 201 and 433 that form a disulfide bond and further include the SOSIP mutations.
[0319] It will be appreciated that the single chain HIV-1 Env proteins can be incorporated into any embodiment disclosed herein in which the cleaved HIV-1 Env proteins can be used. For example, the single chain HIV-1 Env proteins can be linked to a protein nanoparticle subunit to generate a protein nanoparticle including the single chain Env protein, and can also be used in the context of a chimeric HIV-1 Env ectodomain including sequences from two or more different strains of HIV-1.
[0320] Exemplary single chain HIV-1 Env sequences are provided under code B of the Table in Table 13 and set forth as SEQ ID NOs: 210-408. Additional exemplary single chain chimeric HIV-1 Env ectodomain sequences are indicated as such in column 7 of the tables in Table 13, and also provides as SEQ ID NOs: 1078-1098, and 1643-1650.
Membrane Anchored Embodiments
[0321] In some embodiments, the recombinant HIV-1 Env ectodomain is a membrane anchored protein, for example, the recombinant Env ectodomain can be linked to a transmembrane domain. The transmembrane domain can be linked to any portion of the recombinant HIV-1 Env ectodomain, as long as the presence of the transmembrane domain does not disrupt the structure of the HIV-1 Env ectodomain, or its ability to induce an immune response to HIV-1. In non-limiting examples, the transmembrane domain can be linked to the N- or C-terminal reside of a gp120 polypeptide, or the C-terminal residue of a gp41 ectodomain included in the recombinant HIV-1 Env protein. In some embodiments, the C-terminal residue of the gp41 ectodomain included in the recombinant HIV-1 Env ectodomain can be linked to the transmembrane domain. One or more peptide linkers (such as a gly-ser linker, for example a 10 amino acid glycine-serine peptide linker, such as a peptide linker comprising the amino acid sequence set forth as SEQ ID NOs: 528 (GGSGGGGSGG)) can be used to link the transmembrane domain and the gp120 or gp41 protein. In some embodiments a native HIV-1 Env MPER sequence can be used to link the transmembrane domain and the gp120 or gp41 protein.
[0322] Non-limiting examples of transmembrane domains for use with the disclosed embodiments include the BG505™ domain (KIFIMIVGGLIGLRIVFAVLSVIHRVR, SEQ ID NO: 758), the Influenza A Hemagglutinin™ domain (ILAIYSTVASSLVLLVSLGAISF, SEQ ID NO: 760, and the Influenza A Neuraminidase TM domain (IITIGSICMVVGIISLILQIGNIISIWVS, SEQ ID NO: 762). Nucleic acid sequences encoding these TM domains are provided as SEQ ID NOs: 759, 761, and 763, respectively.
[0323] The recombinant HIV-1 Env ectodomain linked to the transmembrane domain can include any of the stabilizing mutations provided herein. For example, the transmembrane domain can be linked to the C-terminal residue of a gp41 ectodomain included in a recombinant HIV-1 Env ectodomain including the DS substitutions (I201C/A433C), and/or can be linked to any of the disclosed chimeric recombinant HIV-1 Env ectodomains. Exemplary sequences of recombinant HIV-1 Env ectodomain (or a fragment thereof) linked to a transmembrane domain and including amino acid substitutions to stabilize the ectodomain in the prefusion mature closed conformation are provided under code T of the Table in Table 13, and as SEQ ID NOs: 544-571, and 1765-2098.
Linkage to a Trimerization Domain
[0324] In several embodiments, the recombinant HIV-1 Env ectodomain can be linked to a trimerization domain, for example the C-terminus of the gp41 protein included in the recombinant HIV-1 Env ectodomain can be linked to the trimerization domain. The trimerization domain can promotes trimerization of the three protomers of the recombinant HIV-1 Env protein. Non-limiting examples of exogenous multimerization domains that promote stable trimers of soluble recombinant proteins include: the GCN4 leucine zipper (Harbury et al. 1993 Science 262:1401-1407), the trimerization motif from the lung surfactant protein (Hoppe et al. 1994 FEBS Lett 344:191-195), collagen (McAlinden et al. 2003 J Biol Chem 278:42200-42207), and the phage T4 fibritin Foldon (Miroshnikov et al. 1998 Protein Eng 11:329-414), any of which can be linked to the recombinant HIV-1 Env ectodomain (e.g., by linkage to the C-terminus of the gp41 polypeptide to promote trimerization of the recombinant HIV-1 protein, as long as the recombinant HIV-1 Env ectodomain retains specific binding activity for a mature closed conformation specific antibody, prefusion-specific antibody (e.g., PGT122), and/or includes a HIV-1 Env mature closed conformation.
[0325] In some examples, the recombinant HIV-1 Env ectodomain can be linked to a Foldon domain, for example, the recombinant HIV-1 Env ectodomain can include a gp41 polypeptide with a Foldon domain linked to its C-terminus. In specific examples, the Foldon domain is a T4 fibritin Foldon domain such as the amino acid sequence GYIPEAPRDGQAYVRKDGEWVLLSTF (SEQ ID NO: 578), which adopts a β-propeller conformation, and can fold and trimerize in an autonomous way (Tao et al. 1997 Structure 5:789-798). Modified Foldon domains can also be used, such as a Foldon domain including an amino acid sequence set forth as GYIPEAPRDGQCYVRCDGEWVLLSTF (SEQ ID NO: 752), GYIPECPRDGQAYVCKDGEWVLLSTF (SEQ ID NO: 753), GYIPEAPRDGQCYCRKDGEWVLLSTF (SEQ ID NO: 754), or GYIPEAPRDGQACVRKDGECVLLSTF (SEQ ID NO: 755). These modified Foldon domains include amino acid substitutions that add two cysteine residues for formation of stabilizing disulfide bonds. In some embodiments, any of the disclosed recombinant HIV-1 Env ectodomains can be linked to a modified Foldon domain as described herein.
[0326] Exemplary sequences of recombinant HIV-1 Env ectodomain linked to a trimerization domain are provided under code G of the Table in Table 13, and as SEQ ID NOs: 508-510.
[0327] Typically, the heterologous trimerization domain is positioned C-terminal to the gp41 polypeptide. Optionally, the multimerization domain is connected to the recombinant HIV-1 Env ectodomain via a linker, such as an amino acid linker. Exemplary linkers are provided herein and are known in the art; non-limiting examples include Gly or Gly-Ser linkers, such as the amino acid sequence: GGSGGSGGS; SEQ ID NO: 574). Numerous conformationally neutral linkers are known in the art that can be used in this context without disrupting the conformation of the recombinant HIV-1 Env protein. Some embodiments include a protease cleavage site for removing the trimerization domain from the HIV polypeptide, such as, but not limited to, a thrombin site between the recombinant HIV-1 Env ectodomain and the trimerization domain.
Additional Descriptions of Recombinant HIV-1 Env Ectodomains
[0328] Any of the recombinant HIV-1 Env ectodomains disclosed herein can further include an N-linked glycosylation site at gp120 position 332 (if not already present on the ectodomain). For example, by T332N substitution in the case of BG505 based immunogens. The presence of the glycosylation site at N332 allows for binding by 2G12 antibody.
[0329] Any of the recombinant HIV-1 Env ectodomains disclosed herein can include a lysine residue at gp120 position 168 (if not already present on the ectodomain). For example, the lysine residue can be added by amino acid substitution (such as an E168K substitution in the case of the JR-FL based immunogens). The presence of the lysine residue at position 168 allows for binding of particular broadly neutralizing antibodies to the V1V2 loop of gp120.
[0330] Any of the recombinant HIV-1 Env ectodomains disclosed herein can include an arginine residue at gp120 position 368 (if not already present on the ectodomain). For example, the arginine residue can be added by amino acid substitution (such as a D368R substitution). The presence of the arginine residue at position 368 reduces binding of CD4 to the HIV-1 Env ectodomain to inhibit the trimer from adopting the CD4-bound conformation.
[0331] Any of the recombinant HIV-1 Env ectodomains disclosed herein can further include a non-natural disulfide bond between gp120 positions 201 and 433 (if not already present on the ectodomain). For example, the non-natural disulfide bond can be introduced by including cysteine substitutions at positions 201 and 433. The presence of the non-natural disulfide bond between residues 201 and 433 contributes to the stabilization of the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0332] Any of the recombinant HIV-1 Env ectodomains disclosed herein can further include a non-natural disulfide bond between HIV-1 Env positions 501 and 605 (if not already present on the ectodomain). For example, the non-natural disulfide bond can be introduced by including cysteine substitutions at positions 501 and 605. The presence of the non-natural disulfide bond between positions 501 and 605 contributes to the stabilization of the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0333] Any of the recombinant HIV-1 Env ectodomains disclosed herein can further include a proline residue at HIV-1 Env positions 559 (if not already present on the ectodomain). For example, the proline residue can be introduced at position 559 by amino acid substitution (such as an I559P substitution). The presence of the proline residue at position 559 contributes to the stabilization of the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0334] Any of the recombinant HIV-1 Env ectodomains disclosed herein can further include a non-natural disulfide bond between HIV-1 Env positions 501 and 605 and a proline residue at HIV-1 Env positions 559 (if not already present on the ectodomain). For example, the non-natural disulfide bond can be introduced by including cysteine substitutions at positions 501 and 605, and the proline residue can be introduced at position 559 by amino acid substitution (such as an I559P substitution). The presence of the non-natural disulfide bond between positions 501 and 605 and the proline residue at position 559 contributes to the stabilization of the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0335] Any of the recombinant HIV-1 Env ectodomains disclosed herein can be further modified to be a singly chain HIV-1 Env ectodomain including a 10 amino acid glycine serine linker between HIV-1 Env residues 507 and 512 (if the recombinant HIV-1 Env ectodomains is not already a single chain ectodomain).
[0336] Any of the recombinant HIV-1 Env ectodomains disclosed herein can be further modified to include the “R6” mutation, which provides six Arginine residues in place of the naïve furin cleavage site between gp120 and gp41.
[0337] Any of the soluble recombinant HIV-1 Env ectodomain trimers disclosed herein can include mutations to add a N-linked glycan sequon at position 504, position 661, or positions 504 and 661, to increase glycosylation of the membrane proximal region of the ectodomain.
[0338] Any of the recombinant HIV-1 Env ectodomain trimers disclosed herein that include a protease cleavage site between the gp120 and gp41 polypeptides can be modified to be a single chain HIV-1 Env ectodomain by mutation of the protease cleavage site for example by introducing a 10 amino acid linker connecting gp120 and gp41 or a 15 amino acid linker connecting g120 and gp41, for example as shown in SEQ ID NOs: 2158 (15 AA linker) and 2159 (10 AA linker).
[0339] In some embodiments, the recombinant HIV-1 Env ectodomain can comprise a circular permutant of the Env ectodomain. For example, the circular permutant can comprise, from N-terminus to C-terminus,
[0340] (A) the gp41 polypeptide and the gp120 polypeptide linked by a peptide linker or directly linked; or
[0341] (B) a first segment of the gp41 polypeptide comprising a α6 helix, a α7 helix, and/or a β27 strand of the prefusion mature closed conformation of the HIV-1 Env protein;
[0342] the gp120 polypeptide; and
[0343] a second segment of the gp41 polypeptide comprising the α8 helix and/or the α9 helix of the prefusion mature closed conformation, wherein
[0344] the first and second segments of the gp41 polypeptide are linked to the gp120 polypeptide by a peptide linker, or are directly linked to the gp120 polypeptide.
The recombinant HIV-1 Env ectodomain comprising the circular permutant of the Env ectodomain can further comprise any of the amino acid substitutions disclosed herein for stabilizing the HIV-1 Env ectodomain in the prefusion mature closed conformation, such as the DS-SOSIP substitutions.
C. V1V2V3 Immunogens
[0345] The V1, V2, and V3 domains of HIV-1 Env are located on the apex of the trimer in the prefusion mature closed conformation and include regions recognized by several neutralizing antibodies. Provided herein are immunogens that include these minimal domains of the HIV-1 Env protein in a format that maintains their structure in the prefusion mature closed conformation, and which are useful, for example, for inducing an immune response to HIV-1 Env. These immunogens are also useful for specific binding to antibodies that target the V1, V2, or V3 domains of HIV-1 Env, for example as probes to identify or detect such antibodies.
[0346] In several embodiments, the V1, V2, and V3 domains are included on a protein scaffold, such as a scaffold protein based on the 1VH8 protein (SEQ ID NO: 855), which is deposited in the Protein Data Bank as No. 1VH8, and incorporated by reference herein in its entirety. In another example, the “scaffold” can be any of the recombinant HIV-1 ectodomain trimers described herein, and the V1V2V3 immunogen can be included on the recombinant HIV-1 ectodomain trimer in place of the corresponding sequence of the HIV-1 ectodomain (e.g., the V1V2V3 immunogen can be “transplanted” on the recombinant HIV-1 ectodomain trimer). In some embodiments, the V1V2V3 scaffold protein comprises a circular permutant of the V1, V2, and V3 domains of HIV-1 linked to the 1VH8 protein. In some embodiments, the V1V2V3 scaffold protein comprises from N- to C-terminus: [0347] (1VH8 residues 36-159)-L.sub.1-(1VH8 residues 2-15)-L.sub.2-(V1V2 domain)-L.sub.3-(V3 domain)
In some embodiments, the V1V2 domain portion of the V1V2V3 scaffold protein can include HIV-1 Env residues 120-203. In some embodiments, the V3 domain portion of the V1V2V3 scaffold protein can be a circular permutant of the V3 domain including, from N- to C-terminus, [0348] (HIV-1 Env residues 317-330)-L.sub.4-(HIV-1 Env residues 297-314)
The linkers in the V1V2V3 scaffold protein are peptide linkers, for example glycine-serine linkers. In some embodiments, the L.sub.1 linker can include a GSG sequence, the L.sub.2 linker can include SEQ ID NO: 528 or SEQ ID NO: 854, the L.sub.3 linker can include SEQ ID NO: 319, and/or the L.sub.4 linker can include AA-GSG-A.
[0349] Exemplary V1V2V3 scaffold proteins are provided as SEQ ID NOs: 836-843. In some embodiments, the immunogen includes an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to any one of SEQ ID NOs: 836-843.
[0350] The V1V2V3 scaffold protein can include any of the stabilizing mutations described herein that include mutations to the V1, V2, and/or V3 domain to stabilize the V1, V2, and/or V3 domains in the prefusion mature closed conformation of the HIV-1 Env protein, for example the V1V2V3 scaffold protein can include cysteine substitutions at positions 174 and 319, or 175 and 320, which stabilize the V1, V2 and/or V3 domains in the prefusion mature closed conformation.
D. Protein Nanoparticles
[0351] In some embodiments a protein nanoparticle is provided that includes one or more of the disclosed recombinant HIV-1 Env ectodomains stabilized in a prefusion mature closed conformation, or an immunogenic fragment thereof. Such a protein nanoparticle can be specifically bound by one or more antibodies that specifically bind to the HIV-1 Env prefusion mature closed conformation, such as VRC26, PGT122, PGT145, and 35O22. Additionally, in several embodiments, the disclosed nanoparticles do not specifically bind to an antibody that specifically binds to HIV-1 Env in its CD4 bound conformation, but not to HIV-1 Env in its prefusion mature closed conformation. For example, the disclosed protein nanoparticles do not specifically bind to 17b antibody in the presence of a molar excess of CD4. Non-limiting example of nanoparticles include ferritin nanoparticles, an encapsulin nanoparticles, Sulfur Oxygenase Reductase (SOR) nanoparticles, and lumazine synthase nanoparticles, which are comprised of an assembly of monomeric subunits including ferritin proteins, encapsulin proteins, SOR proteins, and lumazine synthase respectively. Exemplary sequences of recombinant HIV-1 Env ectodomains linked to a nanoparticle subunit are provided under code F in the Table included in Table 13. To construct protein nanoparticles including a HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragment thereof, the HIV-1 Env protein or fragment can be linked to a subunit of the protein nanoparticle (such as a ferritin protein, an encapsulin protein, a SOR protein, or a lumazine synthase protein). The fusion protein self-assembles into a nanoparticle under appropriate conditions.
[0352] In several embodiments, the protein nanoparticle comprises two or more of the recombinant HIV-1 Env proteins, wherein the two or more recombinant HIV-1 Env proteins are from at least two different strains of HIV-1.
[0353] In some embodiments, the immunogen comprises a recombinant HIV-1 Env protein linked to a protein nanoparticle subunit, and comprises an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to the sequence set forth as one of 471-507, or 596-645, wherein the recombinant HIV-1 Env protein linked to the nanoparticle subunit can oligomerizes to form a functional protein nanoparticle including a recombinant HIV-1 Env ectodomain trimer (or immunogenic fragment thereof) in a prefusion mature closed conformation.
[0354] In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a ferritin subunit to construct a ferritin nanoparticle. Ferritin nanoparticles and their use for immunization purposes (e.g., for immunization against influenza antigens) have been disclosed in the art (see, e.g., Kanekiyo et al., Nature, 499:102-106, 2013, incorporated by reference herein in its entirety). Ferritin is a globular protein that is found in all animals, bacteria, and plants, and which acts primarily to control the rate and location of polynuclear Fe(III).sub.2O.sub.3 formation through the transportation of hydrated iron ions and protons to and from a mineralized core. The globular form of the ferritin nanoparticle is made up of monomeric subunits, which are polypeptides having a molecule weight of approximately 17-20 kDa. An example of the amino acid sequence of one such monomeric subunit is represented by SEQ ID NO: 575.
[0355] Each monomeric subunit has the topology of a helix bundle which includes a four antiparallel helix motif, with a fifth shorter helix (the c-terminal helix) lying roughly perpendicular to the long axis of the 4 helix bundle. According to convention, the helices are labeled ‘A, B, C, D & E’ from the N-terminus respectively. The N-terminal sequence lies adjacent to the capsid three-fold axis and extends to the surface, while the E helices pack together at the four-fold axis with the C-terminus extending into the capsid core. The consequence of this packing creates two pores on the capsid surface. It is expected that one or both of these pores represent the point by which the hydrated iron diffuses into and out of the capsid. Following production, these monomeric subunit proteins self-assemble into the globular ferritin protein. Thus, the globular form of ferritin comprises 24 monomeric, subunit proteins, and has a capsid-like structure having 432 symmetry. Methods of constructing ferritin nanoparticles are known to the person of ordinary skill in the art and are further described herein (see, e.g., Zhang, Int. J. Mol. Sci., 12:5406-5421, 2011, which is incorporated herein by reference in its entirety).
[0356] In specific examples, the ferritin polypeptide is E. coli ferritin, Helicobacter pylori ferritin, human light chain ferritin, bullfrog ferritin or a hybrid thereof, such as E. coli-human hybrid ferritin, E. coli-bullfrog hybrid ferritin, or human-bullfrog hybrid ferritin. Exemplary amino acid sequences of ferritin polypeptides and nucleic acid sequences encoding ferritin polypeptides for use to make a ferritin nanoparticle including a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof can be found in GENBANK®, for example at accession numbers ZP_03085328, ZP_06990637, EJB64322.1, AAA35832, NP_000137 AAA49532, AAA49525, AAA49524 and AAA49523, which are specifically incorporated by reference herein in their entirety as available Jun. 20, 2014. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a ferritin subunit including an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to amino acid sequence set forth as SEQ ID NO: 575.
[0357] Non-limiting examples of a recombinant HIV-1 Env ectodomains stabilized in a prefusion mature closed conformation or immunogenic fragments thereof linked to a ferritin subunit include the amino acid sequence set forth as any one of SEQ ID NO: 471, 473-475, 626-637, 797-802, 809-814, 821-835, 1099-1113, and 1201-1218.
[0358] In additional embodiments, any of the disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof can be linked to a lumazine synthase subunit to construct a lumazine synthase nanoparticle. The globular form of lumazine synthase nanoparticle is made up of monomeric subunits; an example of the sequence of one such monomeric subunit is provides as the amino acid sequence set forth as SEQ ID NO: 576.
[0359] In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a lumazine synthase subunit including an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to amino acid sequence set forth as SEQ ID NO: 576. Specific examples of a recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragments thereof linked to a lumazine synthase subunit is provided as the amino acid sequence set forth as SEQ ID NO: 472, 476-477, 638-645, 803-808, and 815-820.
[0360] In additional embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to an encapsulin subunit to construct an encapsulin nanoparticle. The globular form of the encapsulin nanoparticle is made up of monomeric subunits; an example of the sequence of one such monomeric subunit is provides as the amino acid sequence set forth as SEQ ID NO: 756.
[0361] In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to an encapsulin subunit including an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to amino acid sequence set forth as SEQ ID NO: 756.
[0362] Encapsulin proteins are a conserved family of bacterial proteins also known as linocin-like proteins that form large protein assemblies that function as a minimal compartment to package enzymes. The encapsulin assembly is made up of monomeric subunits, which are polypeptides having a molecule weight of approximately 30 kDa. Following production, the monomeric subunits self-assemble into the globular encapsulin assembly including 60 monomeric subunits. Methods of constructing encapsulin nanoparticles are known to the person of ordinary skill in the art, and further described herein (see, for example, Sutter et al., Nature Struct. and Mol. Biol., 15:939-947, 2008, which is incorporated by reference herein in its entirety). In specific examples, the encapsulin polypeptide is bacterial encapsulin, such as E. coli or Thermotoga maritime encapsulin.
[0363] In additional embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a Sulfer Oxygenase Reductase (SOR) subunit to construct a recombinant SOR nanoparticle. In some embodiments, the SOR subunit can include the amino acid sequence set forth as SEQ ID NO: 577.
[0364] In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a SOR subunit including an amino acid sequence at least 80% (such as at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to amino acid sequence set forth as SEQ ID NO: 577.
[0365] SOR proteins are microbial proteins (for example from the thermoacidophilic archaeon Acidianus ambivalens that form 24 subunit protein assemblies. Methods of constructing SOR nanoparticles are known to the person of ordinary skill in the art (see, e.g., Urich et al, Science, 311:996-1000, 2006, which is incorporated by reference herein in its entirety). An example of an amino acid sequence of a SOR protein for use to make SOR nanoparticles is set forth in Urich et al., Science, 311:996-1000, 2006, which is incorporated by reference herein in its entirety.
[0366] In some examples, the disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to the N- or C-terminus, or placed within an internal loop of a ferritin, encapsulin, SOR, or lumazine synthase subunit, for example with a linker, such as a Ser-Gly linker. When the constructs have been made in HEK 293 Freestyle cells, the fusion proteins are secreted from the cells and self-assembled into nanoparticles. The nanoparticles can be purified using known techniques, for example by a few different chromatography procedures, e.g. Mono Q (anion exchange) followed by size exclusion (SUPEROSE® 6) chromatography.
[0367] Several embodiments include a monomeric subunit of a ferritin, encapsulin, SOR, or lumazine synthase protein, or any portion thereof which is capable of directing self-assembly of monomeric subunits into the globular form of the protein. Amino acid sequences from monomeric subunits of any known ferritin, encapsulin, SOR, or lumazine synthase protein can be used to produce fusion proteins with the disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, so long as the monomeric subunit is capable of self-assembling into a nanoparticle displaying recombinant HIV-1 Env ectodomain or immunogenic fragment thereof on its surface.
[0368] The fusion proteins need not comprise the full-length sequence of a monomeric subunit polypeptide of a ferritin, encapsulin, SOR, or lumazine synthase protein. Portions, or regions, of the monomeric subunit polypeptide can be utilized so long as the portion comprises amino acid sequences that direct self-assembly of monomeric subunits into the globular form of the protein.
[0369] In some embodiments, it may be useful to engineer mutations into the amino acid sequence of the monomeric ferritin, encapsulin, SOR, or lumazine synthase subunits. For example, it may be useful to alter sites such as enzyme recognition sites or glycosylation sites in order to give the fusion protein beneficial properties (e.g., half-life).
[0370] It will be understood by those skilled in the art that fusion of any of the disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof to the ferritin, encapsulin, SOR, or lumazine synthase protein should be done such that the disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof does not interfere with self-assembly of the monomeric ferritin, encapsulin, SOR, or lumazine synthase subunits into the globular protein, and that the ferritin, encapsulin, SOR, or lumazine synthase subunits do not interfere with the ability of the disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof to elicit an immune response to HIV. In some embodiments, the ferritin, encapsulin, SOR, or lumazine synthase protein and disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof can be joined together directly without affecting the activity of either portion. In other embodiments, the ferritin, encapsulin, SOR, or lumazine synthase protein and the disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof can be joined using a linker (also referred to as a spacer) sequence. The linker sequence is designed to position the ferritin, encapsulin, SOR, or lumazine synthase portion of the fusion protein and the recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragments thereof can be linked to an portion of the fusion protein, with regard to one another, such that the fusion protein maintains the ability to assemble into nanoparticles, and also elicit an immune response to HIV. In several embodiments, the linker sequences comprise amino acids. Preferable amino acids to use are those having small side chains and/or those which are not charged. Such amino acids are less likely to interfere with proper folding and activity of the fusion protein. Accordingly, preferred amino acids to use in linker sequences, either alone or in combination are serine, glycine and alanine. One example of such a linker sequence is SGG. Amino acids can be added or subtracted as needed. Those skilled in the art are capable of determining appropriate linker sequences for construction of protein nanoparticles.
[0371] The disclosed recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation or immunogenic fragments thereof can be linked to ferritin, encapsulin, SOR, or lumazine synthase subunits can self-assemble into multi-subunit protein nanoparticles, termed ferritin nanoparticles, encapsulin nanoparticles, SOR nanoparticles, and lumazine synthase nanoparticles, respectively. The nanoparticles including a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof have substantially the same structural characteristics as the native ferritin, encapsulin, SOR, or lumazine synthase nanoparticles that do not include the disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof. That is, they contain 24, 60, 24, or 60 subunits (respectively) and have similar corresponding symmetry.
[0372] Additional sequences of recombinant HIV-1 Env proteins as disclosed herein linked to a protein nanoparticle subunit are provided as SEQ ID NOs: 478-507.
[0373] In some embodiments, the recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to Escherichia coli enzyme 2-hydroxypentadienoic acid hydratase subunit (see Montgomery et al, J. Mol. Biol. 396: 1379-1391, 2010), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2101 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a cocksfoot mottle virus coat protein subunit (see Tars et al., Virology 310: 287-297, 2003), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2102 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a Rice yellow mottle virus capsid protein subunit (see Qu et al., Structure Fold. Des. 8: 1095-1103, 2000), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2103 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a sesbania mosaic virus coat protein subunit (see Bhuvaneshwari et al., Structure 3: 1021-1030, 1995), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2104 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a tomato bushy stunt virus coat protein subunit (see Hopper et al., J. Mol. Biol. 177: 701-713, 1984), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2105 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a phage MS2 protein capsid subunit (see van den Worm et al., Nucleic Acids Res. 26: 1345-1351, 1998), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2106 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to bacteriophage fr capsid subunit (see Liljas et al., J. Mol. Biol. 244: 279-290, 1994), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2107 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a bacteriophage phiCb5 coat protein subunit (see Plevka et al., J. Mol. Biol. 391: 635-647, 2009), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2108 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a HK97 bacteriophage capsid subunit (see Helgstrand et al., J. Mol. Biol. 334: 885, 2003), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2109 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a bacteriophage GA protein capsid subunit (see Tars et al., J. Mol. Biol. 271: 759-773, 1997), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2110 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a bacteriophage PRR1 coat protein subunit (see Persson et al., J. Mol. Biol. 383: 914, 2008), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2111 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a bacteriophage PP7 coat protein subunit (see Tars et al., Acta Crystallogr., Sect. D 56: 398, 2000), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2112 or a fragment thereof. In some embodiments, a disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or immunogenic fragment thereof can be linked to a bacteriophage Q beta capsid subunit (see Golmohammadi et al., Structure 4: 543-554, 1996), which can include, for example, the amino acid sequence set forth as SEQ ID NO: 2113 or a fragment thereof.
E. Polynucleotides and Expression
[0374] Polynucleotides encoding a disclosed immunogen (e.g., a HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation, or an immunogenic fragment thereof), or protein nanoparticles (or a subunit thereof) or vectors, disclosed herein are also provided. These polynucleotides include DNA, cDNA and RNA sequences which encode the antigen. One of skill in the art can readily use the genetic code to construct a variety of functionally equivalent nucleic acids, such as nucleic acids which differ in sequence but which encode the same antibody sequence, or encode a conjugate or fusion protein including the nucleic acid sequence.
[0375] In a non-limiting example, a polynucleotide sequence set forth as SEQ ID NO: 757, which encodes the single chain HIV-1 Env set forth as SEQ ID NO: 352. In another example, a polynucleotide sequence set forth as SEQ ID NO: 2119, which encodes the BG505.SOSIP.R6.664.T332N_I201C/A433C HIV-1 Env set forth as SEQ ID NO: 26. For reference, native BG505 DNA sequence is provided as SEQ ID NO: 2120.
[0376] In several embodiments, the nucleic acid molecule encodes a precursor of a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, that, when expressed in an appropriate cell, is processed into a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof. For example, the nucleic acid molecule can encode a recombinant HIV-1 Env ectodomain including a N-terminal signal sequence for entry into the cellular secretory system that is proteolytically cleaved in the during processing of the HIV-1 Env protein in the cell. In some embodiments, the signal peptide includes the amino acid sequence set forth as residues 1-30 of SEQ ID NO: 2.
[0377] Exemplary nucleic acids can be prepared by cloning techniques. Examples of appropriate cloning and sequencing techniques, and instructions sufficient to direct persons of skill through many cloning exercises are known (see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4.sup.th ed, Cold Spring Harbor, N.Y., 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013). Product information from manufacturers of biological reagents and experimental equipment also provide useful information. Such manufacturers include the SIGMA Chemical Company (Saint Louis, Mo.), R&D Systems (Minneapolis, Minn.), Pharmacia Amersham (Piscataway, N.J.), CLONTECH Laboratories, Inc. (Palo Alto, Calif.), Chem Genes Corp., Aldrich Chemical Company (Milwaukee, Wis.), Glen Research, Inc., GIBCO BRL Life Technologies, Inc. (Gaithersburg, Md.), Fluka Chemica-Biochemika Analytika (Fluka Chemie AG, Buchs, Switzerland), Invitrogen (Carlsbad, Calif.), and Applied Biosystems (Foster City, Calif.), as well as many other commercial sources known to one of skill.
[0378] Nucleic acids can also be prepared by amplification methods. Amplification methods include polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), the self-sustained sequence replication system (3SR). A wide variety of cloning methods, host cells, and in vitro amplification methodologies are well known to persons of skill.
[0379] The polynucleotides encoding a recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation, fragments thereof, and protein nanoparticles (or a subunit thereof) can include a recombinant DNA which is incorporated into a vector into an autonomously replicating plasmid or virus or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (such as a cDNA) independent of other sequences. The nucleotides can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide. The term includes single and double forms of DNA.
[0380] Polynucleotide sequences encoding recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation, fragments thereof, and protein nanoparticles (or a subunit thereof) can be operatively linked to expression control sequences. An expression control sequence operatively linked to a coding sequence is ligated such that expression of the coding sequence is achieved under conditions compatible with the expression control sequences. The expression control sequences include, but are not limited to, appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons.
[0381] DNA sequences encoding the recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation, fragments thereof, and protein nanoparticles (or a subunit thereof) can be expressed in vitro by DNA transfer into a suitable host cell. The cell may be prokaryotic or eukaryotic. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Methods of stable transfer, meaning that the foreign DNA is continuously maintained in the host, are known in the art.
[0382] Hosts can include microbial, yeast, insect and mammalian organisms. Methods of expressing DNA sequences having eukaryotic or viral sequences in prokaryotes are well known in the art. Non-limiting examples of suitable host cells include bacteria, archea, insect, fungi (for example, yeast), plant, and animal cells (for example, mammalian cells, such as human). Exemplary cells of use include Escherichia coli, Bacillus subtilis, Saccharomyces cerevisiae, Salmonella typhimurium, SF9 cells, C129 cells, 293 cells, Neurospora, and immortalized mammalian myeloid and lymphoid cell lines. Techniques for the propagation of mammalian cells in culture are well-known (see, e.g., Helgason and Miller (Eds.), 2012, Basic Cell Culture Protocols (Methods in Molecular Biology), 4.sup.th Ed., Humana Press). Examples of commonly used mammalian host cell lines are VERO and HeLa cells, CHO cells, and W138, BHK, and COS cell lines, although cell lines may be used, such as cells designed to provide higher expression, desirable glycosylation patterns, or other features. In some embodiments, the host cells include HEK293 cells or derivatives thereof, such as GnTI.sup.4− cells (ATCC® No. CRL-3022), or HEK-293F cells.
[0383] Transformation of a host cell with recombinant DNA can be carried out by conventional techniques as are well known to those skilled in the art. Where the host is prokaryotic, such as, but not limited to, E. coli, competent cells which are capable of DNA uptake can be prepared from cells harvested after exponential growth phase and subsequently treated by the CaCl.sub.2 method using procedures well known in the art. Alternatively, MgCl.sub.2 or RbCl can be used. Transformation can also be performed after forming a protoplast of the host cell if desired, or by electroporation.
[0384] When the host is a eukaryote, such methods of transfection of DNA as calcium phosphate coprecipitates, conventional mechanical procedures such as microinjection, electroporation, insertion of a plasmid encased in liposomes, or viral vectors can be used. Eukaryotic cells can also be co-transformed with polynucleotide sequences encoding a disclosed antigen, and a second foreign DNA molecule encoding a selectable phenotype, such as the herpes simplex thymidine kinase gene. Another method is to use a eukaryotic viral vector, such as simian virus 40 (SV40) or bovine papilloma virus, to transiently infect or transform eukaryotic cells and express the protein (see for example, Viral Expression Vectors, Springer press, Muzyczka ed., 2011). One of skill in the art can readily use an expression systems such as plasmids and vectors of use in producing proteins in cells including higher eukaryotic cells such as the COS, CHO, HeLa and myeloma cell lines.
[0385] In one non-limiting example, a disclosed immunogen is expressed using the pVRC8400 vector (described in Barouch et al., J. Virol, 79, 8828-8834, 2005, which is incorporated by reference herein).
[0386] Modifications can be made to a nucleic acid encoding a recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation, fragment thereof, and protein nanoparticle (or a subunit thereof) described herein without diminishing its biological activity. Some modifications can be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, termination codons, a methionine added at the amino terminus to provide an initiation, site, additional amino acids placed on either terminus to create conveniently located restriction sites, or additional amino acids (such as poly His) to aid in purification steps.
[0387] In addition to recombinant methods, the recombinant HIV-1 Env proteins stabilized in a prefusion mature closed conformation, fragments thereof, and protein nanoparticles (or a subunit thereof) can also be constructed in whole or in part using protein synthesis methods known in the art.
F. Virus-Like Particles
[0388] In some embodiments, a virus-like particle (VLP) is provided that includes a disclosed immunogen (e.g., a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof). VLPs lack the viral components that are required for virus replication and thus represent a highly attenuated form of a virus. The VLP can display a polypeptide (e.g., a recombinant HIV-1 Env protein) that is capable of eliciting an immune response to HIV when administered to a subject. Virus like particles and methods of their production are known and familiar to the person of ordinary skill in the art, and viral proteins from several viruses are known to form VLPs, including human papillomavirus, HIV (Kang et al., Biol. Chem. 380: 353-64 (1999)), Semliki-Forest virus (Notka et al., Biol. Chem. 380: 341-52 (1999)), human polyomavirus (Goldmann et al., J. Virol. 73: 4465-9 (1999)), rotavirus (Jiang et al., Vaccine 17: 1005-13 (1999)), parvovirus (Casal, Biotechnology and Applied Biochemistry, Vol 29, Part 2, pp 141-150 (1999)), canine parvovirus (Hurtado et al., J. Virol. 70: 5422-9 (1996)), hepatitis E virus (Li et al., J. Virol. 71: 7207-13 (1997)), and Newcastle disease virus. The formation of such VLPs can be detected by any suitable technique. Examples of suitable techniques known in the art for detection of VLPs in a medium include, e.g., electron microscopy techniques, dynamic light scattering (DLS), selective chromatographic separation (e.g., ion exchange, hydrophobic interaction, and/or size exclusion chromatographic separation of the VLPs) and density gradient centrifugation.
[0389] The virus like particle can include any of the recombinant HIV-1 Env ectodomain trimers or immunogenic fragments thereof, that are disclosed herein. For example, the virus like particle can include the recombinant HIV-1 Env ectodomain trimer or immunogenic fragments thereof, of any of claims X-Y included in the claim set below. Embodiments concerning the virus-like particles are further described in Clauses 1-16, below.
[0390] Clause 1. A virus like particle comprising the recombinant HIV-1 Env ectodomain trimer or immunogenic fragment thereof of any one of claims 1-67;
[0391] particularly wherein the recombinant HIV-1 Env ectodomain trimer or immunogenic fragment thereof is linked to a transmembrane domain;
[0392] particularly wherein the recombinant HIV-1 Env ectodomain trimer comprises DS and SOS substitutions as described herein;
[0393] particularly wherein the recombinant HIV-1 Env ectodomain trimer is a chimeric HIV-1 Env trimer comprising a BG505 “platform” as described herein, a V1V2 domain from a CAP256.SU (SEQ ID NO: 51), a BB201.B42 (SEQ ID NO: 81), a KER2018.11 (SEQ ID NO: 107), a CH070.1 (SEQ ID NO: 174), a ZM233.6 (SEQ ID NO: 745), a Q23.17 (SEQ ID NO: 746), a A244 (SEQ ID NO: 747), a T250-4 (SEQ ID NO: 2114), or a WITO.33 (SEQ ID NO: 748) strain of HIV-1, with the remainder of the HIV-1 Env ectodomain based on Env from a 45_01dG5 Env or a 426c Env that further comprises amino acid substitutions to remove the N-linked glycan sequons at positions 276, 460, 463.
[0394] Clause 2. An isolated nucleic acid molecule encoding the virus like particle of clause 1.
[0395] Clause 3. The nucleic acid molecule of clause 2, wherein the nucleic acid molecule encodes a precursor protein of the gp120/gp41 protomers in the recombinant HIV-1 Env ectodomain trimer.
[0396] Clause 4. The nucleic acid molecule of clause 2 or clause 3, operably linked to a promoter.
[0397] Clause 5. A vector comprising the nucleic acid molecule of clause 4.
[0398] Clause 6. An isolated host cell comprising the vector of clause 5.
[0399] Clause 7. The virus-like particle of any one of the prior clauses, wherein administration of an effective amount of the virus like particle induces a neutralizing immune response to HIV-1 Env in the subject.
[0400] Clause 8. An immunogenic composition comprising an effective amount of the virus like particle of any one of the prior clauses, and a pharmaceutically acceptable carrier.
[0401] Clause 9. The immunogenic composition of clause 8, further comprising an adjuvant.
[0402] Clause 10. A method for generating an immune response to Human Immunodeficiency Virus type 1 (HIV-1) gp120 in a subject, comprising administering to the subject an effective amount of the immunogenic composition of clause 9 or clause 10, thereby generating the immune response.
[0403] Clause 11. A method for treating or preventing a Human Immunodeficiency Virus type 1 (HIV-1) infection in a subject, comprising administering to the subject a therapeutically effective amount of the immunogenic composition of clause 9 or clause 10, thereby treating the subject or preventing HIV-1 infection of the subject.
[0404] Clause 12. The method of clause 10 clause 11, comprising a prime-boost administration of the immunogenic composition.
[0405] Clause 13. The method of any of clauses 10-12, wherein the subject is at risk of or has an HIV-1 infection.
[0406] Clause 14. A kit comprising the virus like particle, nucleic acid molecule, vector, or composition, of any of clauses 1-9, and instructions for using the kit.
[0407] Clause 15. Use of the virus like particle, nucleic acid molecule, vector, or composition of any of clauses 1-9, to inhibit or prevent HIV-1 infection in a subject.
[0408] Clause 16. Use of the virus like particle, nucleic acid molecule, vector, or composition of any of clauses 1-9, to induce an immune response to HIV-1 Env in a subject.
G. Viral Vectors
[0409] The nucleic acid molecules encoding the disclosed immunogens (e.g., a recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation or an immunogenic fragment thereof) can be included in a viral vector, for example for expression of the antigen in a host cell, or for immunization of a subject as disclosed herein. In some embodiments, the viral vectors are administered to a subject as part of a prime-boost vaccination. In several embodiments, the viral vectors are included in a vaccine, such as a primer vaccine or a booster vaccine for use in a prime-boost vaccination.
[0410] In several examples, the viral vector can be replication-competent. For example, the viral vector can have a mutation in the viral genome that does not inhibit viral replication in host cells. The viral vector also can be conditionally replication-competent. In other examples, the viral vector is replication-deficient in host cells.
[0411] A number of viral vectors have been constructed, that can be used to express the disclosed antigens, including polyoma, i.e., SV40 (Madzak et al., 1992, J. Gen. Virol., 73:15331536), adenovirus (Berkner, 1992, Cur. Top. Microbiol. Immunol., 158:39-6; Berliner et al., 1988, Bio Techniques, 6:616-629; Gorziglia et al., 1992, J. Virol., 66:4407-4412; Quantin et al., 1992, Proc. Natl. Acad. Sci. USA, 89:2581-2584; Rosenfeld et al., 1992, Cell, 68:143-155; Wilkinson et al., 1992, Nucl. Acids Res., 20:2233-2239; Stratford-Perricaudet et al., 1990, Hum. Gene Ther., 1:241-256), vaccinia virus (Mackett et al., 1992, Biotechnology, 24:495-499), adeno-associated virus (Muzyczka, 1992, Curr. Top. Microbiol. Immunol., 158:91-123; On et al., 1990, Gene, 89:279-282), herpes viruses including HSV and EBV (Margolskee, 1992, Curr. Top. Microbiol. Immunol., 158:67-90; Johnson et al., 1992, J. Virol., 66:29522965; Fink et al., 1992, Hum. Gene Ther. 3:11-19; Breakfield et al., 1987, Mol. Neurobiol., 1:337-371; Fresse et al., 1990, Biochem. Pharmacol., 40:2189-2199), Sindbis viruses (H. Herweijer et al., 1995, Human Gene Therapy 6:1161-1167; U.S. Pat. Nos. 5,091,309 and 5,2217,879), alphaviruses (S. Schlesinger, 1993, Trends Biotechnol. 11:18-22; I. Frolov et al., 1996, Proc. Natl. Acad. Sci. USA 93:11371-11377) and retroviruses of avian (Brandyopadhyay et al., 1984, Mol. Cell Biol., 4:749-754; Petropouplos et al., 1992, J. Virol., 66:3391-3397), murine (Miller, 1992, Curr. Top. Microbiol. Immunol., 158:1-24; Miller et al., 1985, Mol. Cell Biol., 5:431-437; Sorge et al., 1984, Mol. Cell Biol., 4:1730-1737; Mann et al., 1985, J. Virol., 54:401-407), and human origin (Page et al., 1990, J. Virol., 64:5370-5276; Buchschalcher et al., 1992, J. Virol., 66:2731-2739). Baculovirus (Autographa californica multinuclear polyhedrosis virus; AcMNPV) vectors are also known in the art, and may be obtained from commercial sources (such as PharMingen, San Diego, Calif.; Protein Sciences Corp., Meriden, Conn.; Stratagene, La Jolla, Calif.).
[0412] In several embodiments, the viral vector can include an adenoviral vector that expresses a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof. Adenovirus from various origins, subtypes, or mixture of subtypes can be used as the source of the viral genome for the adenoviral vector. Non-human adenovirus (e.g., simian, chimpanzee, gorilla, avian, canine, ovine, or bovine adenoviruses) can be used to generate the adenoviral vector. For example, a simian adenovirus can be used as the source of the viral genome of the adenoviral vector. A simian adenovirus can be of serotype 1, 3, 7, 11, 16, 18, 19, 20, 27, 33, 38, 39, 48, 49, 50, or any other simian adenoviral serotype. A simian adenovirus can be referred to by using any suitable abbreviation known in the art, such as, for example, SV, SAdV, SAV or sAV. In some examples, a simian adenoviral vector is a simian adenoviral vector of serotype 3, 7, 11, 16, 18, 19, 20, 27, 33, 38, or 39. In one example, a chimpanzee serotype C Ad3 vector is used (see, e.g., Peruzzi et al., Vaccine, 27:1293-1300, 2009). Human adenovirus can be used as the source of the viral genome for the adenoviral vector. Human adenovirus can be of various subgroups or serotypes. For instance, an adenovirus can be of subgroup A (e.g., serotypes 12, 18, and 31), subgroup B (e.g., serotypes 3, 7, 11, 14, 16, 21, 34, 35, and 50), subgroup C (e.g., serotypes 1, 2, 5, and 6), subgroup D (e.g., serotypes 8, 9, 10, 13, 15, 17, 19, 20, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 36-39, and 42-48), subgroup E (e.g., serotype 4), subgroup F (e.g., serotypes 40 and 41), an unclassified serogroup (e.g., serotypes 49 and 51), or any other adenoviral serotype. The person of ordinary skill in the art is familiar with replication competent and deficient adenoviral vectors (including singly and multiply replication deficient adenoviral vectors). Examples of replication-deficient adenoviral vectors, including multiply replication-deficient adenoviral vectors, are disclosed in U.S. Pat. Nos. 5,837,511; 5,851,806; 5,994,106; 6,127,175; 6,482,616; and 7,195,896, and International Patent Application Nos. WO 94/28152, WO 95/02697, WO 95/16772, WO 95/34671, WO 96/22378, WO 97/12986, WO 97/21826, and WO 03/022311.
H. Neutralizing Immune Response
[0413] A disclosed recombinant HIV-1 Env ectodomain stabilized in a prefusion mature closed conformation, or immunogenic fragment thereof, can be used to elicit a neutralizing immune response to HIV-1 in a subject. In several such embodiments, induction of the immune response includes production of neutralizing antibodies to HIV-1.
[0414] In several embodiments, following immunization of a subject with a disclosed immunogen (e.g., as described herein) serum can be collected from the subject at appropriate time points, frozen, and stored for neutralization testing. Methods to assay for neutralization activity are known to the person of ordinary skill in the art and are further described herein, and include, but are not limited to, plaque reduction neutralization (PRNT) assays, microneutralization assays, flow cytometry based assays, single-cycle infection assays (e.g., as described in Martin et al (2003) Nature Biotechnology 21:71-76), and pseudovims neutralization assays (e.g., as described in Georgiev et al. (Science, 340, 751-756, 2013), Seaman et al. (J. Virol., 84, 1439-1452, 2005), and Mascola et al. (J. Virol., 79, 10103-10107, 2005), each of which is incorporated by reference herein in its entirety.
[0415] In some embodiments, the serum neutralization activity can be assayed using a panel of HIV-1 pseudovimses as described in Georgiev et al., Science, 340, 751-756, 2013 or Seaman et al. J. Virol., 84, 1439-1452, 2005. Briefly, pseudovirus stocks are prepared by co-transfection of 293T cells with an HIV-1 Env-deficient backbone and an expression plasmid encoding the Env gene of interest. The serum to be assayed is diluted in Dulbecco's modified Eagle medium-10% FCS (Gibco) and mixed with pseudovirus. After 30 min, 10,000 TZM-bl cells are added, and the plates are incubated for 48 hours. Assays are developed with a luciferase assay system (Promega, Madison, Wis.), and the relative light units (RLU) are read on a luminometer (Perkin-Elmer, Waltham, Mass.). To account for background, a cutoff of ID.sub.50≥40 can be used as a criterion for the presence of serum neutralization activity against a given pseudovirus.
[0416] In some embodiments, administration of a therapeutically effective amount of one or more of the disclosed immunogens to a subject (e.g., by a prime-boost administration of a DNA vector encoding a disclosed immunogen (prime) followed by a protein nanoparticle including a disclosed immunogen (boost)) induces a neutralizing immune response in the subject. In several embodiments, the neutralizing immune response can be detected using a pseudovirus neutralization assay against a panel of HIV-1 pseudoviruses including HIV-1 Env proteins from different HIV-1 strains. In one example, the panel can include pseudoviruses including Env proteins from HIV-1 strains from Clade A (KER2018.11, Q23.17, Q168.a2, Q769.h5, and RW020.2), Clade B (BaL.01, 6101.10, BG1168.01, CAAN.A2, JR-FL, JR-CSF.JB, PVO.4, THR04156.18, TRJ04551.58, TRO.11, and YU2), and Clade C (DU156.12, DU422.01, ZAO12.29, ZM55.28a, and ZM106.9). In other examples, the panel can include pseudoviruses including Env proteins from the HIV-1 strains listed in Table S5 or Table S6 of Georgiev et al. (Science, 340, 751-756, 2013, which is incorporated by reference herein in its entirety), or Table 1 of Seaman et al. (J. Virol., 84, 1439-1452, 2005, which is incorporated by reference herein in its entirety).
[0417] In some embodiments, administration of a therapeutically effective amount of one or more of the disclosed immunogen to a subject (e.g., by a prime-boost administration of a DNA vector encoding a disclosed immunogen (prime) followed by a protein nanoparticle including a disclosed immunogen (boost)) induces a neutralizing immune response in the subject, wherein serum from the subject neutralizes, with an ID.sub.50≥40, at least 30% (such as at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%) of pseudoviruses is a panel of pseudovimses including the HIV-1 Env proteins listed in Table S5 or Table S6 of Georgiev et al. (Science, 340, 751-756, 2013), or Table 1 of Seaman et al. (J. Virol., 84, 1439-1452, 2005) or including Env proteins from HIV-1 strains from Clade A (KER2018.11, Q23.17, Q168.a2, Q769.h5, and RW020.2), Clade B (BaL.01, 6101.10, BG1168.01, CAAN.A2, JR-FL, JR-CSF.JB, PVO.4, THR04156.18, TRJ04551.58, TRO.11, and YU2), and Clade C (DU156.12, DU422.01, ZA012.29, ZM55.28a, and ZM106.9).
[0418] In additional embodiments, administration of a therapeutically effective amount of one or more of the disclosed immunogen to a subject (e.g., by a prime-boost administration of a DNA vector encoding a disclosed immunogen (prime) followed by a protein nanoparticle including a disclosed immunogen (boost)) induces a neutralizing immune response in the subject, wherein serum from the subject neutralizes, with an ID.sub.50≥40, at least 30% (such as at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%) of pseudoviruses is a panel of pseudoviruses including the Clade A, Clade B, or Clade C HIV-1 Env proteins listed in Table S5 or Table S6 of Georgiev et al. (Science, 340, 751-756, 2013), or Table 1 of Seaman et al. (J. Virol., 84, 1439-1452, 2005) or including Env proteins from HIV-1 strains from Clade A (KER2018.11, Q23.17, Q168.a2, Q769.h5, and RW020.2), Clade B (BaL.01, 6101.10, BG1168.01, CAAN.A2, JR-FL, JR-CSF.JB, PVO.4, THR04156.18, TRJO4551.58, TRO.11, and YU2), and Clade C (DU156.12, DU422.01, ZA012.29, ZM55.28a, and ZM106.9).
I. Compositions
[0419] The disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen, can be included in a pharmaceutical composition (including therapeutic and prophylactic formulations), often combined together with one or more pharmaceutically acceptable vehicles and, optionally, other therapeutic ingredients (for example, antibiotics or antiviral drugs). In several embodiments, pharmaceutical compositions including one or more of the disclosed immunogens are immunogenic compositions.
[0420] Such pharmaceutical compositions can be administered to subjects by a variety of administration modes known to the person of ordinary skill in the art, for example, intramuscular, subcutaneous, intravenous, intra-arterial, intra-articular, intraperitoneal, or parenteral routes.
[0421] To formulate the pharmaceutical compositions, the disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen, can be combined with various pharmaceutically acceptable additives, as well as a base or vehicle for dispersion of the conjugate. Desired additives include, but are not limited to, pH control agents, such as arginine, sodium hydroxide, glycine, hydrochloric acid, citric acid, and the like. In addition, local anesthetics (for example, benzyl alcohol), isotonizing agents (for example, sodium chloride, mannitol, sorbitol), adsorption inhibitors (for example, TWEEN® 80), solubility enhancing agents (for example, cyclodextrins and derivatives thereof), stabilizers (for example, serum albumin), and reducing agents (for example, glutathione) can be included. Adjuvants, such as aluminum hydroxide (ALHYDROGEL®, available from Brenntag Biosector, Copenhagen, Denmark and AMPHOGEL®, Wyeth Laboratories, Madison, N.J.), Freund's adjuvant, MPL™ (3-O-deacylated monophosphoryl lipid A; Corixa, Hamilton, Ind.) and IL-12 (Genetics Institute, Cambridge, Mass.), among many other suitable adjuvants well known in the art, can be included in the compositions.
[0422] When the composition is a liquid, the tonicity of the formulation, as measured with reference to the tonicity of 0.9% (w/v) physiological saline solution taken as unity, is typically adjusted to a value at which no substantial, irreversible tissue damage will be induced at the site of administration. Generally, the tonicity of the solution is adjusted to a value of about 0.3 to about 3.0, such as about 0.5 to about 2.0, or about 0.8 to about 1.7.
[0423] The disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen can be dispersed in a base or vehicle, which can include a hydrophilic compound having a capacity to disperse the antigens, and any desired additives. The base can be selected from a wide range of suitable compounds, including but not limited to, copolymers of polycarboxylic acids or salts thereof, carboxylic anhydrides (for example, maleic anhydride) with other monomers (for example, methyl (meth)acrylate, acrylic acid and the like), hydrophilic vinyl polymers, such as polyvinyl acetate, polyvinyl alcohol, polyvinylpyrrolidone, cellulose derivatives, such as hydroxymethylcellulose, hydroxypropylcellulose and the like, and natural polymers, such as chitosan, collagen, sodium alginate, gelatin, hyaluronic acid, and nontoxic metal salts thereof. Often, a biodegradable polymer is selected as a base or vehicle, for example, polylactic acid, poly(lactic acid-glycolic acid) copolymer, polyhydroxybutyric acid, poly(hydroxybutyric acid-glycolic acid) copolymer and mixtures thereof. Alternatively or additionally, synthetic fatty acid esters such as polyglycerin fatty acid esters, sucrose fatty acid esters and the like can be employed as vehicles. Hydrophilic polymers and other vehicles can be used alone or in combination, and enhanced structural integrity can be imparted to the vehicle by partial crystallization, ionic bonding, cross-linking and the like. The vehicle can be provided in a variety of forms, including fluid or viscous solutions, gels, pastes, powders, microspheres and films, for examples for direct application to a mucosal surface.
[0424] The disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen can be combined with the base or vehicle according to a variety of methods, and release of the antigens can be by diffusion, disintegration of the vehicle, or associated formation of water channels. In some circumstances, the disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen is dispersed in microcapsules (microspheres) or nanocapsules (nanospheres) prepared from a suitable polymer, for example, isobutyl 2-cyanoacrylate (see, for example, Michael et al., J. Pharmacy Pharmacol. 43:1-5, 1991), and dispersed in a biocompatible dispersing medium, which yields sustained delivery and biological activity over a protracted time.
[0425] The pharmaceutical compositions of the disclosure can alternatively contain as pharmaceutically acceptable vehicles substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, and triethanolamine oleate. For solid compositions, conventional nontoxic pharmaceutically acceptable vehicles can be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
[0426] Pharmaceutical compositions for administering the immunogenic compositions can also be formulated as a solution, microemulsion, or other ordered structure suitable for high concentration of active ingredients. The vehicle can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like), and suitable mixtures thereof. Proper fluidity for solutions can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of a desired particle size in the case of dispersible formulations, and by the use of surfactants. In many cases, it will be desirable to include isotonic agents, for example, sugars, polyalcohols, such as mannitol and sorbitol, or sodium chloride in the composition. Prolonged absorption of the disclosed antigens can be brought about by including in the composition an agent which delays absorption, for example, monostearate salts and gelatin.
[0427] In certain embodiments, the disclosed immunogens (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen can be administered in a time-release formulation, for example in a composition that includes a slow release polymer. These compositions can be prepared with vehicles that will protect against rapid release, for example a controlled release vehicle such as a polymer, microencapsulated delivery system or bioadhesive gel. Prolonged delivery in various compositions of the disclosure can be brought about by including in the composition agents that delay absorption, for example, aluminum monostearate hydrogels and gelatin. When controlled release formulations are desired, controlled release binders suitable for use in accordance with the disclosure include any biocompatible controlled release material which is inert to the active agent and which is capable of incorporating the disclosed antigen and/or other biologically active agent. Numerous such materials are known in the art. Useful controlled-release binders are materials that are metabolized slowly under physiological conditions following their delivery (for example, at a mucosal surface, or in the presence of bodily fluids). Appropriate binders include, but are not limited to, biocompatible polymers and copolymers well known in the art for use in sustained release formulations. Such biocompatible compounds are non-toxic and inert to surrounding tissues, and do not trigger significant adverse side effects, such as nasal irritation, immune response, inflammation, or the like. They are metabolized into metabolic products that are also biocompatible and easily eliminated from the body. Numerous systems for controlled delivery of therapeutic proteins are known (e.g., U.S. Pat. Nos. 5,055,303; 5,188,837; 4,235,871; 4,501,728; 4,837,028; 4,957,735; and 5,019,369; 5,055,303; 5,514,670; 5,413,797; 5,268,164; 5,004,697; 4,902,505; 5,506,206; 5,271,961; 5,254,342; and 5,534,496).
[0428] Exemplary polymeric materials for use in the present disclosure include, but are not limited to, polymeric matrices derived from copolymeric and homopolymeric polyesters having hydrolyzable ester linkages. A number of these are known in the art to be biodegradable and to lead to degradation products having no or low toxicity. Exemplary polymers include polyglycolic acids and polylactic acids, poly(DL-lactic acid-co-glycolic acid), poly(D-lactic acid-co-glycolic acid), and poly(L-lactic acid-co-glycolic acid). Other useful biodegradable or bioerodable polymers include, but are not limited to, such polymers as poly(epsilon-caprolactone), poly(epsilon-aprolactone-CO-lactic acid), poly(epsilon.-aprolactone-CO-glycolic acid), poly(beta-hydroxy butyric acid), poly(alkyl-2-cyanoacrilate), hydrogels, such as poly(hydroxyethyl methacrylate), polyamides, poly(amino acids) (for example, L-leucine, glutamic acid, L-aspartic acid and the like), poly(ester urea), poly(2-hydroxyethyl DL-aspartamide), polyacetal polymers, polyorthoesters, polycarbonate, polymaleamides, polysaccharides, and copolymers thereof. Many methods for preparing such formulations are well known to those skilled in the art (see, for example, Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978). Other useful formulations include controlled-release microcapsules (U.S. Pat. Nos. 4,652,441 and 4,917,893), lactic acid-glycolic acid copolymers useful in making microcapsules and other formulations (U.S. Pat. Nos. 4,677,191 and 4,728,721) and sustained-release compositions for water-soluble peptides (U.S. Pat. No. 4,675,189).
[0429] The pharmaceutical compositions of the disclosure typically are sterile and stable under conditions of manufacture, storage and use. Sterile solutions can be prepared by incorporating the conjugate in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the disclosed antigen and/or other biologically active agent into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein. In the case of sterile powders, methods of preparation include vacuum drying and freeze-drying which yields a powder of the disclosed antigen plus any additional desired ingredient from a previously sterile-filtered solution thereof. The prevention of the action of microorganisms can be accomplished by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
[0430] Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remingtons Pharmaceutical Sciences, 19.sup.th Ed., Mack Publishing Company, Easton, Pa., 1995.
[0431] In several embodiments, the compositions include an adjuvant. The person of ordinary skill in the art is familiar with adjuvants, for example, those that can be included in an immunogenic composition. It will be appreciated that the choice of adjuvant can be different in these different applications, and the optimal adjuvant and concentration for each situation can be determined empirically by those of skill in the art.
[0432] The pharmaceutical composition typically contains a therapeutically effective amount of a disclosed immunogen (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen, or viral vector can be prepared by conventional techniques. Preparation of immunogenic compositions, including those for administration to human subjects, is generally described in Pharmaceutical Biotechnology, Vol. 61 Vaccine Design-the subunit and adjuvant approach, edited by Powell and Newman, Plenum Press, 1995. New Trends and Developments in Vaccines, edited by Voller et al., University Park Press, Baltimore, Md., U.S.A. 1978. Encapsulation within liposomes is described, for example, by Fullerton, U.S. Pat. No. 4,235,877. Conjugation of proteins to macromolecules is disclosed, for example, by Likhite, U.S. Pat. No. 4,372,945 and by Armor et al., U.S. Pat. No. 4,474,757. Typically, the amount of antigen in each dose of the immunogenic composition is selected as an amount which induces an immune response without significant, adverse side effects.
[0433] The amount of the disclosed immunogen (for example, a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, or a protein nanoparticle including such proteins), or nucleic acid molecule encoding an immunogen, or viral vector can vary depending upon the specific antigen employed, the route and protocol of administration, and the target population, for example. For protein therapeutics, typically, each human dose will comprise 1-1000 μg of protein, such as from about 1 μg to about 100 μg, for example, from about 1 μg to about 50 μg, such as about 1 μg, about 2 μg, about 5 μg, about 10 μg, about 15 μg, about 20 μg, about 25 μg, about 30 μg, about 40 μg, or about 50 μg. The amount utilized in an immunogenic composition is selected based on the subject population (e.g., infant or elderly). An optimal amount for a particular composition can be ascertained by standard studies involving observation of antibody titers and other responses in subjects. It is understood that a therapeutically effective amount of a disclosed immunogen, such as a recombinant HIV-1 Env ectodomain or fragment thereof, protein nanoparticle, viral vector, or nucleic acid molecule in a immunogenic composition, can include an amount that is ineffective at eliciting an immune response by administration of a single dose, but that is effective upon administration of multiple dosages, for example in a prime-boost administration protocol.
[0434] In some embodiments, the composition can be provided as a sterile composition. In more embodiments, the composition can be provided in unit dosage form for use to induce an immune response in a subject, for example, to prevent HIV-1 infection in the subject. A unit dosage form contains a suitable single preselected dosage for administration to a subject, or suitable marked or measured multiples of two or more preselected unit dosages, and/or a metering mechanism for administering the unit dose or multiples thereof. In other embodiments, the composition further includes an adjuvant.
J. Therapeutic Methods
[0435] The recombinant HIV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding the recombinant HIV-1 Env proteins or immunogenic fragments, vectors and compositions, can be used in methods of preventing, inhibiting and treating an HIV-1 infection, as well as methods of inducing an immune response to HIV-1, as described below. In several embodiments, a therapeutically effective amount of an immunogenic composition including one or more of the disclosed recombinant HIV-1 Env proteins or immunogenic fragments thereof, or protein nanoparticles of VLPs, or nucleic acid molecule or viral vector encoding a recombinant HIV-1 Env proteins or immunogenic fragments thereof, can be administered to a subject in order to generate an immune response to HIV-1.
[0436] In some embodiments, a subject is selected for treatment that has, or is at risk for developing, an HIV infection, for example because of exposure or the possibility of exposure to HIV. Following administration of a therapeutically effective amount of a recombinant HIV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding the recombinant HIV-1 Env proteins or immunogenic fragments, vectors and compositions, the subject can be monitored for HIV-1 infection, symptoms associated with HIV-1 infection, or both.
[0437] Typical subjects intended for treatment with the therapeutics and methods of the present disclosure include humans, as well as non-human primates and other animals. To identify subjects for prophylaxis or treatment according to the methods of the disclosure, accepted screening methods are employed to determine risk factors associated with a targeted or suspected disease or condition, or to determine the status of an existing disease or condition in a subject. These screening methods include, for example, conventional work-ups to determine environmental, familial, occupational, and other such risk factors that may be associated with the targeted or suspected disease or condition, as well as diagnostic methods, such as various ELISA and other immunoassay methods, which are available and well known in the art to detect and/or characterize HIV infection. These and other routine methods allow the clinician to select patients in need of therapy using the methods and pharmaceutical compositions of the disclosure. In accordance with these methods and principles, a composition can be administered according to the teachings herein, or other conventional methods known to the person of ordinary skill in the art, as an independent prophylaxis or treatment program, or as a follow-up, adjunct or coordinate treatment regimen to other treatments.
[0438] The methods can be used to inhibit, treat or prevent HIV infection in vivo. When inhibiting, treating, or preventing infection in vivo, the methods can be used either to avoid infection in an HIV-seronegative subject (e.g., by inducing an immune response that protects against HIV-1 infection), or to treat existing infection in an HIV-seropositive subject. The HIV-seropositive subject may or may not carry a diagnosis of AIDS. Hence in some embodiments the methods involves selecting a subject at risk for contracting HIV infection, or a subject at risk of developing AIDS (such as a subject with HIV infection), and administering a recombinant HIV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding the recombinant HIV-1 Env proteins or immunogenic fragments, vectors and compositions, to the subject.
[0439] Treatment of HIV by inhibiting HIV replication or infection can include delaying the development of AIDS in a subject. Treatment of HIV can also include reducing signs or symptoms associated with the presence of HIV (for example by reducing or inhibiting HIV replication). In some examples, treatment using the methods disclosed herein prolongs the time of survival of the subject.
[0440] The administration of a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition can be for prophylactic or therapeutic purpose. When provided prophylactically, the disclosed therapeutic agents are provided in advance of any symptom, for example in advance of infection. The prophylactic administration of the disclosed therapeutic agents serves to prevent or ameliorate any subsequent infection. When provided therapeutically, the disclosed therapeutic agents are provided at or after the onset of a symptom of disease or infection, for example after development of a symptom of HIV-1 infection, or after diagnosis of HIV-1 infection. The therapeutic agents can thus be provided prior to the anticipated exposure to HIV virus so as to attenuate the anticipated severity, duration or extent of an infection and/or associated disease symptoms, after exposure or suspected exposure to the virus, or after the actual initiation of an infection.
[0441] The immunogenic composition including one or more of the disclosed agents (for example, a recombinant HIV-1 Env protein, immunogenic fragments thereof, protein nanoparticles, or VLP), or nucleic acid molecule or viral vector encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, can be used in coordinate vaccination protocols or combinatorial formulations. In certain embodiments, novel combinatorial immunogenic compositions and coordinate immunization protocols employ separate immunogens or formulations, each directed toward eliciting an anti-HIV immune response, such as an immune response to HIV-1 Env protein. Separate immunogenic compositions that elicit the anti-HIV immune response can be combined in a polyvalent immunogenic composition administered to a subject in a single immunization step, or they can be administered separately (in monovalent immunogenic compositions) in a coordinate immunization protocol.
[0442] HIV infection does not need to be completely eliminated or reduced or prevented for the methods to be effective. For example, treatment with one or more of the disclosed therapeutic agents can reduce or inhibit HIV infection by a desired amount, for example by at least 10%, at least 20%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or even at least 100% (elimination or prevention of detectable HIV infected cells), as compared to HIV infection in the absence of the therapeutic agent. In additional examples, HIV replication can be reduced or inhibited by the disclosed methods. HIV replication does not need to be completely eliminated for the method to be effective. For example, treatment with one or more of the disclosed recombinant HIV-1 Env proteins, immunogenic fragment thereof, protein nanoparticles, polynucleotides encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vectors or compositions can HIV replication by a desired amount, for example by at least 10%, at least 20%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or even at least 100% (elimination or prevention of detectable HIV replication), as compared to HIV replication in the absence of the therapeutic agent.
[0443] To successfully reproduce itself, HIV must convert its RNA genome to DNA, which is then imported into the host cell's nucleus and inserted into the host genome through the action of HIV integrase. Because HIV's primary cellular target, CD4+ T-Cells, can function as the memory cells of the immune system, integrated HIV can remain dormant for the duration of these cells' lifetime. Memory T-Cells may survive for many years and possibly for decades. This latent HIV reservoir can be measured by co-culturing CD4+ T-Cells from infected patients with CD4+ T-Cells from uninfected donors and measuring HIV protein or RNA (See, e.g., Archin et al., AIDS, 22:1131-1135, 2008). In some embodiments, the provided methods of treating or inhibiting HIV infection include reduction or elimination of the latent reservoir of HIV infected cells in a subject. For example, a reduction of at least 10%, at least 20%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or even at least 100% (elimination of detectable HIV) of the latent reservoir of HIV infected cells in a subject, as compared to the latent reservoir of HIV infected cells in a subject in the absence of the treatment with one or more of the provided recombinant HIV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vectors or compositions.
[0444] Studies have shown that the rate of HIV transmission from mother to infant is reduced significantly when zidovudine is administered to HIV-infected women during pregnancy and delivery and to the offspring after birth (Connor et al., 1994 Pediatr Infect Dis J 14: 536-541). Several studies of mother-to-infant transmission of HIV have demonstrated a correlation between the maternal virus load at delivery and risk of HIV transmission to the child. The disclosed recombinant HIV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vectors and compositions are of use in decreasing HIV-transmission from mother to infant. Thus, in some embodiments a therapeutically effective amount of one or more of the provided therapeutic agents is administered in order to prevent transmission of HIV, or decrease the risk of transmission of HIV, from a mother to an infant. In some embodiments, a therapeutically effective amount of the agent can be administered to a pregnant subject to induce an immune response that generates neutralizing antibodies that are passes to the fetus via the umbilical cord to protect the fetus from infection during birth. In some embodiments, both a therapeutically effective amount of a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition and a therapeutically effective amount of another anti-HIV agent, such as zidovudine, is administered to the mother and/or infant.
[0445] Administration of a therapeutically effective amount of a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition induces a sufficient immune response to treat or inhibit or prevent the pathogenic infection, for example, to inhibit the infection and/or reduce the signs and/or symptoms of the infection. Amounts effective for this use will depend upon the severity of the disease, the general state of the subject's health, and the robustness of the subject's immune system.
[0446] For prophylactic and therapeutic purposes, a therapeutically effective amount of a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition can be administered to the subject in a single bolus delivery, via continuous delivery (for example, continuous transdermal, mucosal or intravenous delivery) over an extended time period, or in a repeated administration protocol (for example, by an hourly, daily or weekly, repeated administration protocol). The therapeutically effective dosage of the therapeutic agents can be provided as repeated doses within a prolonged prophylaxis or treatment regimen that will yield clinically significant results to alleviate one or more symptoms or detectable conditions associated with a targeted disease or condition as set forth herein.
[0447] In several embodiments, a prime-boost immunization protocol is used, and a recombinant HIV-1 Env ectodomain trimer including that binds to mature and unmutated common ancestor (UCA) forms of multiple classes of broadly neutralizing antibodies (e.g., targeting the CD4 binding site and the V1V2 domain) is used for the prime, and (in some embodiments, also for the boost. Exemplary recombinant HIV-1 Env ectodomain fur use as a prime in such embodiments are provided herein and include those set forth as SEQ ID NOs: SEQ ID NOs: 2146, 2147, 2148, 2149, 2150, 2151, 2152, 2153, 2154, 2155, 2156, 2157, 2158, and 2159.
[0448] Determination of effective dosages in this context is typically based on animal model studies followed up by human clinical trials and is guided by administration protocols that significantly reduce the occurrence or severity of targeted disease symptoms or conditions in the subject, or that induce a desired response in the subject (such as a neutralizing immune response). Suitable models in this regard include, for example, murine, rat, porcine, feline, ferret, non-human primate, and other accepted animal model subjects known in the art. Alternatively, effective dosages can be determined using in vitro models (for example, immunologic and histopathologic assays). Using such models, only ordinary calculations and adjustments are required to determine an appropriate concentration and dose to administer a therapeutically effective amount of the composition (for example, amounts that are effective to elicit a desired immune response or alleviate one or more symptoms of a targeted disease). In alternative embodiments, an effective amount or effective dose of the composition may simply inhibit or enhance one or more selected biological activities correlated with a disease or condition, as set forth herein, for either therapeutic or diagnostic purposes.
[0449] Dosage can be varied by the attending clinician to maintain a desired concentration at a target site (for example, systemic circulation). Higher or lower concentrations can be selected based on the mode of delivery, for example, trans-epidermal, rectal, oral, pulmonary, or intranasal delivery versus intravenous or subcutaneous delivery. The actual dosage of disclosed recombinant HIV-1 Env ectodomain, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition will vary according to factors such as the disease indication and particular status of the subject (for example, the subject's age, size, fitness, extent of symptoms, susceptibility factors, and the like), time and route of administration, other drugs or treatments being administered concurrently, as well as the specific pharmacology of the composition for eliciting the desired activity or biological response in the subject. Dosage regimens can be adjusted to provide an optimum prophylactic or therapeutic response. As described above in the forgoing listing of terms, a therapeutically effective amount is also one in which any toxic or detrimental side effects of the disclosed immunogen and/or other biologically active agent is outweighed in clinical terms by therapeutically beneficial effects.
[0450] A non-limiting range for a therapeutically effective amount of the disclosed immunogen (e.g., a recombinant HIV-1 Env protein, or nucleic acid encoding such protein, or nanoparticle including such protein) within the methods and immunogenic compositions of the disclosure is about 0.0001 mg/kg body weight to about 10 mg/kg body weight, such as about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.5 mg/kg, about 2 mg/kg, about 2.5 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, or about 10 mg/kg, for example 0.01 mg/kg to about 1 mg/kg body weight, about 0.05 mg/kg to about 5 mg/kg body weight, about 0.2 mg/kg to about 2 mg/kg body weight, or about 1.0 mg/kg to about 10 mg/kg body weight.
[0451] In some embodiments, the dosage includes a set amount of a disclosed immunogen (e.g., a recombinant HIV-1 Env protein, or nucleic acid encoding such protein, or nanoparticle including such protein) such as from about 1-300 μg, for example, a dosage of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, or about 300 μg. The dosage and number of doses will depend on the setting, for example, in an adult or anyone primed by prior HIV infection or immunization, a single dose may be a sufficient booster. In naïve subjects, in some examples, at least two doses would be given, for example, at least three doses. In some embodiments, an annual boost is given, for example, along with an annual influenza vaccination.
[0452] Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remingtons Pharmaceutical Sciences, 19.sup.th Ed., Mack Publishing Company, Easton, Pa., 1995.
[0453] In several embodiments, it may be advantageous to administer the therapeutic agents disclosed herein with other agents such as proteins, peptides, antibodies, and other antiviral agents, such as anti-HIV agents. Examples of such anti-HIV therapeutic agents include nucleoside reverse transcriptase inhibitors, such as abacavir, AZT, didanosine, emtricitabine, lamivudine, stavudine, tenofovir, zalcitabine, zidovudine, and the like, non-nucleoside reverse transcriptase inhibitors, such as delavirdine, efavirenz, nevirapine, protease inhibitors such as amprenavir, atazanavir, indinavir, lopinavir, nelfinavir, osamprenavir, ritonavir, saquinavir, tipranavir, and the like, and fusion protein inhibitors such as enfuvirtide and the like. In some examples, the disclosed therapeutic agents are administered with T-helper cells, such as exogenous T-helper cells. Exemplary methods for producing and administering T-helper cells can be found in International Patent Publication WO 03/020904, which is incorporated herein by reference.
[0454] For any application, treatment with a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition can be combined with anti-retroviral therapy, such as HAART. Antiretroviral drugs are broadly classified by the phase of the retrovims life-cycle that the drug inhibits. The therapeutic agents can be administered before, during, concurrent to and/or after retroviral therapy. In some embodiments, the therapeutic agents are administered following a course of retroviral therapy. The disclosed therapeutic agents can be administered in conjunction with nucleoside and nucleotide reverse transcriptase inhibitors (nRTI), non-nucleoside reverse transcriptase inhibitors (NNRTI), protease inhibitors, Entry inhibitors (or fusion inhibitors), Maturation inhibitors, or a broad spectrum inhibitors, such as natural antivirals. Exemplary agents include lopinavir, ritonavir, zidovudine, lamivudine, tenofovir, emtricitabine and efavirenz.
[0455] In some embodiments, a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition can be used as an immunogen to prime or induce an immune response (such as a T or B cell response) to HIV-1 in a subject. In some such embodiments, the T cell response is a CD4.sup.+ T helper cell response, such as a Th1 cell response.
[0456] In some embodiments, the disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition is administered to the subject simultaneously with the administration of the adjuvant. In other embodiments, the recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition is administered to the subject after the administration of the adjuvant and within a sufficient amount of time to induce the immune response.
[0457] The recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition can be used in coordinate vaccination protocols or combinatorial formulations. In certain embodiments, combinatorial and coordinate immunization protocols employ separate immunogens or formulations, each directed toward eliciting an anti-HIV immune response, such as an immune response to HIV-1 Env. Separate immunogenic compositions that elicit the anti-HIV immune response can be combined in a polyvalent immunogenic composition administered to a subject in a single immunization step, or they can be administered separately (in monovalent immunogenic compositions) in a coordinate immunization protocol.
[0458] In one embodiment, a suitable immunization regimen includes at least two separate inoculations with one or more immunogenic compositions, with a second inoculation being administered more than about two, about three to eight, or about four, weeks following the first inoculation. A third inoculation can be administered several months after the second inoculation, and in specific embodiments, more than about five months after the first inoculation, more than about six months to about two years after the first inoculation, or about eight months to about one year after the first inoculation. Periodic inoculations beyond the third are also desirable to enhance the subject's “immune memory.” The adequacy of the vaccination parameters chosen, e.g., formulation, dose, regimen and the like, can be determined by taking aliquots of serum from the subject and assaying antibody titers during the course of the immunization program. Alternatively, the T cell populations can be monitored by conventional methods. In addition, the clinical condition of the subject can be monitored for the desired effect, e.g., prevention of HIV-1 infection or progression to AIDS, improvement in disease state (e.g., reduction in viral load), or reduction in transmission frequency to an uninfected partner. If such monitoring indicates that vaccination is sub-optimal, the subject can be boosted with an additional dose of immunogenic composition, and the vaccination parameters can be modified in a fashion expected to potentiate the immune response. Thus, for example, the dose of the disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition and/or adjuvant can be increased or the route of administration can be changed.
[0459] It is contemplated that there can be several boosts, and that each boost can be a different disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition. It is also contemplated in some examples that the boost may be the same recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition as another boost, or the prime.
[0460] The prime can be administered as a single dose or multiple doses, for example two doses, three doses, four doses, five doses, six doses or more can be administered to a subject over days, weeks or months. The boost can be administered as a single dose or multiple doses, for example two to six doses, or more can be administered to a subject over a day, a week or months. Multiple boosts can also be given, such one to five, or more. Different dosages can be used in a series of sequential inoculations. For example a relatively large dose in a primary inoculation and then a boost with relatively smaller doses. The immune response against the selected antigenic surface can be generated by one or more inoculations of a subject.
[0461] Upon administration of a disclosed recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition of this disclosure, the immune system of the subject typically responds to the immunogenic composition by producing antibodies specific for HIV-1 Env protein. Such a response signifies that an immunologically effective dose was delivered to the subject.
[0462] An immunologically effective dosage can be achieved by single or multiple administrations (including, for example, multiple administrations per day), daily, or weekly administrations. For each particular subject, specific dosage regimens can be evaluated and adjusted over time according to the individual need and professional judgment of the person administering or supervising the administration of the immunogenic composition. In some embodiments, the antibody response of a subject will be determined in the context of evaluating effective dosages/immunization protocols. In most instances it will be sufficient to assess the antibody titer in serum or plasma obtained from the subject. Decisions as to whether to administer booster inoculations and/or to change the amount of the therapeutic agent administered to the individual can be at least partially based on the antibody titer level. The antibody titer level can be based on, for example, an immunobinding assay which measures the concentration of antibodies in the serum which bind to an antigen including, for example, a disclosed recombinant HIV-1 Env protein. The methods of using immunogenic composition, and the related compositions and methods of the disclosure are useful in increasing resistance to, preventing, ameliorating, and/or treating infection and disease caused by HIV (such as HIV-1) in animal hosts, and other, in vitro applications.
[0463] In certain embodiments, the recombinant HIV-1 Env protein, immunogenic fragment thereof, protein nanoparticle, polynucleotide encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vector or composition is administered sequentially with other anti-HIV therapeutic agents, such as before or after the other agent. One of ordinary skill in the art would know that sequential administration can mean immediately following or after an appropriate period of time, such as hours, days, weeks, months, or even years later.
[0464] In additional embodiments, a therapeutically effective amount of a pharmaceutical composition including a nucleic acid encoding a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof is administered to a subject, for example to generate an immune response. In one specific, non-limiting example, a therapeutically effective amount of a nucleic acid encoding a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, is administered to a subject to treat or prevent or inhibit HIV infection, or to induce an immune response to HIV-1 (such as to gp120) in the subject.
[0465] One approach to administration of nucleic acids is direct immunization with plasmid DNA, such as with a mammalian expression plasmid. As described above, the nucleotide sequence encoding a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof can be placed under the control of a promoter to increase expression of the molecule.
[0466] Immunization by nucleic acid constructs is well known in the art and taught, for example, in U.S. Pat. No. 5,643,578 (which describes methods of immunizing vertebrates by introducing DNA encoding a desired antigen to elicit a cell-mediated or a humoral response), and U.S. Pat. Nos. 5,593,972 and 5,817,637 (which describe operably linking a nucleic acid sequence encoding an antigen to regulatory sequences enabling expression). U.S. Pat. No. 5,880,103 describes several methods of delivery of nucleic acids encoding immunogenic peptides or other antigens to an organism. The methods include liposomal delivery of the nucleic acids (or of the synthetic peptides themselves), and immune-stimulating constructs, or ISCOMS™, negatively charged cage-like structures of 30-40 nm in size formed spontaneously on mixing cholesterol and Quil A™ (saponin). Protective immunity has been generated in a variety of experimental models of infection, including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMS™ as the delivery vehicle for antigens (Mowat and Donachie, Immunol. Today 12:383, 1991). Doses of antigen as low as 1 μg encapsulated in ISCOMS™ have been found to produce Class I mediated CTL responses (Takahashi et al., Nature 344:873, 1990).
[0467] In another approach to using nucleic acids for immunization, a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, can also be expressed by attenuated viral hosts or vectors or bacterial vectors. Recombinant vaccinia virus, adeno-associated virus (AAV), herpes virus, retrovirus, cytogmeglo virus or other viral vectors can be used to express the peptide or protein, thereby eliciting a CTL response. For example, vaccinia vectors and methods useful in immunization protocols are described in U.S. Pat. No. 4,722,848. BCG (Bacillus Calmette Guerin) provides another vector for expression of the peptides (see Stover, Nature 351:456-460, 1991).
[0468] In one embodiment, a nucleic acid encoding a disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof, is introduced directly into cells. For example, the nucleic acid can be loaded onto gold microspheres by standard methods and introduced into the skin by a device such as Bio-Rad's HELIOS™ Gene Gun. The nucleic acids can be “naked,” consisting of plasmids under control of a strong promoter. Typically, the DNA is injected into muscle, although it can also be injected directly into other sites, including tissues in proximity to metastases. Dosages for injection are usually around 0.5 μg/kg to about 50 mg/kg, and typically are about 0.005 mg/kg to about 5 mg/kg (see, e.g., U.S. Pat. No. 5,589,466).
K. Immunodiagnostic Methods
[0469] In addition to the therapeutic methods provided above, any of the disclosed immunogens (for example, disclosed recombinant HIV-1 Env ectodomain or immunogenic fragment thereof) can be utilized to produce antigen specific immunodiagnostic reagents, for example, for serosurveillance. Immunodiagnostic reagents can be designed from any of the antigenic polypeptide described herein. For example, in the case of the disclosed immunogens, the presence of serum antibodies to HIV is monitored using the isolated immunogens disclosed herein, such as to detect an HIV infection and/or the presence of antibodies that specifically bind to HIV-1 Env in a unliganded conformation.
[0470] Methods are further provided for a diagnostic assay to monitor HIV-1 induced disease in a subject and/or to monitor the response of the subject to immunization with one or more of the disclosed antigens. By “HIV-1 induced disease” is intended any disease caused, directly or indirectly, by HIV. An example of an HIV-1 induced disease is acquired immunodeficiency syndrome (AIDS). The method includes contacting a disclosed immunogen with a sample of bodily fluid from the subject, and detecting binding of antibodies in the sample to the disclosed immunogens. In addition, the detection of the HWV-1 binding antibody also allows the response of the subject to immunization with the disclosed antigen to be monitored. In still other embodiments, the titer of the HIV-1 binding antibodies is determined. The binding can be detected by any means known to one of skill in the art, including the use of labeled secondary antibodies that specifically bind the antibodies from the sample. Labels include radiolabels, enzymatic labels, and fluorescent labels. In other embodiments, a disclosed immunogen is used to isolate antibodies present in a subject or biological sample obtained from a subject.
[0471] Generally, the method includes contacting a sample from a subject, such as, but not limited to a blood, serum, plasma, urine or sputum sample from the subject with one or more of the disclosed recombinant HWV-1 Env proteins or immunogenic fragments thereof (including a polymeric form thereof) and detecting binding of antibodies in the sample to the disclosed immunogens. The binding can be detected by any means known to one of skill in the art, including the use of labeled secondary antibodies that specifically bind the antibodies from the sample. Labels include radiolabels, enzymatic labels, and fluorescent labels.
L. Kits
[0472] Any immunodiagnostic or therapeutic reagents can be provided as components of a kit. Optionally, such a kit includes additional components including packaging, instructions and various other reagents, such as buffers, substrates, antibodies or ligands, such as control antibodies or ligands, and detection reagents. The kit can include a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. The container typically holds a composition including one or more of the disclosed recombinant HWV-1 Env proteins, immunogenic fragments thereof, protein nanoparticles, polynucleotides encoding a recombinant HIV-1 Env ectodomain or immunogenic fragment, vectors or compositions, which is effective for treating, preventing, diagnosing, monitoring HIV infection or immune response. In several embodiments the container may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The label or package insert indicates that the composition is used for treating the particular condition.
[0473] The label or package insert typically will further include instructions for use of an antigen, or a nucleic acid or a viral vector encoding, expressing or including the antigen, for example, in a method of treating or preventing a HIV infection. The package insert typically includes instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products. The instructional materials may be written, in an electronic form (such as a computer diskette or compact disk) or may be visual (such as video files). The kits may also include additional components to facilitate the particular application for which the kit is designed. The kits may additionally include buffers and other reagents routinely used for the practice of a particular method. Such kits and appropriate contents are well known to those of skill in the art.
EXAMPLES
[0474] The following examples are provided to illustrate particular features of certain embodiments, but the scope of the claims should not be limited to those features exemplified.
Example 1
Structure, Activation, and Immune Recognition of Prefusion HIV-1 Env
[0475] This example illustrates the structure, activation, and immune recognition of prefusion HIV-1 Env. The HIV-1-Env ectodomain trimer, comprising three gp120 and three gp41 subunits, is a conformational machine that facilitates HIV-1 entry by rearranging from a mature unliganded state, through receptor-bound intermediates, to a postfusion state. This example shows the structure at 3.5-Å resolution for an HIV-1-Env trimer bound by antibodies PGT122 and 35O22. This structure reveals the prefusion conformation of gp41, indicates rearrangements needed for fusion activation, and defines parameters of immune evasion for the antigenic target of most neutralizing antibodies. Prefusion gp41 encircles extended N- and C-terminal strands of gp120 with a 4-helix collar, which is fastened by insertion of a fusion peptide-proximal methionine into a gp41-tryptophan clasp. Spike rearrangements required for entry likely involve opening the clasp and expelling the termini. N-linked glycosylation and sequence-variable regions cover the mature ectodomain trimer: the prevalence and location of effective neutralizing responses from seroconverter and chronic cohorts are mapped, and alterations that stabilize its conformation are identified.
[0476] Initially synthesized as a gp160 precursor, which is cleaved into gp120 and gp41 subunits, the trimeric HIV-1-Env ectodomain trimer displays unusual posttranslational processing including the addition of 25-30 N-linked glycans per gp120-gp41 protomer, tyrosine sulfation, and slow signal peptide cleavage. It rearranges from a mature unliganded state that evades antibody recognition, through intermediate states that bind to receptors CD4 and co-receptor (either CCR5 or CXCR4), to a postfusion state (reviewed in Wyatt, R. & Sodroski, Science 280, 1884-1888, 1998). Over the last 20 years substantial atomic-level detail has been obtained on these states, including structures of receptor-bound gp120 (Kwong et al. Nature 393, 648-659, 1998), postfusion gp41 (Chan at al., Cell 89, 263-273, 1997; Weissenhom et al., Nature 387, 426-430, 1997), and the trimeric arrangement of prefusion gp120 along with two gp41 helices, one of which was aligned in sequence (Chan at al., Cell 89, 263-273, 1997; Weissenhorn et al., Nature 387, 426-430, 1997). The prefusion structure of gp41 has, however, resisted atomic-level analysis. Because the primary structural rearrangement driving membrane fusion is the gp41 transition from prefusion to postfusion conformations, the lack of a prefusion gp41 structure has stymied attempts to provide a coherent picture of the conformational rearrangements the spike undergoes to facilitate entry.
[0477] Here, neutralizing antibodies PGT122 (Walker et al., Nature 477, 466-470, 2011) and 35O22 were used to capture the HIV-1 ectodomain trimer in a mature near-native state. Crystals of the antigen-binding fragments (Fabs) of these two antibodies were obtained in complex with a soluble, cleaved, Env trimer construct (BG505 SOSIP.664; Sanders et al., Journal of virology 76, 8875-8889, 2002; Julien et al., PNAS 110, 4351-4356, 2013; Sanders, PLoS pathogens 9, e1003618, 2013) and the structure of this elusive immunological target was determined at atomic-level detail. Analysis of this structure in the context of previously determined gp120 and gp41 structures affords a mechanistic understanding of the conformational transitions the ectodomain trimer undergoes to facilitate virus entry. Delineate aggregate parameters of glycan shielding and genetic variation were determined and a cohort serum was used to determine where the immune system succeeds in recognizing the HIV-1 ectodomain trimer. Analysis of the mature HIV-1-Env structure and its conformational rearrangements, combined with an understanding of its evasion from and vulnerabilities to the immune system, provide an information matrix which can be exploited to manipulate this critical vaccine target.
[0478] Structure determination and overall structure. Atomic-level information for virtually all of the HIV-1 Env ectodomain has been obtained as antibody-bound Env complexes (
[0479] The recently determined electron microscopy (EM) reconstruction (Lyumkis et al., Science 342, 1484-1490, 2013) and crystal structure (Julien et al., Science 342, 1477-1483, 2013) of a soluble cleaved HIV-1 Env based on the BG505 SOSIP.664 construct were no exceptions, in particular—while an artificial disulfide and other modification of the SOSIP.664 construct were critical for production of homogeneous, soluble, cleaved trimers (Ringe et al., PNAS 110, 18256-18261, 2013)—antibody PGT122 appeared to facilitate crystallization of a near-native mature state (Julien et al., Science 342, 1477-1483, 2013). Diffraction from crystals of the PGT122 complex, however, extended to only 4.7-Å resolution hampering the trace of non-helical regions of gp41 as well as the placement and registry of side chains (Julien et al., Science 342, 1477-1483, 2013). Addition of antibody 35O22 to PGT122-bound viral spike in the membrane-bound virion context showed single-molecule fluorescent resonance energy transfer (smFRET) responses that closely resembled that of the mature native unliganded ectodomain trimer (
[0480] Overall, the HIV-1 ectodomain trimer forms a 3-blade propeller, capped at the membrane-distal apex by trimer association domains with antibodies PGT122 and 35O22 binding to membrane-distal and membrane-proximal ends, respectively, of the ectodomain trimer (
[0481] Prefusion structure of gp41. Prefusion gp41 wraps its hydrophobic core around extended N- and C-termini-strands of gp120 (
[0482] Topologically, the gp41 subunit completes a single circle around the gp120 termini with the insertion of a hydrophobic prong comprising the side chain of Met530.sub.gp41 (which is located at the start of α6, proximal to the fusion peptide), into a triple tryptophan-clasp formed by Trp623, (from the end of α8), Trp628.sub.gp41 (from the start of α9) and Trp631.sub.gp41 (one turn into α9) (
[0483] Within a single protomer, the buried surface between gp41 and gp120 totals 5,268 Å.sup.2, including 216 Å.sup.2 from glycan-protein interactions (
[0484] Prefusion to postfusion gp41 transition. To understand the conformational transition from prefusion to postfusion gp41, the gp41-prefusion structure in the near-native HIV-1 Env trimer was compared with previously determined postfusion structures (
[0485] Superposition of prefusion α7 and postfusion HR1 placed residues 569.sub.gp41-593.sub.gp41 within 5 Å, with a rmsd of 1.35 Å. For this superposition to occur, Ca-movements of over 80 Å are required for the gp41-fusion peptide and α6 helix as well as for the C-terminal portion of the α9 helix. Notably, this superposition preserves the coiled coil trimeric interaction of both prefusion and postfusion molecules and thus likely mimics the natural conformational transition that occurs during membrane fusion. Meanwhile, superposition of prefusion α9 and postfusion HR2 placed residues 634.sub.gp41-664.sub.gp41 within 5 Å, with a rmsd of 3.58 Å; the substantial alignment of the α9 and HR2 helices indicate that the HR2 helix is mostly preformed in the prefusion structure.
[0486] Entry rearrangements of HIV-1 Env. Biosynthesis of HIV-1 Env starts with an uncleaved gp160 trimer. Binding by antibodies PG9 and PGT145 to both uncleaved and mature Env indicate the trimer association domains at the spike apex likely assume conformations similar to that observed for the mature ectodomain trimer (Walker et al., Nature 477, 466-470, 2011; Walker et al. Science 326, 285-289, 2009) (
[0487] The CD4-bound state has been visualized by a number of EM reconstructions (Liu, Nature 455, 109-113, 2008; White et al. PLoS pathogens 6, e1001249, 2010) and atomic-level structures (Kwong et al. Nature 393, 648-659, 1998; Pancera PNAS 107, 1166-1171, 2010). In this state, V1V2 separates from V3: V3 points towards the target cell (Huang et al. Science 310, 1025-1028, 2005), and the bridging sheet (Kwong et al. Nature 393, 648-659, 1998) assembles with β2 forming antiparallel hydrogen bonds with β21 (as opposed to the parallel β3-β21 interaction of the near-native mature state; notably, the only parallel β-strand in the RSV F glycoprotein prefusion structure also changes conformation in RSV F pre- to postfusion transition; McLellan et al. Science 340, 1113-1117, 2013). With layer 1 of the inner domain (Finzi et al., Molecular cell 37, 656-667, 2010), helix α0 forms and Gln428.sub.gp120 and strand β21 invert; and in layer 2, inner domain rearrangements include the swapping of distinct perpendicular interactions of Trp112.sub.gp120 and Trp427.sub.gp120 (
[0488] At this receptor-bound stage, it is easy to imagine the fusion peptide penetrating the target cell membrane, while β27 gp41-cysteine loop remains hydrogen bonded to the gp120 termini (and with the C terminus of the gp41 ectodomain is in the viral membrane). Rearrangement of gp41 to its postfusion conformation may be triggered by gp120 shedding (Moore et al., Science 250, 1139-1142, 1990), with expulsion of its termini tugging on the gp41-cysteine loop and destabilizing the prefusion gp41 core. We note that the three tryptophans that make up the gp41-tryptophan clasp are essential to the folding of the post-fusion coiled coil, so they appear to be critical in both conformations (
[0489] HIV-1 rearrangements and other type 1 fusion machines. To determine whether the distinct elements observed in prefusion gp41 were preserved elsewhere, prefusion and postfusion states of other type I fusion machines from influenza virus (a member of the Orthomyxoviridae family of viruses; Wilson et al., Nature 289, 366-373, 1981, Bullough et al., Nature 371, 37-43, 1994), respiratory syncytial virus (RSV; Paramyxoviridae, McLellan et al. Science 340, 1113-1117, 2013, McLellan et al., Journal of virology 85, 7788-7796, 2011), and Ebola virus (Filoviridae, Weissenhorn et al., Molecular cell 2, 605-616, 1998, Lee et al., Nature 454, 177-182, 2008) were examined (
[0490] Glycan shield and genetic variation of mature unliganded Env. The mature unliganded conformation of HIV-1 Env is the target of most neutralizing antibodies. Substantial detail has already been reported regarding antibody recognition of gp120 in this conformation (Julien et al., Science 342, 1477-1483, 2013; Lyumkis et al., Science 342, 1484-1490, 2013). The newly revealed structure of a near-complete gp120-gp41 Env trimer provides an opportunity to understand aggregate properties of glycosylation and variation. Glycan shielding and genetic variation have long been recognized as mechanisms to avoid recognition by antibody (Wyatt et al., Nature 393, 705-711., 1998). The BG505 SOSIP.664 sequence contains 28 sequons specifying N-linked glycosylation (including a T332N mutation). We modeled high mannose glycans (either Man9 or Man5) on each sequon and calculated accessible surface for radii ranging from 1.4 Å (the radius of a water molecule) to 10 Å (the approximate radius of a single immunoglobulin domain) (
[0491] In terms of genetic variation, the per-residue Shannon entropy of 3,943 sequences of HIV-1 was calculated (
[0492] Serologic recognition of mature Env. Despite the multiple mechanisms of evasion shielding mature HIV-1 Env, potent broadly neutralizing antibodies do develop (Hraber et al. AIDS 28, 163-169, 2014). Many of these, including the PGT122 and 35O22 co-crystallized here, require N-linked glycosylation to bind; indeed, 35O22 utilizes a new mode of glycan recognition, involving a framework 3 insertion to create a “bowl” that cups glycan N88.sub.gp120 (
[0493] To determine the location and prevalence of effective humoral responses, a serological analysis was used that determined sites of HIV-1 vulnerability to antibody based on serum neutralization of a panel of diverse HIV-1 isolates (Georgiev et al., Science 340, 751-756, 2013). Sera from a cohort that had been infected for 2-3 years as well as sera from a cohort of donors that had been infected for more than 5 years were assessed on a panel of 21 diverse HIV-1 isolates, and the neutralization phenotypes assigned to 12 prototypic antibody-neutralization fingerprints (
[0494] Viral evasion and immune recognition. In addition to merging virus and host cell membranes as an essential step in entry, viral fusion machines must contend with antibody-mediated neutralization. With RSV, peak infection occurs at 6-12 months of life, when maternal antibodies wane; with influenza virus, natural infection elicits strain-specific antibodies, and evasion occurs seasonally on a global scale. HIV-1, however, confronts the immune system in each individual directly, often presenting high titers of Env antigens over years of chronic infection. These differences in evasion are reflected in structural difference in the fusion machines. The structure of the HIV-1-Env ectodomain trimer revealed here allows the molecular trickery behind single spike entry (Yang et al., Journal of virology 79, 12132-12147, 2005), glycan shielding (Wei, X. et al. Antibody neutralization and escape by HIV-1. Nature 422, 307-312, 2003), and conformational masking (Kwong et al. Nature 420, 678-682, 2002) to be visualized at the atomic level (
Methods
[0495] BG505 SOSIP.664 expression and purification. The crystallized HIV-1-Env construct from strain BG505 was synthesized as described in (Julien et al., Science, 342, 1477-1483, 2013; Julien et al., Proc. Nat'l. Acad. Sci. U.S.A., 110, 4351-4356, 2013; Sanders et al., PLoS pathogens, 9, e1003618, 2013), using BG505 GenBank® Acc. Nos., using BG505 GenBank accession numbers ABA61516 and DQ208458 (Wu et al. Journal of virology 80, 835-844, 2006), including the “SOS” mutations (A501C, T605C), the isoleucine to proline mutation at residue 559 (1559P), and the glycan site at residue 332 (T332N); mutating the cleavage site to 6R (REKR to RRRRR); and truncating the C terminus to residue 664 (all HIV-1 Env numbering according to the HX nomenclature). This construct is referred to as BG505 SOSIP.664 herein.
[0496] The construct was cotransfected with furin in HEK 293 S GnTI−/− cells using 600 μgs plasmid DNA and 150 μgs of furin as described previously (Sanders, PLoS pathogens 9, e1003618, 2013). Transfection supernatants were harvested after 7 days, and passed over either a 2G12 antibody- or VRC01 antibody-affinity column. After washing with PBS, bound proteins were eluted with 3M MgCl.sub.2, 10 mM Tris pH 8.0. The eluate was concentrated to less than 5 ml with Centricon-70 and applied to a Superdex 200 column, equilibrated in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
[0497] Fab expression and purification. PGT122 and 35O22 IgGs were expressed as previously described (McLellan et al., Nature 480, 336-343, 2011). Heavy chain plasmids containing an HRV3C cleavage site after Lys 218 in the hinge region were co-transfected with light chain plasmids in 293F (35O22) or GnTI−/− (PGT122, which is glycosylated) using TrueFect-Max transfection reagent (United Biosystems) according to manufacturer's protocol. Cultures were fed with fresh 293FreeStyle media (Life Technologies) 4 h post-transfection and with HyClone SFM4HEK293 enriched medium (HyClone) containing valproic acid (4 mM final concentration) 24 h after transfection. Cultures were then incubated at 33° C. for 6 days, and supernatants harvested and passed over a protein A affinity column. After PBS wash and low pH elution, pH of eluate was neutralized with 1M Tris pH 8.5. Fabs were obtained using HRV3C digestion and collecting flow-thru from protein A column to remove Fc fraction. Fabs were further purified over Superdex 200 in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide.
[0498] Ternary complex preparation. PGT122 and 35O22 Fabs were added to a solution of purified trimeric BG505 SOSIP.664 in 5 fold molar excess for 30 min at room temperature (RT). The complex was then partially deglycosylated by adding Endo H (50 μl) for 1 hour at RT in the gel filtration buffer. The complex was then purified over gel filtration equilibrated in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide. Fractions were pooled, concentrated down to 5-10 OD.sub.280/mL and used immediately for crystal screening or flash frozen in liquid nitrogen and kept at −80° C. until further use.
[0499] Crystallization screening. The ternary complex was screened for crystallization using 572 conditions from Hampton, Wizard and Precipitant Synergy (Majeed, S. et al. Structure 11, 1061-1070 (2003) screens using a Cartesian Honeybee crystallization robot as described previously (McLellan et al., Nature 480, 336-343, 2011) and a mosquito robot using 0.1 μl of reservoir solution and 0.1 μl of protein solution. Crystals suitable for structural determination grew in 0.2M Li.sub.2SO.sub.4, 6.65% PEG 1500, 20% isopropanol and 0.1M sodium acetate pH 5.5. Crystals were reproduced in hanging droplets containing 0.5 μl of reservoir solution and 0.5 μl of protein solution. The final crystals were obtained in 16% isopropanol, 5.32% PEG 1500, 0.2M Li.sub.2SO.sub.4, 0.1M Na acetate pH 5.5. The crystals were cryoprotected in a solution of 15% 2R3R-butanediol, 5% isopropanol in paratone N and data were collected at a wavelength of 1.00 Å at the SER-CAT beamline ID-22 (Advanced Photon Source, Argonne National Laboratory).
[0500] X-ray data collection, structure solution and model building. Diffraction data were processed with the HKL2000 suite (Otwinowski and Minor, Meth. Enzymol., 276, 307-326, 1997). The data were corrected for anisotropy by services.mbi.ucla.edu/anisoscale/ with truncations to 3.5 Å, 3.5 Å, 3.1 Å along a, b, and c axes, respectively. Structure solution was obtained with Phaser using gp120 (PDB ID: 4J6R; Georgiev et al., Science 340, 751-756, 2013), PGT122 (PDB ID: 4JY5; Julien et al., PLoS pathogens 9, e1003342, 2013) and 35O22Fv as search models. Refinement was carried out with Phenix (Adams et al. J Synchrotron Radiat, 11, 53-55, 2004) imposing PGT122, 35O22 and gp120 model-based refinement restraint during initial round of refinement. Model building was carried out with Coot (Emsley and Cowtan, Acta crystallographica. Section D, Biological crystallography, 60, 2126-2132, 2004). The Ramachandran plot as determined by MOLPROBITY (Davis et al., Nucleic Acids Res, 32, W615-619, 2004) showed 92.66% of all residues in favored regions and 99.03% of all residues in allowed regions. Data collection and refinement statistics are shown in
[0501] smFRET. Peptides for site-specific fluorescent labeling were inserted into HIV-1.sub.JR-FL gp160 at positions that did not interfere with Env function by overlap extension PCR. Tagged virus was purified and labelled with Cy3B and Cy5(4S)COT fluorophores, and surface immobilized for imaging via total internal reflection fluorescence (TIRF) microscopy as described (Munro et al. Biophysical Journal 104, 415A, 2013). Labelled virus was pre-incubated for 30 min with 0.1 mg/ml PGT122 or 35O22, or with both PGT122 and 35O22 prior to imaging. Fluorescence trajectories were acquired at 25 frames/s. Traces that presented anticorrelated fluctuations in fluorescence intensity, indicative of FRET, were identified and compiled into histograms. Histograms were fit to the sum of three Gaussian distributions in Matlab. smFRET revealed that HIV-1 Env is conformationally dynamic, transitioning between three distinct conformations. Response to various ligands identified the low-FRET conformation as the predominant population of mature prefusion unliganded HIV-1 Env; intermediate- and high-FRET conformations predominant in the presence of CD4 and CD4-induced antibodies (Munro et al. Biophysical Journal 104, 415A, 2013).
[0502] Binding studies using biolayer interferometry. A fortéBio Octet Red384 instrument was used to measure binding of BG505 SOSIP. 664 and BG505 gp120 molecules to neutralizing antibodies (VRC01, VRC03, b6, b12, F105, PGT122, PGT128, PGT135, 2G12, 8ANC195, 17b, 2.2C, 412d, PG9, PGT145, VRC26.09, 35O22, PGT151) and CD4 Ig. All the assays were performed with agitation set to 1,000 rpm in phosphate-buffered saline (PBS) buffer supplemented with 1% bovine serum albumin (BSA) in order to minimize nonspecific interactions. The final volume for all the solutions was 40-50 μl/well. Assays were performed at 30° C. in solid black tilted-bottom 384-well plates (Geiger Bio-One). Human antibodies (40-50 μg/ml) in PBS buffer was used to load anti-human IgG Fc capture (AHC) probes for 300 s. Typical capture levels were between 1 and 1.5 nm, and variability within a row of eight tips did not exceed 0.1 nm. Biosensor tips were then equilibrated for 180 s in PBS/l % BSA buffer prior to binding assessment of the BG505 SOSIP.664 and BG505 gp120 molecules in solution for 300 s; binding was then allowed to dissociate for 300 s. Parallel correction to subtract systematic baseline drift was carried out by subtracting the measurements recorded for a sensor without monoclonal antibody incubated in PBS/1% BSA. Data analysis were carried out using Octet software, version 8.0.
[0503] Difference distance analysis. Difference distance matrices were produced by distance sorting atom positions and plotting with the program DDMP (Nishikawa et al., J. Physical Society of Japan 32, 1331-1337 (1972).
[0504] Surface plasmon resonance analysis. Affinities and kinetics of binding of antibodies 35O22 and PGT151 to BG505 SOSIP.664 soluble trimer were assessed by surface plasmon resonance on a Biacore T-200 (GE Healthcare) at 20° C. with buffer HBS-EP+ (10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.05% surfactant P-20). In general, mouse anti-human Fc antibody was first immobilized onto two flow cells on a CM5 chip at ˜10000 response units (RU) with standard amine coupling protocol (GE Healthcare). Either CD4-Ig, 2G12 IgG or 17b IgG was then captured on both flow cells by flowing over a 200 nM solution at 5 μl/min flow rate for two minutes. This was followed by a 1-minute injection of 1 μM human Fc on both flow cells to block unliganded mouse anti-human Fc antibody. The captured 2G12, CD4 or 17b were used to immobilize BG505 SOSIP.664 trimer on only one flow cell, with no trimer captured on the other flow cell (reference cell). For capturing with 2G12 or CD4-Ig, 500 nM of unliganded trimer was used, whereas, a complex of 500 nM trimer+1500 nM sCD4 was used for capturing with 17b. Antibody Fab fragments at 2-fold dilutions starting from 885 nM, 600 nM and 460 nM for 35O22, PGT151 and PGT145, respectively, were injected over the captured trimer channel and the reference channel at a flow rate of 50 μl/min for 2 minutes and allowed to dissociate for 3-30 minutes depending on the rate of dissociation of each interaction. The cells were regenerated with two 10 μl injections of 3.0 M MgCl.sub.2 at a flow rate of 100 μl/min. Blank sensorgrams were obtained by injection of same volume of HBS-EP+buffer in place of antibody Fab fragments. Sensorgrams of the concentration series were corrected with corresponding blank curves and fitted globally with Biacore T200 evaluation software using a 1:1 Langmuir model of binding. The stoichiometry of binding of antibodies to the trimer were estimated by normalizing the Rmax values to the amount of trimer captured and performing linear regression analysis using the Rmax values for the antibodies with known stoichiometries.
[0505] Modeling of missing loops, side chains, and the N-linked glycan shield. Missing loops not defined in the HIV-1-Env trimer crystal structure were modeled using Loopy (Xiang et al., Proc. Nat'l. Acad. Sci. U.S.A., 99, 7432-7437, 2002). The Missing side chains were modeled with Scap (Xiang and Honig, J Mol. Biol., 311, 421-430, 2001).
[0506] To model the N-linked glycan shield, we first determined all possible N-linked sequons in the HIV-1 Env trimer structure. A single asparagine residue in each sequon was targeted for computational N-linked glycan addition using a series of oligmannose 9 rotamer libraries at different resolutions. In constructing the rotamer libraries, the asparagine side chain rotamers were also considered. To avoid a combinatorial explosion in the search space, select torsion angles in the oligomannose 9 rotamer libraries were allowed to vary in increments between 30-60 degrees. An overlap factor (ofac) was used to screen for clashes between the sugar moieties and the trimer structure. The ofac between two nonbonded atoms is defined as the distance between two atoms divided by the sum of their van der Waal's radii. For the modeling carried out here, the ofac was set to a value of 0.60. For sterically occluded positions, the ofac was set to 0.55. To remove steric bumps between sugar moieties, all models were subjected to 100 cycles of conjugate gradient energy minimization using the GLYCAM (Kirschner et al. Journal of computational chemistry 29, 622-655 (2008)) force field in Amber12 (Cornell J. Am. Chem. Soc. 117, 5179-5197, 1995), with a distance-dependent dielectric.
[0507] Mapping sequence variability onto trimer structure. For each of HIV-1 Env, influenza HA, and RSV F, residue sequence variability was computed as the Shannon entropy for each residue position, based on representative sets of 3943 HIV-1 strains, 4467 influenza strains, and 212 RSV strains, respectively. Residues were colored based on the computed entropy values, on a scale of white (conserved) to purple (variable).
[0508] Serum neutralization fingerprinting analysis. The prevalence of effective neutralizing responses against HIV-1 Env in cohorts from 2-3 and 5+ years post-infection was estimated using a neutralization fingerprinting approach, as described previously (Georgiev et al., Science, 340, 751-756, 2013). Briefly, serum neutralization over a set of 21 diverse viral strains was compared to neutralization of the same viruses by a set of broadly neutralizing antibodies grouped into 12 epitope-specific antibody clusters. For each serum, the relative prevalence of each of the 12 antibody specificities was estimated by representing serum neutralization as a linear combination of the monoclonal specificities, with prevalence values of 0.2 deemed as positive. Sera with less than 30% breadth on the 21-virus panel as well as sera with high residual values from the computation (data not shown) were not included in the analysis. For mapping prevalence values onto the BG505 structure, residues part of multiple antibody epitopes were colored according to the respective antibody specificity with the highest prevalence in the 5+ years cohort. Antibody neutralization was measured using single-round-of-infection HIV-1 Env-pseudoviruses and TZM-bl target cells, as described previously (Li et al., J. Virol., 79, 10108-10125, 2005). Neutralization curves were fit by nonlinear regression using a 5-parameter hill slope equation as previously described (Li et al., J. Virol., 79, 10108-10125, 2005).
[0509] Patient information. In the CHAVI 001 cohort, high-risk subjects were screened for HIV-1 infection by ELISA, Western blotting, and plasma RNA to recruit individuals with acute HIV infection, who were then followed for ˜2 years until plasma neutralization breadth developed (Tomaras et al., J. Virol., 82, 12449-12463, 2008). In addition, a group of individuals were enrolled in the CHAVI 001 or CHAVI 008 cohorts who were chronically infected with HIV-1 strains clade A, B or C, and were screened for plasma neutralization breadth. The trial participants were enrolled at sites in Tanzania, South Africa, Malawi, the United States, and the United Kingdom (Tomaras et la., J. Virol., 85, 11502-11519, 2011). Both CHAVI001 and CHAVI008 protocols were approved by the institutional review boards of each of the participating institutions where blood samples were received or processed for analysis.
[0510] Epitope analysis for HIV-1 Env, influenza HA, and RSV F antibodies. Glycan usage and average residue entropy were calculated for eight representative HIV-1 Env (VRC01, b12, CD4, HJ16, 8ANC195, PG9, PGT122, 2G12, and 35O22), four representative influenza HA (2D1, C05, F10, and CR8043), and three representative RSV F (D25, Motavizumab, and 101F) epitopes based on their respective crystal structures. The selection of the flu antibodies was done as follows: F10 (stem targeting) and C05 (head targeting) were selected based on their cross-neutralizing ability for group 1 and group 2 of influenza A. CR8043 (group 2 specific) and 2D1 (H1 specific), which targets distinct regions from F10 and C05 at the stem and head of the HA respectively, were also selected for epitope analysis. An antigen residue was defined as an epitope residue if it had a non-zero BSA in the crystal structure. The fraction of glycan surface area in an epitope was calculated as the buried surface area of epitope glycans divided by the buried surface area of the full epitope. Mann-Whitney test was used to quantify the statistical difference between glycan fraction or average residue entropy for HIV-1 vs. influenza or RSV antibody epitopes.
[0511] Figures. Structure figures were prepared using PYMOL (The PyMOL Molecular Graphics System, DeLano Scientific, San Carlos, Calif., 2002).
[0512] Interfaces. Interactive surfaces were obtained from PISA (ebi.ac.uk/pdbe/pisa/).
Example 2
Crystal Structure of Unliganded HIV-1 Env Trimer in the Prefusion Mature Closed Conformation and Stabilization of the IV-1 Env Ectodomain in a Prefusion Mature Closed Conformation
[0513] This example illustrates the three dimensional structure of the BG505 SOSIP.664 trimer in the prefusion mature closed conformation when not bound by neutralizing antibody. Additionally, this example illustrates exemplary HIV-1 Env ectodomains stabilized in a prefusion mature closed conformation. The crystal structure of the HIV-1 Env ectodomain in complex with the PGT122 and 35O22 Fabs (i.e., in a prefusion mature closed conformation) or in unliganded (without bound antibody) compared to the structure of HIV-1 Env in the CD4 bound conformation shows dramatic structural rearrangements in both the membrane-proximal and membrane-distal regions, providing guidance for the stabilization of the mature closed conformation of HIV-1 Env.
[0514] The structure of the unliganded HIV-1 Env ectodomain trimer is substantially identical to HIV-1 Env in the PGT122/35O22-bound BG505 SOSIP structure (discussed in Example 1) with rmsd of Cα ˜1.1 Å. This finding confirms that the HIV-1 Env ectodomain is not significantly distorted by binding to PGT122 and 35O22 antibodies, and therefore, that the structure disclosed in Example 1 provides an accurate view of the HIV-1 Env ectodomain in the prefusion mature closed conformation.
[0515] As the sole viral antigen on the HIV-1-virion surface, trimeric Env—and its gp120 and gp41 subunits—have been the focus of extensive vaccine efforts (Rerks-Ngarm et al., N Engl J Med, 361, 2209-2220, 2009; Flynn et al., J Infect Dis, 191, 654-665, 2005). These have been stymied, however, by unfavorable Env properties including substantial conformational diversity (Kwong et al., Nature, 420, 678-682, 2002). While a near-native soluble Env trimer (BG505 SOSIP.664) has been developed, which is preferentially recognized by broadly neutralizing antibodies (Binley et al., J Virol., 74, 627-643, 2000; Sanders et al., PLoS pathogens 9, e1003618, 2013; Sanders et al., J Virol, 76, 8875-8889, 2002), this trimer can be triggered by the CD4 receptor to expose epitopes recognized by ineffective antibodies, and a conformationally fixed trimer remains a key goal for vaccine designers. Here the crystal structure at 3.7 Å resolution of the unliganded SOSIP.664 trimer is presented, its structural compatibility with Env-reactive antibodies is characterized, and structure-based design is used to fix its conformation. The unliganded SOSIP.664 trimer assumed a closed structure, highly similar to antibody-bound structures (Example 1; Julien et al, Science, 342, 1477-1483, 2013; Lyumkis et al., Science 342, 1484-1490, 2013), which epitope analysis revealed to be structurally compatible with broadly neutralizing antibodies, but not ineffective ones. Structural compatibility correlated with binding antigenicity, except for ineffective antibodies directed to CD4-induced epitopes. Structure-based design yielded conformationally fixed variants, including a 201-433 double cysteine (DS) mutant, with improved specificity for broadly neutralizing antibodies. The DS-SOSIP.664 mutant retained nanomolar affinity for CD4, with which it formed a new structural state: a closed trimer bound by a single CD4 without the typical antigenic hallmarks of CD4 induction. This new structural state appeared to be an obligatory intermediate between the unliganded closed state and an activated state recognized by multiple CD4s and co-receptor. Conformational fixation—enabled by antigenicity-guided structural design—can thus be used to delineate mechanistic states and to improve Env-antigenic specificity, with DS-Env trimers fixed in the unliganded closed state defining a new generation of vaccine immunogens.
[0516] HIV-1 uses multiple mechanisms to evade the immune system, and these have stymied the development of an effective vaccine. One mechanism—conformational masking (Kwong et al., Nature, 420, 678-682, 2002)—hides the vulnerable shape of trimeric Env recognized by broadly neutralizing antibodies via structural rearrangements that expose immunodominant Env epitopes recognized by non- or poorly neutralizing antibodies. A potential solution is to determine the structure of the vulnerable conformation of Env and to use this structural information and protein design to stabilize or fix the vulnerable shape. Definition of the structure of trimeric HIV-1 Env in its vulnerable shape has been accomplished at increasing resolution by crystallography and cryo-electron microscopy (Example 1; Julien et al, Science, 342, 1477-1483, 2013; Lyumkis et al, Science 342, 1484-1490, 2013; Liu et al., Nature 455, 109-113, 2008). These studies have culminated in atomic-level structures of antibody-bound forms of a soluble, near-native trimer mimic, named BG505 SOSIP.664 for HIV-1 strain (BG505, Wu et al., J Virol, 80, 835-844, 2006) and stabilizing mutations (SOSIP.664, Binley et al., J Virol., 74, 627-643, 2000; Sanders et al, PLoS pathogens 9, e1003618, 2013; Sanders et al., J Virol., 76, 8875-8889, 2002). Antibodies, however, can influence conformation, and structures of the Env gp120 subunit can differ substantially when unliganded or antibody-bound (
[0517] Overall, despite differences in glycosylation and lattice packing, the structure of the unliganded trimer assumed a closed conformation, which was remarkably similar to antibody-bound trimers (Example 1; Julien et al., Science, 342, 1477-1483, 2013; Lyumkis et al., Science 342, 1484-1490, 2013), with an overall root-mean-square deviation (RMSD) in Cα positions of less than 1 Å—substantially lower than observed with monomeric gp120 (
[0518] The unliganded closed structure was compatible with the epitopes for all broadly neutralizing epitopes, except those of the membrane-proximal external region, which recognize epitopes downstream of residue 664, and of antibodies b1214 and CH10315, with CH103 exceeding a 2 Å threshold of epitope similarity and with b12 exceeding a volume threshold of 500 Å3 (
[0519] These results indicate the unliganded closed trimer to be structurally specific for neutralizing antibodies. Structural specificity as measured by epitope compatibility, however, is only one of the requirements of an appropriate vaccine template: antigenic specificity as measured by binding to broadly neutralizing and not ineffective antibodies is also crucial. The BG505 SOSIP.664 had previously been shown by Moore, Sanders, and colleagues to be antigenically specific for broadly neutralizing antibodies, though binding to poorly neutralizing antibodies directed at the V3 loop was reported (Sanders et al, PLoS pathogens 9, e1003618, 2013). Negative selection by ineffective antibodies such as the V3-directed antibody 447-52D17 to remove aberrantly folded molecules was used (
[0520] To fix the unliganded closed state and to prevent CD4 triggering, regions of the unliganded closed structure that moved upon CD4 binding were analyzed to identify cavity-filling hydrophobic substitutions, side-chain pairs capable of forming disulfide bonds, and positions where the introduction of a proline would be compatible with only the unliganded closed structure of Env, but not its receptor-bound conformation (
[0521] These results indicate the 201C-433C ‘DS’ variant of BG505 SOSIP.664 (termed “DS-SOSIP.664”) is not triggered by CD4. To define the interaction of the DS-SOSIP.664 variant with CD4, surface plasmon resonance (SPR) was used (
[0522] DS-SOSIP.664 can thus capture Env in a single CD4-bound state. To obtain structural information on this single CD4 bound state, the hydrogen-deuterium exchange (HDX) of DS-SOSIP.664 with and without CD4 was characterized. Without CD4, the hydrogen-deuterium exchange of DS-SOSIP.664 appeared similar to the exchange of the parent SOSIP.664 (
[0523] As the single-CD4-bound state could be SOSIP.664 specific, and indeed both SOSIP.664 and DS-SOSIP.664 variant appear to be extraordinarily rigid, DS-stabilized Envs were assessed in other contexts. When DS mutations were placed into functional virus, they ablated entry (
[0524] Additional HIV-1 Env ectodomain variants including one or more amino acid substitutions to stabilize the ectodomain in the prefusion mature closed conformation are set forth in Table 13 and described herein, the antigenicity of some of which is presented in
[0525] The unliganded Env trimer—fixed in the pre-fusion closed conformation—may be an ideal HIV-1 immunogen. We assessed DS-SOSIP.664 for physical stability to conditions typically encountered during manufacturing and observed increased stability relative to the parent SOSIP.664 to denaturation by temperature, pH or freeze-thaw (
Methods
[0526] BG505 SOSIP.664 expression, purification, and deglycosylation. BG505 SSOIP.664 trimer was produced in HEK 293 GnTI−/− cells via transient transfection of the BG505 SOSIP expressing plasmid with furin and purified as described previously (Sanders et al, PLoS pathogens 9, e1003618, 2013; Julien et al, Science, 342, 1477-1483, 2013) and in Example 1. Briefly, the BG505 SOSIP.664 expressed supernatant was passed over the 2G12 IgG-conjugated protein A column, washed with phosphate-buffered saline (PBS), and eluted with the elution buffer containing 3M MgCl2, pH 8.5. The eluted protein was then dialyzed against PBS and set for deglycosylation reaction at 37° C. in the reaction buffer containing 1 mM EDTA, 150 mM NaCl, protease inhibitor cocktail (Roche), 17,000 units of Endo H/ml, and 50 mM sodium acetate, pH 5.8. The deglycosylated BG505 SOSIP was further purified with Superdex 200 16/60 (GE Healthcare) column in the buffer containing 5 mM HEPES 7.5, 150 mM NaCl, and 0.02% NaN3. The peak corresponding to trimeric HIV-1 Env was identified, pooled and concentrated to −10 mg/ml using an Amicon Ultra-15 centrifugal filter (MWCO 50,000, Millipore) and screened for crystallization. For antigenicity and stability analyses, trimers were purified by affinity chromatography over a VRC01 column, purified by gel filtration over a Superdex 200 16/60 (GE Healthcare) column in buffer containing 5 mM HEPES 7.5, 150 mM NaCl, and 0.02% NaN3, and finally, passed through a 447-52D column to remove aberrant trimer species (
[0527] Crystallization screening. Deglycosylated BG505 SOSIP.664 was screened for crystallization using 572 conditions from Hampton, Wizard and Precipitant Synergy (Majeed et al, Structure, 11, 1061-1070, 2003) screens using a Cartesian Honeybee crystallization robot as described previously (McLellan et al., Nature, 480, 336-343, 2011) and a mosquito robot using 0.1 μl of reservoir solution and 0.1 μl of protein solution. Crystals suitable for structural determination were obtained robotically in 26% PEG 400, 3.2% PEG 3350, and 0.1M sodium acetate pH 5.5. Crystals were cryoprotected in a solution containing 30% glycerol, 30% PEG 400, 4% PEG 3350, and 0.1M sodium acetate pH 5.5, and flash-frozen in liquid nitrogen. Data were collected at a wavelength of 1.00 Å at the SER-CAT beamline ID-22 (Advanced Photon Source, Argonne National Laboratory).
[0528] X-ray data collection, structure solution and model building. Diffraction data were processed with the HKL2000 suite (Otwinowski & Minor, Methods Enzymol., 276, 307-326, 1997). The data were corrected for anisotropy using the anisotropy server services.mbi.ucla.edu/anisoscale/ with truncations to 3.7 Å, 3.7 Λ, 3.3 Å along a, b, and c axes, respectively. Structure solution was obtained with Phaser using 35O22- and PGT122-bound BG505 SOSIP.664 (PDB ID: 4TVP10) as search models. Refinement was carried out with Phenix (Adams et al., J Synchrotron Radiat., 11, 53-55, 2004). Model building was carried out with Coot (Emsley & Cowtan, Acta crystal. Section D, Biol. Crystal., 60, 2126-2132, 2004).
[0529] Structural analyses involving residue-specific properties. To estimate the degree of structural flexibility in the unliganded HIV-1 trimer, we determined the average Cα RMSD distance for each residue position in the unliganded trimer structure (
[0530] Hydrogen/deuterium exchange (HDX) mass spectrometry (MS) is indicative of intrinsic amide exchange of peptide segments and is a useful technique to monitor dynamic characteristics of proteins in solution. Qualitative exchange profiles for observable peptides of SOSIP.664 after 3s were extracted from individual HDX-MS exchange plots (Guttman et al., Structure, 22, 974-984, 2014). The average exchange values (0-75%) were substituted in the B-factor field for the observed peptides of SOSIP.664 coordinates and displayed within PyMol. Non-observable peptides in the deuterium exchange experiment as well as peptides with missing electron density were excluded from the analysis.
[0531] Residue sequence variability was computed as the Shannon entropy for each residue position based on a representative set of 3,943 HIV-1 strains. The electrostatic potential surfaces were generated using GRASP41.
[0532] Assessment of antibody functionality on a panel of 170 diverse HIV-1. Neutralization was measured using single-round-of-infection HIV-1 Env-pseudoviruses and TZM-bl target cells, as described previously (Sarzotti-Kelsoe et al., J. Immunol. Meth., 409, 131-146, 2014). Neutralization curves were fit by nonlinear regression using a 5-parameter hill slope equation. The 50% and 80% inhibitory concentrations (IC.sub.50 and IC.sub.80) were reported as the antibody concentrations required to inhibit infection by 50% and 80% respectively.
[0533] Computation of antibody epitope RMSD, volume overlap, and epitope presence. HIV-1-specific antibody-antigen complex structures were compiled from the PDB, and antibodies were defined as broadly or poorly/non-neutralizing based on published or in-house neutralization data of diverse viral strains (Georgiev et al, Science, 340, 751-756, 2013). Antibodies that were deemed to have insufficient evidence for being classified as broadly or poorly/non-neutralizing were excluded from the analysis. A single antibody representative was included in the analysis in cases where multiple antibody clonal relatives were found. The epitope residues for each antibody were defined based on the respective antibody-antigen complex crystal structures, with an antigen residue being defined as an epitope residue if any of its heavy atoms were within 5.5 Å of any antibody heavy atom. To compute the RMSD between the epitope residues in the antibody-antigen complex structure and the same residues in the unliganded trimer structure: (1) the epitope residues from the complex structure were aligned to the unliganded trimer structure using the align function in PyMOL, then (2) the Cα RMSD of the epitope residues was calculated. To remove outlier residues, the top and bottom 10% of the Cα deviations were removed from the RMSD calculation. To calculate the volume overlap between a given antibody and the unliganded trimer structure, the alignment from above was used to compute the overlap volume between the antibody from the complex structure and the unliganded trimer structure by using the phase_volCalc utility from Schrödinger. An antibody epitope was considered as present in the unliganded trimer structure if at least 70% of the epitope residues as defined by the antibody antigen complex structure were also present in the unliganded trimer structure. For mapping the per-residue RMSD computation onto the unliganded trimer structure, residues part of any antibody epitope (including epitopes with less than 70% total residues present) were included in the analysis; if a given residue was part of more than one antibody epitope, the highest RMSD value for that residue among all epitopes was used. Antibody volume overlap values were mapped onto the unliganded trimer structure for all residues part of the epitope for the given antibody; if a residue was part of more than one antibody epitope, then the lowest volume overlap for that residue among all epitopes was used. Correlations of structural properties with neutralization and/or binding data were computed using the Spearman correlation coefficient.
[0534] Structural compatibility analysis. For a given antibody, the Antigenic Structural Compatibility (ASC) score with the HIV-1 Env unliganded pre-fusion trimer structure was computed based on a comparison to a structure of the antibody bound to an Env-derived antigen (e.g., gp120 core or V3 peptide). ASC scores were computed on a 0-1 scale using the following variables: (i) The fraction f of epitope residues (as defined by the structure of the antibody complex) exposed to solvent in the unliganded trimer structure was computed, with a residue considered accessible to solvent if its solvent-accessible surface area (SASA) was at least half its SASA in the respective antibody complex structure; ƒ was set to 0 if less than 70% of epitope residues were present in the antigen. (ii) A resolution estimate r was used such that Cα RMSDs d below r=2 were not penalized in the scores. (iii) The volume overlap values were used to define a volume overlap factor v that is equal to 1 for overlap below 200 Å3, is equal to 0 for overlap over 1000 Å3, and decays linearly in between. Intuitively, the unliganded trimer structure is expected to be structurally compatible with an antibody if f and v are high and if the RMSD d is low, since such conditions would indicate similarity between the unliganded trimer structure and the Env conformation in the antibody complex. Thus, the ASC score for each antibody with the unliganded trimer was defined by the formula: f v exp(−0.5 max(0, d−r)).
[0535] Transient transfection expression of immunogens in 96-well microplates. A 96-well microplate-formatted transient transfection expression approach was used to achieve high-throughput expression of various immunogen proteins as follows. HEK GnTi-cells were thawed and incubated with growth medium (293 FreeStyle Expression Medium supplemented with 10% Fetal Bovine Serum and 1% streptomycin-penicillin) (Invitrogen, Calif.) at 37° C., 5% CO2, until the cells reached logarithmic physiological growth. 24 hours prior to DNA-transient transfection, 100 μl of physiologically growing cells was seeded in each well of a 96-well microplate at a density of 2.5×105 cells/ml in expression medium (293 FreeStyle Expression Medium supplemented with 10% Ultra-Low IgG Fetal Bovine Serum and 1x-Non-Essential Amino Acids) (Invitrogen, Calif.), and incubated at 37° C., 5% CO2 for 20 h. Two hours prior to transfection, 100 μl of spent medium from each well was replaced with 60 μl of fresh expression medium. DNA-TrueFect-Max complexes were used for transfection, and these were prepared by mixing 0.2 μg plasmid DNA in 10 μl of Opti-MEM transfection medium (Invitrogen, Calif.) with 0.4 μl of TrueFect-Max (United BioSystems, Md.) in 10 μl of Opti-MEM, and incubating for 15 min prior to transfection. 20 μl of the complex was added into each well and mixed with growing cells, and the 96-well plate was incubated at 37° C., 5% CO2. One day post transfection, 20 μl of enriched medium (293 FreeStyle Expression Medium supplemented 25% Ultra-Low IgG Fetal Bovine Serum, 2× Non-Essential Amino Acids and 2× glutamine) was added to each well, and returned to incubator for continuous culture. On days three to five post transfection, the culture was exposed to oxygen in the sterilized air once per day. After day five post transfection, the biological function of the expressed protein in the supernatant in 96-well microplate was analyzed using an ELISA assay.
[0536] Antigenic analysis of stabilized HIV-1 Env trimeric immunogens in 96-well microplate by antibody binding ELISA assay. The D7324 antibody-coated 96-well ELISA plate was prepared by incubating 2 μg/ml of D7324 Antibody (Aalto, Ireland) in 100 μl PBS in 96 Well Flat-Bottom Immuno Plate (nunc, Thermo, Ill.) overnight at 4° C., followed by removal of coating solution and incubation of 200 μl/well, 2% (W/V) dry milk in PBS overnight at 4° C., and then the wells were washed 5 times with PBS+0.05% Tween 20. 30 μl of supernatant expressed in each well of the 96-well microplate was incubated with 70 μl of PBS in each well of a D7324 antibody-coated 96-well ELISA plate for two hours at room temperature (RT), and then the wells were washed 5 times with PBS+0.05% Tween 20. 100 μl of anti-specific epitope primary antibody (prepared in our lab) at a concentration of 10 μg/ml in PBS with 0.2% (W/V) dry milk and 0.2% Tween 20 was incubated into each well for 1 hour at RT, and then the wells were washed 5 times with PBS+0.05% Tween 20. 100 μl of Horseradish peroxidase (HRP)-conjugated goat anti-human IgG antibody (Jackson ImmunoResearch Laboratories Inc., PA) at 1:10,000 in PBS with 1.0% (W/V) dry milk and 0.2% Tween 20 was incubated into each well for 30 min at RT, and then the wells were washed 5 times in PBS+0.05% Tween 20. The wells were developed using TMB at RT for 10 min, and the reaction was stopped with 180 mM HCl. The readout was measured at a wavelength of 450 nm. All samples were performed in duplicate.
[0537] Antigenic analysis of BG505 SOSIP.664 and mutants by MSD-ECLIA assay using D7324 Detection. Standard 96-well bare MULTI-ARRAY Meso Scale Discovery (MSD) Plates (MSD, cat #L15XA-3) were coated with a panel of HIV neutralizing and non-neutralizing monoclonal antibodies in duplicates (30 μL/well) at a concentration of 10 μg/mL, diluted in 1×PBS and the plates were incubated overnight at 4° C. The following day, plates were washed (wash buffer: 0.05% Tween-20+1×PBS) and blocked with 150 μL of blocking buffer [5% [W/V] MSD Blocker A (MSD, Cat #R93BA-4)] and incubated for 1 hr on a vibrational shaker (Heidolph TITRAMAX 100; CAT #P/N: 544-11200-00) at 650 rpm. All the incubations were performed at room temperature, except the coating step. During the incubation, BG505 SOSIP trimer was titrated down in a serial 2 fold dilutions starting at 4 μg/mL concentration of the trimer in assay diluent (1% [W/V] MSD blocker A +0.05% Tween-20). After the incubation with blocking buffer was complete, the plates were washed and the diluted trimer was transferred (25 μl/well) to the MSD plates and incubated for 2 hrs on the vibrational shaker at 650 rpm. For soluble CD4 (sCD4) induction, trimer was pre-incubated with sCD4 at a constant molar concentration of 1 μM for 1 hour before adding to the MSD plate. After the 2 hr incubation with trimer, the plates were washed again and secondary detection MSD Sulfotag labeled D7324 antibody (Prior to running the assay D7324 antibody was labeled with MSD Sulfotag (MSD; Cat #R91AN-1) at a conjugation ratio of 1:15 [D7324: Sulfotag]), which was diluted in assay diluent at 5 μg/mL and was added to the plates (25 μL/well) and incubated for 1 hr on the vibrational shaker at 650 rpm. The plates were washed and read using the 1× read buffer (MSD Read Buffer T (4×); Cat #R92TC-2) on MSD Sector Imager 2400.
[0538] Antigenic analysis of stabilized HIV-1 Env trimeric immunogens by antibody binding ELISA assay. Similar to what was done for the 96 well plate ELISA, the D7324 (Aalto, Ireland) antibody was coated overnight at 2 μg/ml in 100 μl PBS at 4° C. Wells were washed once in PBS/Tween 20 (0.2%) and blocked with 200 μl/well of 2% (W/V) dry milk in PBS for one hour at room temperature (RT). The wells were then washed 5 times in PBS+0.05% Tween 20 (PBST) and purified proteins (BG505 SOSIP.664 and mutants) were then coated at either 0.5 or 2 μg/ml in PBS, 10% FBS for 2 hours at RT. The wells were washed 5 times in PBS-T. 100 μl of primary antibody at a concentration of 10 μg/ml in PBS/Tween 20 (0.2%) was incubated into each well for 1 hour at RT, and then the wells were washed 5 times in PBS-T. 100 μl of Horseradish peroxidase (HRP)-conjugated goat anti-human IgG antibody (Santa Cruz Biotechnology) at 1:5,000 in PBS with 0.2% Tween 20 was added to each well for 1 hour at RT. The wells were washed 5 times in PBS-T. The wells were developed using Sureblue (KPL) at RT for 10 min, and the reaction was stopped with 180 mM HCl. The readout was measured at a wavelength of 450 nm. All samples were performed in duplicate.
[0539] Surface plasmon resonance analysis. Affinities and kinetics of binding to BG505 SOSIP.664 soluble trimer and its mutants were assessed by surface plasmon resonance on a Biacore T-200 (GE Healthcare) at 20° C. with buffer HBS-EP+(10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.05% surfactant P-20).
[0540] For assessing binding of trimer to CD41 antibody 17b and HR2-reactive peptide C34, mouse anti-human Fc antibody was first immobilized onto two flow cells on a CM5 chip at ˜10,000 response units (RU) with standard amine coupling protocol (GE Healthcare). Either 17b IgG or C34-Ig was then captured on one flow cell by flowing over a 200 nM solution at 5 μl/min flow rate for two minutes. The other flow cell was used as reference. To block unliganded mouse anti-human Fc antibody, this was followed by a 1-minute injection of 1 μM human Fc on both flow cells. 500 nM unliganded trimer (−CD4) or a complex of 500 nM trimer+1500 nM sCD4 (+CD4) was flowed over the sample flow at a flow rate of 50 μl/min for 2 minutes and allowed to dissociate for 5 minutes. The cells were regenerated with two 10 μl injections of 3.0 M MgCl2, pH 7.5 at a flow rate of 100 μl/min. Blank sensorgrams were obtained by injection of the same volume of HBS-EP+ buffer. Sensorgrams were corrected with corresponding blank curves.
[0541] For assessing binding of trimer to sCD4, single-cycle kinetics analyses were carried out. First, ˜2000RU of antibody 2G12 were immobilized on two flow cells. Next, 200 nM of trimer was injected on the sample flow cell. Finally, 5 concentrations of sCD4 (100 nM, 50 nM, 25 nM, 12.5 nM, 6.25 nM) were injected incrementally in a single cycle, starting from the lowest concentration, followed by a dissociation phase of 30 min. Blank sensorgrams were obtained by injection of same volume of HBS-EP+ buffer in place of sCD4. Sensorgrams of the concentration series were corrected with corresponding blank curves and fitted globally with Biacore T200 evaluation software using a 1:1 Langmuir model of binding.
[0542] For assessing affinity and kinetics of antibody 17b binding, trimer was captured onto a 2G12 surface that was obtained by capturing 2G12 IgG on a flow cell immobilized with ˜10,000 response units (RU) of mouse anti-human Fc antibody. To block unliganded mouse anti-human Fc antibody, this was followed by a 1-minute injection of 1 μM human Fc on both flow cells. Binding to 17b Fab was carried out in the single-cycle kinetics format with successive injections of 5 concentrations of 17b Fab. Blank sensorgrams were obtained by injection of the same volume of HBS-EP+ buffer in place of antibody Fab fragments. Sensorgrams of the concentration series were corrected with corresponding blank curves and fitted globally with Biacore T200 evaluation software using a 1:1 Langmuir model of binding.
[0543] For determining the time-course of CD4 activation of the soluble timers, 17b IgG, 3074 IgG and 2G12 IgG were captured on three separate flow cells of a CM5 chip immobilized with ˜10,000 RU of mouse anti-human Fc antibody. Trimers were incubated in 4-fold molar excess of sCD4 and samples were injected at different time-points. Blank sensorgrams were obtained by injection of same volume of HBS-EP+ buffer in place of trimer. To measure any change in the trimer samples on incubation, unliganded trimers were injected before and 72 hours after start of the experiment.
[0544] Biolayer interferometry analysis. A fortéBio HTX instrument was used to measure affinities of BG505 SOSIP.664 and the 201C-430C variant to a panel of HIV-1 Env reactive antibodies at 30° C. All assays were carried out with agitation set to 1,000 rpm in PBS supplemented with 1% BSA (PBS/1% BSA) using solid black 96-well plates (Geiger Bio-One). For the quaternary-specific antibodies CAP256-VRC26.09 and PGT145, the IgG (40 μg/ml) was directly immobilized onto an anti-human capture sensor for 300 s. Typical capture levels were between 1.2 and 1.4 nm, and variability within a row of eight tips did not exceed 0.1 nm. Biosensor tips were then equilibrated for 300 s in PBS/l % BSA buffer prior to assessment of binding to the HIV-1 trimer molecules in solution (0.015 to 0.5 μM). Association was allowed to proceed for 300 s followed by dissociation for 300 s. Dissociation wells were used only once to prevent contamination. Parallel correction to subtract systematic baseline drift was carried out by subtracting the measurements recorded for a sensor loaded with the respiratory syncytial virus (RSV)-specific antibody D25 incubated in PBS/1% BSA.
[0545] For all other binding studies, 2G12 (60 μg/ml) was immobilized onto an anti-human capture sensor for 300 s (typical loading levels 1.0 nm) followed by incubation with either the BG505.SOSIP or the 201C-433C variant for 600 s (resulting in loading levels of ˜0.8 nm). The 2G12: HIV-1 Env complex was then allowed to associate with Fab molecules (2.5 μM-0.2 μM) in PBS/1% BSA for 300s followed by dissociation for 300-1800 s. A D25:RSV fusion glycoprotein complex was used to control for non-specific binding of the Fab molecules. Data analysis and curve fitting were carried out using Octet software, version 8.1. Experimental data were fitted with the binding equations describing a 1:1 interaction. Global analyses of the complete data sets assuming binding was reversible (full dissociation) were carried out using nonlinear least-squares fitting allowing a single set of binding parameters to be obtained simultaneously for all concentrations used in each experiment.
[0546] Negative-stain electron microscopy. Negative-stain electron microscopy samples were diluted to about 0.03 mg/ml, adsorbed to a freshly glow-discharged carbon-film grid for 15s, and stained with 0.7% uranyl formate. Images were collected semi-automatically using SerialEM44 on a FEI Tecnai T20 with a 2 k×2 k Eagle CCD camera at a pixel size of 0.22 nm/px. Particles were picked automatically and reference-free 2D classification was performed in EMAN245.
[0547] Differential scanning calorimetry. The heat capacity of BG505 SOSIP.664 and BG505 SOSIP.664.201C-433C was measured as a function of temperature using a high-precision differential scanning VP-DSC microcalorimeter (GE Healthcare/Microcal, Northampton, Mass.). The samples were extensively dialyzed against PBS, pH 7.4, and then degassed to avoid the formation of bubbles in the calorimetric cells. Thermal denaturation scans were conducted from 10 to 100° C. at a rate of 1° C./min. The protein concentration was about 0.3 mg/mL.
[0548] Analytical ultracentrifugation equilibrium measurements. Analytical ultracentrifugation (AUC) equilibrium experiments were performed at 15° C., using a Beckman XL-A/I ultracentrifuge equipped with a Ti60An rotor. Data was collected using UV absorbance at 230 nm. Samples were dialyzed in Na2HPO4 10 mM, NaCl 140 mM, pH 7.4 overnight at 4° C. and loaded into six-channel equilibrium cells with parallel sides and quartz windows. 120 μL aliquots of sample diluted to 0.25 (78), 0.16 (51) and 0.087 (27) μM (μg/mL) were loaded, respectively, into three channels A, B and C of the cell, with three of the channels used for buffer reference. Samples were spun at 5000 rpm (9810*g) for 20 hours, after which four scans were collected at a rate of 1 per hour. The rotor speed was then increased to 6500 rpm (12750*g) for 10 hours, after which four additional scans were collected at the same rate. The speed was further increased to 8000 rpm (15690*g) for another 10 hours and four more scans were recorded under the same conditions. During the last step, the rotor speed was increased to 10000 rpm (19620*g) for four more scans, resulting in a total of 16 scans for each concentration and a total of 48 scans per protein. The data was processed and analyzed using HeteroAnalysis 1.1.44 software (biotech.uconn.edu/auf) and SEDPHAT46. Buffer density and protein v-bars were calculated using the SednTerp (Alliance Protein Laboratories) software. The data for all concentrations and speeds were globally fit using nonlinear regression to an ideal monomer model. Hydrogen Deuterium Exchange (HDX). The hydrogen-deuterium exchange rates for BG505 SOSIP.664 and the DS-SOSIP.664 both alone and in the presence of CD4 were assessed. Complexes with soluble CD4 (D1D2) were formed by overnight incubation with a nine-fold molar excess of ligand (relative to trimer). Proteins (10 μg) were diluted 10-fold into deuterated PBS buffer and incubated at room temperature. Aliquots removed after 3 s, 1 min, 30 min and 20 h were quenched by mixing with an equal volume of cold 200 mM Tris-2-carboxyethyl phosphine (TCEP), 0.2% formic acid (final pH 2.5). The samples were subsequently digested with pepsin (at 0.15 mg/mL) for 5 min on ice, flash frozen in liquid nitrogen, and stored at ˜80° C. For LC-MS analysis, samples were thawed on ice for 5 minutes and manually injected onto a Waters BEH 1.7 μm 1.2×5 mm trap column (Waters) flowing 0.1% TFA at 200 μL/min. After 3 minutes of washing the peptides were resolved over a Hypersil 1×50 mm 2.1 μm C18 column (Thermo Scientific) using a gradient of 15 to 40% B in 8 minutes (A: 0.05% TFA 5% ACN; B: 0.05% TFA 80% ACN). Eluted peptides were analyzed with a Waters Synapt Q-TOF mass spectrometer. Peptide identification and exchange analysis were as described previously (Guttman et al, Structure, 22, 974-984, 2014).
[0549] Neutralization of viral entry. The point mutations were introduced into full-length Env clone BG505.W6M.C212 in expression vector pcDNA3.1/V5-His-TOPO (Invitrogen). Pseudotyped, single round of entry virus was produced as described in Shu et at (Shu et al., Vaccine, 25, 1398-1408, 2007). Briefly, plasmid DNA was used to transfect 293T cells along with an envelope-deficient HIV-1 subtype A proviral plasmid, SG3dEnv48 to generate pseudotyped viral particles. Serial dilutions of the pseudovirus stocks were added to TZMbl reporter cells, and two days later the activity of the luciferase reporter gene in infected cells was assessed with a Luciferase Assay kit (Promega) and measured in a luminometer; activity was reported as Relative Light Units (RLU).
[0550] smFRET on JR-FL viral spikes. Briefly, HEK293 cells were transfected at a 40:1 ratio of wild-type HIV-1JR-FL or HIV-1JR-FL 201C-433C Env to dually V1-Q3/V4-A1 tagged Env and the additional presence of pNL4-3 Aenv ART. Virus was concentrated from supernatants 40 h post-transfection and dually labelled overnight in a reaction with 0.5 μM Cy3B(3S)-cadaverine, 0.5 μM Cy5(4S)COT-CoA, 0.65 μM transglutaminase (Sigma), and 5 μM AcpS at room temperature. After addition of DSPE-PEG2,000-biotin (Avanti) at 0.02 mg/ml (30 min), the viruses were purified on a 6-18% Optiprep gradient in 50 mM Tris pH 7.4, 100 mM NaCl and stored at −80° C. For smFRET imaging, viruses were immobilized on streptavidincoated quartz microfluidic devices and imaged at room temperature on a wide-field prism-based TIRF instrument equipped with an Opus 532 nm laser (Laser Quantum). Donor and acceptor fluorescence were collected through a 1.27-NA 60× water-immersion objective (Nikon), and recorded using an ORCA-Flash4.0 sCMOS camera (Hamamatsu) at 25 frames/s for 80 s. All smFRET imaging experiments were performed in buffer containing 50 mM Tris pH7.5, 100 mM NaCl, and a cocktail of triplet-state quenchers and oxygen scavengers. The conformational effects of dodecameric sCD4D1D2 (sCD4D1D2-Igatp) on wild-type and HIV-1JR-FL 201C-433C mutant Env were tested after incubation with the ligand for 30 min at 0.01 mg/ml. Histograms were fitted into three-state Gaussian curves; and occupancies of each FRET state were calculated from histogram fitting. Following Hidden Markov Modeling, all transitions were displayed in transition density plots (TDP).
[0551] Assessment of physical stability. To assess the physical stability of the closed, prefusion conformation of trimeric BG505 SOSIP and 201C-433C proteins, the proteins were subjected to a variety of pharmaceutically relevant stresses such as extreme pH, high temperature, low and high osmolarity, as well as repeated freeze/thaw cycles. The physical stability of treated BG505 SOSIP and 201C-433C proteins was evaluated by measuring the retention of binding to the quaternary-specific V1V2-directed antibodies CAP256-VRC26.09 and PGT145 and induction of binding to the V3-loop antibody 447.52D and the CD41 antibody 17b which is not observed in the closed prefusion conformation of the SOSIP trimer. The retention of binding to CD4-Ig and VRC01 was also measured. In the pH treatment experiments, HIV-1 proteins were prepared at an initial concentration of 125 μg/ml, and pH was adjusted using either pH 3.5 or pH 10 with 0.5 M citrate, pH 2.8 or 1 M CAPS, pH 10.5 buffer respectively and incubated at room temperature for 60 minutes before returning the pH to pH 7.5 using 1 M Tris, pH 8.5 or 1 M Tris, pH 7.0, respectively. In the temperature treatment experiments, HIV-1 proteins at 125 μg/ml concentration were incubated at 50° C., 70° C. and 90° C. for 60 minutes in PCR cyclers with heated lids to prevent evaporation and ramp rates of 2.5° C./s. To assess antigenic characteristics following extremes of low and high osmolarity, spin desalting columns (Thermo Scientific) were used to buffer exchange the proteins into either 5 mM Tris, pH 7.5, 10 mM NaCl or 3 M MgCl2, pH 7.5. Proteins were incubated at room temperature for 60 minutes before buffer exchange into 1×PBS, pH 7.4 and concentrating the sample to 125 μg/ml concentration. The freeze/thaw treatment was carried out by repeatedly flash freezing protein in liquid nitrogen and thawing at 37° C. ten times. All protein solutions were supplemented with 0.2% BSA for a final HIV-1 protein concentration of 100 μg/ml and antibody binding measurements were carried out using a fortéBio Octet HTX instrument. Assays were performed at 30° C. with agitation set to 1000 rpm in tilted black 384-well plates (Geiger Bio-One) and a volume of 50 μl/well. Anti-human Fc probes were loaded with full-length IgG of the antibodies mentioned above at 50 μg/ml in PBS buffer for 180 seconds, which were then equilibrated for 240 seconds in PBS+0.2% BSA before being used to immobilize treated or untreated BG505 SOSIP and 201C-433C proteins for 300 seconds. Parallel measurements of antibody binding to PBS+0.2% BSA and soluble recombinant Influenza hemagglutinin in PBS+0.2% BSA were used to assess systematic baseline drift and non-specific binding. The fractional degree of retention of quaternary structure integrity is reported as the ratio of steady state binding level before and after stress treatment. To assess the physical stability of the closed, prefusion conformation of trimeric BG505 SOSIP, A433P and 201C-433C proteins over time, we incubated a 40 nM solution of each trimer in HBS-EP+buffer at 4 different temperatures-4° C., 20° C., 37° C. and 42° C. Aliquots were taken at different time points over the course of 10 days, and retention of quaternary structure in the trimers was assessed by SPR by flowing over antibody VRC26.09 captured on an Fc surface. A parallel lane with 2G12 captured on it served as control for equal protein loading. Blank subtractions were carried out as described in the SPR section above. The fractional degree of retention of quaternary structure integrity is reported as the ratio of steady state binding level before and after incubation. Virus-Like Particles ELISAs. ELISAs were performed as described previously 49. Briefly, Immulon II plates were coated overnight at 4° C. with VLPs at 20 times their concentration in transfection supernatants. Wells were washed with PBS and then blocked with 4% bovine serum albumin/10% fetal bovine serum in PBS. Various biotinylated monoclonal antibodies (biotinylated using sulfo-NHSXbiotin, Thermo), and CD4-IgG2 were then titrated in the presence or absence of a fixed concentration of 2 μg/ml soluble CD4. Alkaline phosphatase conjugated to streptavidin (Vector Laboratories, Burlingame, Calif.; to detect biotinylated mAbs) or anti-Fc (Accurate, Westbury, N.Y.; to detect CD4-IgG2) and SigmaFAST p-nitrophenyl phosphate tablets (Sigma) were then used to detect binding. Plates were read at 405 nm.
[0552] Figures. Structure figures were prepared using PYMOL50.
[0553] Coordinates. The atomic coordinates of an asymmetric unit of the crystal structure of the unliganded trimeric HIV-1 Env ectodomain in the prefusion mature closed conformation are recited in Table 3 submitted as an ASCII text named “Table_3.txt” (˜0.7 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014, and have been deposited with the Protein Data Bank as Acc. No. 47MJ. The atomic coordinates of the crystal structure of an unliganded trimeric HIV-1 Env ectodomain in the prefusion mature closed conformation are recited in Table 4 submitted as an ASCII text named “Table_4.txt” (˜2 MB, created on Aug. 7, 2014) in U.S. Provisional Application No. 62/046,059, filed Sep. 4, 2014.
Example 3
Production of IV-1 Env Protein Covalently Linked to Antibody
[0554] This example provides an exemplary protocol for producing a recombinant HIV-1 Env protein covalently linked to a broadly neutralizing antibody.
[0555] HIV-1 Env expression construct were designed to contain a cysteine mutation at a key complementary site at the antibody complex interface and a protease cleavable Streptactin II tag C-terminal of the HIV-1 Env residue 664. The respective antibodies were mutated to contain a cysteine at a key complementary site at the antibody complex interface and the antibody heavy chain had a C-terminal cleavable His6 tag after the Fab region. In the case of covalently linking VRC01 to HIV-1 gp140 trimer, mutations 459C in HIV-1 Env and 60C in VRC01 heavy chain enabled covalent assembly of the complex within the producer cells.
[0556] DNA for the HIV-1 Env, antibody heavy, antibody light and furin were mixed together in a molar ratio of approximately 1:0.25:0.25:0.5 and transfected into suspension HEK 293F cells. 7 days post transfection the supernatants were harvested, clarified and filtered. The media was passed through NiNTA resin and after washing with PBS eluted in 250 mM imidazole. The eluate was passed over a 2 ml streptactin column, washed with 5 ml wash buffer and eluted in 3 ml elution buffer using the manufacturer's buffer formulations. The resulting eluate was concentrated to 1.5 ml and passed through a Superdex S200 gel filtration column equilibrated in phosphate buffered saline and the main peak containing the covalently linked complex was verified to contain the intermolecular disulfide bond by reducing and non-reducing SDS-PAGE. Fractions corresponding to the covalently linked antibody-Env complex were pooled and flash frozen in liquid nitrogen and stored at −80 C.
Example 4
Single Chain HIV-1 Env Proteins
[0557] HIV-1-Env constructs from various strains were synthesized and include the “SOS” mutations (A501C, T605C), the isoleucine to proline mutation at residue 559 (1559P), and the glycan site at residue 332 (T332N); mutating the gp120/gp41 cleavage site to a ten-amino-acid linker; and truncating the C terminus to residue 664 (all HIV-1 Env numbering according to the HXB2 nomenclature). This construct in the case of the BG505 strain is referred to as bC101n.
[0558] The bC101n construct was transfected in HEK 293 F cells using 1 mg plasmid DNA and transfection supernatants were harvested after 7 days, and passed over either a 2G12 antibody- or VRC01 antibody-affinity column. After washing with PBS, bound proteins were eluted with 3M MgCl.sub.2, 10 mM Tris pH 8.0. The eluate was concentrated to less than 5 ml using a Centricon-70 and applied to a Superdex 200 column, equilibrated in phosphate buffered saline. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
[0559] Constructs such as bC101n were also designed with a C-terminal Thrombin cleavage site, His.sub.6-tag, Streptactin II tag to enable purification as described in McLellan et al. Science 340, 1113-1117, 2013. Briefly, supernatants were harvested after 7 days, and passed over NiNTA affinity column. After washing with PBS, bound proteins were eluted with 250 mM imidazole. The eluate was concentrated to less than 3 ml using a Centricon-70 and applied to a 2 ml Streptactin column, equilibrated in phosphate buffered saline. The sample was eluted in 8 ml of elution buffer. The eluate was concentrated to less than 5 ml using a Centricon-70 and applied to a Superdex 200 column, equilibrated in phosphate buffered saline. The peak corresponding to trimeric HWV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
Example 5
Chimeric HIV-1 Env Proteins
[0560] This example describes the design and production of chimeric HIV-1 Env immunogens based on diverse HWV-1 strains. In the context of inducing an immune response in a subject that can control infection across multiple HIV-1 strains, the use of immunogens based on diverse HIV-1 strains can overcome the intrinsic sequence diversity of HIV-1 Env.
[0561] The structural data provided in the prior Examples illustrates that the HIV-1 Env ectodomain in the prefusion mature closed conformation includes a “base” or “platform” including three gp41 molecules, each of which wrap their hydrophobic core around the extended N- and C-termini-strands of gp120 (see, e.g.,
[0562] The interface between the gp41 and gp120 proteins in the HIV-1 Env trimer includes gp120 residues 46-54, 70-75, 84-89, 99, 102, 106, 107, 114, 215, 220-224, 226, 244, 471-473, and 476-477 (“Interface Residue set A”). In
[0563] A chimeric HIV-1-Env construct was synthesized that includes gp120 residues 31-45 and 478-507, and gp41 residues 512-664 from the BG505 strain with SOSIP and 332N substitutions (e.g., as set forth as SEQ ID NO: 3), and the remainder of the gp120 residues (46-477) from the 3301_V1_C24 HIV-1 strain (SEQ ID NO: 751), which is a clade C virus. The protease cleavage site separating gp120/gp41 was mutated to include six arginine residues, and the C-terminus of gp41 was set at position 664 (all HIV-1 Env numbering according to the HXB2 nomenclature). The amino acid sequence of the resulting chimeric Env protein is provided as SEQ ID NO: 384 (3301_V1_C24_bg505-NCgp120+gp41.SOSIP). Additional variants were designed and produced, including a chimeric HIV-1 Env ectodomain trimer having gp41, and gp120 N- and C-terminal region sequences from the BG505 strain (with SOSIP substitutions), with the remaining gp120 sequence from the ZM53, or 25925-2.22 strains. The corresponding chimeric proteins were termed ZM53_BG505-NCgp120_gp41.SOSIP (SEQ ID NO: 386), 25925-2.22_BG505-NCgp120_gp41.SOSIP (SEQ ID NO: 383), and 3301_V1_C24_BG505-NCgp120+gp41.SOSIP (SEQ ID NO: 384). Expression and purification was performed as described in Examples 1 and 2 above.
[0564] A further variant was produced, SEQ ID NO: 382 (CNE58_SU-strandC_bg505-NCgp120+gp41.SOSIP) that includes gp41 and gp120 N- and C-terminal regions (31-45 and 478-507, respectively) from BG505.SOSIP.664, with residues 166-173 (V1V2 strand C) from CAP256 SU, and the rest of gp120 from the CNE58 strain.
[0565] DNA constructs encoding the chimeric Env proteins were transfected in HEK 293 F cells using 1 mg plasmid DNA and 250 μg plasmid encoding Furin as described previously (Sanders, PLoS pathogens 9, e1003618, 2013, incorporated by reference herein). Transfection supernatants were harvested after 7 days, and constructs that ended at residue 664 were purified using a GNA-Lectin affinity column as described in Pejchal et al, Science, 334: 1097-1103, 2011, incorporated by reference herein. Briefly, supernatants were passed over the GNA-lectin-affinity column and after washing with PBS, bound proteins were eluted with 1 M methyl α-D-mannoside. The eluate was concentrated to less than 5 ml using a Centricon-70 and applied to a Superdex 200 column, equilibrated in phosphate buffered saline. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
[0566] Constructs were also designed with a C-terminal Thrombin cleavage site, His.sub.6-tag, Streptactin II tag to enable purification as described in McLellan et al. Science 340, 1113-1117, 2013. Briefly, supernatants were harvested after 7 days, and passed over NiNTA affinity column. After washing with PBS, bound proteins were eluted with 250 mM imidazole. The eluate was concentrated to less than 3 ml using a Centricon-70 and applied to a 2 ml Streptactin column, equilibrated in phosphate buffered saline. The sample was eluted in 8 ml of elution buffer. The eluate was concentrated to less than 5 ml using a Centricon-70 and applied to a Superdex 200 column, equilibrated in phosphate buffered saline. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
[0567] The 3301_V1_C24_bg505-NCgp120+gp41.SOSIP and ZM53_BG505-NCgp120_gp41.SOSIP chimeras had nearly full gp120/gp41 cleavage, as shown by SDS-page (
[0568] Additional variants were designed and produced, including a chimeric HIV-1 Env including a BG505 gp120 sequence with SOSIP substitutions, and a CAP45 gp41 sequence. The sequence of this chimera is provided as SEQ ID NO: 772. Structural analysis of the gp120 and gp41 contacts confirm that there is minimal disruption between the gp120-gp41 interface when substituting this strain. The BG505.SOSIP/CAP45 chimera had nearly full gp120/gp41 cleavage, as shown by SDS-page (
[0569] The neutralization profile of several neutralizing and non-neutralizing antibodies was compared with the antigenic profile of a chimeric HIV-1 Env ectodomain based on the native DU156 virus. As shown in
[0570] Many additional chimeric HIV-1 Env ectodomain proteins were designed and produced, including those provided as SEQ ID NOs: 379-386, 579-595, 764-772, 856-1056, 1077-1098, and 1114-1200. The details of the design of each of these chimeric Env proteins are provided in Table 13. Additional recombinant HIV-1 Env ectodomains including stabilizing substitutions and based on more HIV-1 strains were also produced, including those provided as SEQ ID NOs: 1057-1077. The recombinant HIV-1 Env ectodomains were expressed in cells and the corresponding antigenic characteristics of each ectodomain was evaluated by bind antibody binding assay.
[0571] Binding to several different antibodies was assayed to evaluate the antigenic profile of each the recombinant HIV-1 Env proteins (
[0572]
[0573] Additionally, bioinformatics algorithms were used to identify chimeric HIV-1 Env ectodomains that exhibited relatively strong binding to quaternary-specific antibodies (e.g., VRC26) and relatively weak binding to weakly neutralizing antibodies (e.g., F105). Based on these algorithms, several chimeras of particular interest were identified, including the following:
[0574] DU422.01-chim_d7324.201C-433C (SEQ ID NO: 964)
[0575] ZM106.9-chim_d7324.201C-433C (SEQ ID NO: 1025)
[0576] CH038.12-chim_d7324.201C-433C (SEQ ID NO: 938)
[0577] 16055-2.3-chim_d7324.201C-433C (SEQ ID NO: 872)
[0578] ZM55.28a-chim_d7324.201C-433C (SEQ ID NO: 1098)
[0579] CH117.4-chim_d7324.201C-433C (SEQ ID NO: 940)
[0580] ZM53.12-chim_d7324.201C-433C (SEQ ID NO: 1034)
[0581] 25925-2.22-chim_d7324.201C-433C (SEQ ID NO: 881)
[0582] B1369.9A-chim_d7324.201C-433C (SEQ ID NO: 924)
[0583] 3301.V1.C24-chim_d7324.201C-433C (SEQ ID NO: 888)
[0584] CAP45.G3-chim_d7324.201C-433C (SEQ ID NO: 937)
[0585] C1080.c3-chim_d7324.201C-433C (SEQ ID NO: 930)
[0586] 286.36-chim_d7324.201C-433C (SEQ ID NO: 856)
[0587] MW965.26-chim_d7324.201C-433C (SEQ ID NO: 978)
[0588] CNE55-chim_d7324.201C-433C (SEQ ID NO: 953)
[0589] C4118.09-chim_d7324.201C-433C (SEQ ID NO: 933)
[0590] DU156.12-chim_d7324.201C-433C (SEQ ID NO: 962)
[0591] TH966.8-chim_d7324.201C-433C (SEQ ID NO: 1010)
[0592] 6545.V4.C1-chim_d7324.201C-433C (SEQ ID NO: 908)
[0593] 620345.cl-chim_d7324.201C-433C (SEQ ID NO: 902)
[0594] 0921.V2.C14-chim_d7324.201C-433C (SEQ ID NO: 871)
[0595] AC10.29-chim_d7324.201C-433C (SEQ ID NO: 917)
[0596] QH209.14M.A2-chim_d7324.201C-433C (SEQ ID NO: 990)
[0597] 50 MB201.A1-chim_d7324.201C-433C (SEQ ID NO: 973)
[0598] These chimeras include gp120 sequences from several different HIV-1 subtypes, including subtype A (BI369.9A, MB201.A1, QH209.14M.A2), subtype B (AC10.29), subtype C (0921.V2.C14, 16055-2.3, 25925-2.22, 286.36, CAP45.G3, DU156.12, DU422.01, MW965.26, ZM53.12, ZM55.28a, ZM106.9), subtype CRF AC (3301.V1.C24, 6545.V4.C1), subtype CFR AE (620345.c1, C1080.c3, C4118.09, CNE55, TH966.8) and subtype CRF BC (CH038.12, CH117.4). Thus, these results demonstrate that the strategies for stabilizing chimeric HIV-1 Env ectodomains in the prefusion mature closed conformation disclosed herein can be applied across a diverse array of HIV-1 strains.
[0599] Based on the antigenic characteristics of the assayed chimeras, additional chimeric HIV-1 Env ectodomains were constructed. By comparing the sequences for assayed chimeras with good antigenic characteristics (e.g., strong binding to VRC26 and low binding to F105) to chimeras with poor antigenic characteristics (e.g., low binding to VRC26 and strong binding to F105), residue positions within gp120 that had different amino acid composition in the former vs. the latter set of chimeras were identified using bioinformatics algorithms. In a non-limiting embodiment, such residue positions included Residue Set B (SEQ 1114-1142): 133-134, 164, 169, 308, and 316 from BG505. In another non-limiting embodiment, such residue positions included the expanded set Residue Set C (SEQ 1143-1171: 49, 133-134, 149-152, 164,169, 188, 190, 211, 223, 252, 281, 293, 308, 316, 336, 340, 352, 360,362-363,369,372, 393, 410, 432, 442, 444, 446, 474, and 476 from BG505. In another non-limiting embodiment, such residue positions included the expanded set Residue Set C+Residue Set D (SEQ 1172-1200): 46, 60, 62-63, 84-85, 87, 99, 102, 130, 132, 135, 153, 158, 160-161, 165-167, 171-173, 175, 177-178, 181, 184-185, 189, 202, 232, 234, 236, 240, 268-271, 275, 277, 287, 289, 292, 295, 297, 305, 315, 317, 319, 322, 328, 330, 332-335, 337, 339, 343-347, 350-351, 357, 371, 375, 379, 387, 389, 394, 411, 412-413, 415, 424, 426, 429, 440, 460-461, 465, 475, and 477 from BG505.
Example 6
Protein Nanoparticles Including Recombinant HIV-1 Env Proteins
[0600] This example provides an exemplary protocol for producing a protein nanoparticle including a recombinant HIV-1 Env protein that is stabilized in a prefusion mature conformation.
[0601] BG505 SOSIP.664 linked to nanoparticles (e.g. Ferritin) was cotransfected with furin in HEK 293 S GnTI−/− cells using 500 μgs plasmid DNA and 125 μgs of furin. Transfection supernatants were harvested after 7 days, and passed over either a 2G12 antibody- or VRC01 antibody-affinity column. After washing with PBS, bound proteins were eluted with 3M MgCl.sub.2, 10 mM Tris pH 8.0. The eluate was concentrated to less than 5 ml with Centricon-70 and applied to a Superdex 200 column, equilibrated in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide. The peak corresponding to the nanoparticle size was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C.
[0602] Alternatively, other methods as described in Kanekiyo et al., Nature, 499, 102-106, 2013, incorporated by reference herein, can be used to purify nanoparticles including recombinant HIV-1 Env proteins.
Example 7
Immunization of Animals
[0603] This example describes exemplary procedures for the immunization of animals with the disclosed immunogens, and measurement of the corresponding immune response.
[0604] In some examples nucleic acid molecules encoding the disclosed immunogens are cloned into expression vector CMV/R. Expression vectors are then transfected into 293F cells using 293Fectin (Invitrogen, Carlsbad, Calif.). Seven days after transfection, cell culture supernatant is harvested and passed over either a 2G12 antibody- or VRC01 antibody-affinity column. After washing with PBS, bound proteins were eluted with 3M MgCl.sub.2, 10 mM Tris pH 8.0. The eluate was concentrated to less than 5 ml with Centricon-70 and applied to a Superdex 200 column, equilibrated in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C. Some proteins are purified using HiTrap IMAC HP Column (GE, Piscataway, N.J.), and subsequent gel-filtration using SUPERDEX™ 200 (GE). In some examples the 6× His tag is cleaved off using 3C protease (Novagen, Madison, Wis.). For vaccinations with the disclosed immunogens 4-6 months old guinea pigs (Strain Hartley)(Charles River Laboratories, Mass.) are immunized using polyIC (High molecular weight, InvivoGen Inc, CA) as the adjuvant. Specifically, four guinea pigs in each group are vaccinated with 25 μg of protein and 100 μg of polyIC in 400 μl intramuscularly (both legs, 200 μl each leg) for example at week 0, 4, 8, 12, 22. Sera are collected for example at week 2 (Post-1), 6 (Post-2), 10 (Post-3), 14 (Post-4) and 24 (Post-5), and subsequently analyzed for their neutralization activities against a panel of HIV-1 strains, and the profile of antibodies that mediate the neutralization. The immunogens are also used to probe for guinea pig anti-sera for existence of HIV-1 neutralizing antibodies in the anti-sera, such as antibodies that compete for binding to the recombinant HIV-1 Env ectodomain trimer with PGT122, PGT145, PGT151, and/or VRC26.
Example 8
Immunization of Non-Human Primates
[0605] This example describes exemplary procedures for the immunization of non-human primates with the disclosed immunogens, and measurement of the corresponding immune response.
[0606] In some examples nucleic acid molecules encoding the disclosed immunogens are cloned into expression vector CMV/R. Expression vectors are then transfected into 293F cells using 293Fectin (Invitrogen, Carlsbad, Calif.). Seven days after transfection, cell culture supernatant is harvested and passed over either a 2G12 antibody- or VRC01 antibody-affinity column. After washing with PBS, bound proteins were eluted with 3M MgCl.sub.2, 10 mM Tris pH 8.0. The eluate was concentrated to less than 5 ml with Centricon-70 and applied to a Superdex 200 column, equilibrated in 5 mM HEPES, pH 7.5, 150 mM NaCl, 0.02% azide. The peak corresponding to trimeric HIV-1 Env was identified, pooled, and concentrated or flash-frozen in liquid nitrogen and stored at −80° C. Some proteins are purified using HiTrap IMAC HP Column (GE, Piscataway, N.J.), and subsequent gel-filtration using SUPERDEX™ 200 (GE). In some examples the 6× His tag is cleaved off using 3C protease (Novagen, Madison, Wis.). For vaccinations with the disclosed immunogens, Indian origin Rhesus Macaque (bodyweights more than 2 kg) are immunized with polyIC-LC as the adjuvant. Specifically, five monkeys in each group are vaccinated with 100 μg of protein and 500 μg polyIC-LC in 1 ml intramuscularly in the Quadriceps muscle for example at week 0, 4, 20. Sera are collected for example at week 2 (Post-1), 6 (Post-2), 24 (Post-3), and subsequently analyzed for their neutralization activities against a panel of HIV-1 strains, and the profile of antibodies that mediate the neutralization. The immunogens are also used to probe for Rhesus Macaque anti-sera for existence of HIV-1 neutralizing antibodies in the anti-sera, such as antibodies that compete for binding to the recombinant HIV-1 Env ectodomain trimer with PGT122, PGT145, PGT151, and/or VRC26.
Example 9
Assaying Serum Neutralization Activity
[0607] Following immunization with a disclosed immunogen (e.g., as described above) serum can be collected at appropriate time points, frozen, and stored for neutralization testing. The serum neutralization activity can be assayed using various assays, such as a pseudoviruses neutralization assay.
[0608] In some embodiments, the serum neutralization activity can be assayed essentially as previously described (see, e.g., Georgiev et al., Science, 340, 751-756, 2013, which is incorporated by reference herein in its entirety). Briefly, frozen serum from the immunized subject is heat-inactivated at 56° C. for 30 min prior to the assay. Pseudovirus stocks are prepared by co-transfection of 293T cells with an HIV-1 Env-deficient backbone and an expression plasmid for the Env gene of interest. The serum to be assayed is diluted in Dulbecco's modified Eagle medium-10% FCS (Gibco) and mixed with pseudovirus. After 30 min, 10,000 TZM-bl cells are added, and the plates are incubated for 48 hours. Assays are developed with a luciferase assay system (Promega, Madison, Wis.), and the relative light units (RLU) are read on a luminometer (Perkin-Elmer, Waltham, Mass.). The percent neutralization is calculated as follows: % neutralization=100×(V.sub.0−V.sub.n)/V.sub.o, where V.sub.n is the RLU in the virus and antibody wells and V.sub.0 is the RLU in the virus-only wells. The reciprocal dilution at which 50% of the virus is neutralized (ID50) is computed for each virus-serum pair. To account for background, a cutoff of ID50>=40 is used as a criterion for the presence of serum neutralization activity against a given virus.
[0609] Standard panels of Env proteins from selected HIV-1 strains have been developed for co-expression with the Env-deficient backbone in the neutralization assay (see, e.g., Georgiev et al., Science, 340, 751-756, 2013, incorporated by reference herein). For example, the standard panel can include Env proteins from HIV-1 strains from Clade A (KER2018.11, Q23.17, Q168.a2, Q769.h5, and RW020.2), Clade B (BaL.01, 6101.10, BG1168.01, CAAN.A2, JR-FL, JR-CSF.JB, PVO.4, THRO4156.18, TRJO4551.58, TRO.11, and YU2), and Clade C (DU156.12, DU422.01, ZA012.29, ZM55.28a, and ZM106.9). An additional standard panel is provided in Table S5 of Georgiev et al. (Science, 340, 751-756, 2013, which is incorporated by reference herein in its entirety) and Table 1 of Seaman et al., J. Virol., 84, 1439-1452, 2005, which is incorporated by reference herein in its entirety).
Example 10
Treatment of Subjects
[0610] This example describes methods that can be used to treat a subject that has or is at risk of having an infection from HIV-1 that can be treated by eliciting an immune response, such as a neutralizing antibody response to HIV-1. In particular examples, the method includes screening a subject having, thought to have or at risk of having a HIV-1 infection. Subjects of an unknown infection status can be examined to determine if they have an infection, for example using serological tests, physical examination, enzyme-linked immunosorbent assay (ELISA), radiological screening or other diagnostic technique known to those of skill in the art. In some examples, subjects are screened to identify a HIV-1 infection, with a serological test, or with a nucleic acid probe specific for a HIV-1. Subjects found to (or known to) have a HIV-1 infection can be administered a disclosed immunogen (such as a recombinant HIV-1 Env stabilized in a prefusion mature closed conformation) that can elicit an antibody response to HIV. Subjects may also be selected who are at risk of developing HIV, such as subjects exposed to HIV.
[0611] Subjects selected for treatment can be administered a therapeutic amount of a disclosed immunogen as disclosed herein. For example, a disclosed HIV-1 Env protein stabilized in a prefusion mature closed conformation can be administered at doses of 0.5 μg/kg body weight to about 1 mg/kg body weight per dose, such as 1 μg/kg body weight-100 μg/kg body weight per dose, 100 μg/kg body weight-500 μg/kg body weight per dose, or 500 μg/kg body weight-1000 μg/kg body weight per dose. However, the particular dose can be determined by a skilled clinician. The immunogen can be administered in one or several doses, for example in a prime-boost vaccination. The mode of administration can be any used in the art. The amount of agent administered to the subject can be determined by a clinician, and may depend on the particular subject treated. Specific exemplary amounts are provided herein (but the disclosure is not limited to such doses).
Example 11
Inducing a Neutralizing Immune Response in an Animal Model
[0612] This example provides data showing that a HIV-1 Env ectodomain timer stabilized in the prefusion mature conformation can induce a neutralizing immune response in multiple animal models.
[0613] Two months old Hartley guinea pigs (four animals per study group) or New Zealand white rabbits (five animals per study group) were immunized at weeks 0, 4, and 16, as follows: Guinea pigs
[0614] 1) BG505 SOSIP (25 μg) and polyIC (100 μg) as adjuvant
[0615] 2) BG505 SOSIP DS (25 μg) and polyIC (100 μg) as adjuvant
[0616] 3) BG505 SOSIP (25 μg) and Matrix M (25 μg) as adjuvant
[0617] 4) BG505 SOSIP DS (25 μg) and Matrix M (25 μg) as adjuvant Rabbits
[0618] 1) BG505 SOSIP (30 μg) and Matrix M (30 μg) as adjuvant
[0619] 2) BG505 SOSIP DS (30 μg) and Matrix M (30 μg) as adjuvant
[0620] Serum collected from immunized rabbits (
[0621] Serum collected at weeks 6 and 18 was also tested for neutralization activity against a panel of HIV-1 strains (
Methods
[0622] Immunogen preparation. HIV-1 Env timer preparation was performed substantially as described in Example 2. The BG505.SOSIP.664 HIV-1 Env ectodomain trimer (SEQ ID NO: 3) or the BG505.SOSIP.664.201C-433C HIV-1 Env ectodomain trimer (SEQ ID NO: 26) were used. Trimers were purified by affinity chromatography over a VRC01 column, purified by gel filtration over a Superdex 200 16/60 (GE Healthcare) column in buffer containing 5 mM HEPES 7.5, 150 mM NaCl, and 0.02% NaN3, and finally, passed through a 447-52D column to remove aberrant trimer species (as described in Example 2 and illustrated in
[0623] Immunizations. Guinea pig injections consisted of 25 μg of Env trimer formulated in a 400 ul volume in PBS, with 100 μg of PolyIC adjuvant (HMW, Invivogen) or 25 μg Matrix M (Novavax; see Reimer et al., PLoS One, 7(7):e41451, 2012). For rabbit studies, 30 μg of Env trimer was formulated with 30 μg Matrix M in a 1 ml volume in PBS. The immunization was administered intramuscularly as two separate injections into each quadriceps. PolyIC adjuvant was prepared by making a 2 mg/ml stock solution in saline, heating the necessary amount for 10 min at 70° C., and cooling at room temperature for 1 hour prior to injection. Immunizations were performed on weeks 0, 4, and 16. Blood draws for immune assessment included a prebleed −1 week sample, followed by blood draws 2 weeks after each immunization. Collected sera were heat inactivated for 1 hour at 56° C. before being analyzed.
[0624] Enzyme-Linked Immunosorbent Assays (ELISAs) for Anti-V3 Peptide Responses. 96 well plates (Reacti-Bind®, Pierce) were coated with 100 μl/well of 2 μg/ml peptide in PBS overnight at 4° C. (MW965.26 V3 peptide: TRPNNNTRKSIRIGPGQTFYATG (residues 265-287 of SEQ ID NO: 2); BG505 V3 peptide: TRPNNNTRKSIRIGPGQAFYATG (residues 296-318 of SEQ ID NO: 2), amino acid difference underlined). For each consecutive step following coating, plates were washed 5 times with PBS-T (PBS+0.05% tween) and incubated at 37° C. for 1 hour. After coating, plates were blocked with 200 μl/well of blocking buffer (B3T: 150 mM NaCl, 50 mM Tris-HCl, 1 mM EDTA, 3.3% fetal bovine serum, 2% bovine albumin, 0.07% Tween 20, 0.02% thimerosal). Next, guinea pig sera was diluted in B3T and added in 5-fold serial dilutions to the plates. Then goat anti-guinea pig antibody conjugated with horseradish peroxidase (KPL, Gaithersburg, Md.,) at a 1:10,000 dilution in B3T was added to each well. TMB substrate (SureBlue™, KPL, Gaithersburg, Md., cat #52-00-03) was used to develop plates for 10 minutes before 1N sulfuric acid was added to stop the reaction without washing beforehand. Plates were read at 450 nm (Molecular Devices, SpectraMax using SoftMax Pro 5 software) and the final optical density was determined after the horseradish peroxidase nonspecific background binding was subtracted.
[0625] D7324-Capture Enzyme Linked Immunosorbent Assays (ELISAs) for Anti-BG505 Envelope Trimer Responses. 96 well plates (Reacti-Bind®, Pierce) were coated with 100 μl/well of 2 μg/ml of anti-D7324 antibody (Aalto Bioreagents, Dublin, Ireland) in PBS overnight at 4 degrees Celsius. After coating, plates were blocked for 1 hour at room temperature with PBS+5% skim milk (Difco, Bectin, Dickinson and Company). Plates were then washed five times with PBS-T (PBS+0.2% tween-20) before adding 0.5 μg/ml of BG505 SOSIP.664-D7324 trimer diluted in PBS+10% FBS for two hours at room temperature. After the addition of the trimer, subsequent procedures mimic the anti-V3 ELISAs except dilutions were made in PBS-T instead of B3T.
[0626] HIV-1 Neutralization Assays. Sera from immunized animals were assessed for virus neutralization using previously described methods (Li et al., J. Virol., 79, 10108-10125, 2005). In the single round infection assay, a reduction in a luciferase luminescence indicates neutralization activity. Target cells were TZM-bl cells, which are a clonal HeLa cell line expressing CD4, CXCR4 and CCR5. Upon infection, the HIV-1 viral protein Tat induces a luciferase reporter gene, whose expression is measured as relative light units. Data are represented as the inhibitory reciprocal dilutions of sera required to inhibit either 50% of infection (IC.sub.50), calculated using a regression fit as previously described.
Example 12
Membrane Anchored HIV-1 Env Ectodomain Trimers
[0627] This example illustrates production and antigenicity of exemplary HIV-1 Env ectodomain trimers stabilized in a prefusion mature closed conformation that include a transmembrane domain for anchoring to the cell surface. Numerous HIV-1 Env ectodomain trimers stabilized in a prefusion mature closed conformation were linked to a transmembrane domain and expressed in cells for anchoring to the cell membrane, as listed below. Variation within the membrane anchored sequences includes strain (including chimeras), single chain or not (e.g., sc15ln (15 A.A. linker between gp120/gp41), sc101n (10 A.A. linker between gp120/gp41)), stabilizing mutations (e.g., SOS, DS, IP, or combinations thereof), linker between position 664 and the TM domain (e.g., MPER sequence, or 10 ln (10 A.A. linker)), TM domain (e.g, HA or HIV-1 TM), and presence or absence of a cytoplasmic tail. Exemplary constructs are listed below
[0628] TH966.8-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1765)
[0629] 6545.V4.C1-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1766)
[0630] R2184.c4-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1767)
[0631] ZM197.7-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1768)
[0632] ZM106.9-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1769)
[0633] ZM53.12-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1770)
[0634] R2184.c4-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1771)
[0635] CNE55-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1772)
[0636] 6545.V4.C1-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1773)
[0637] DU422.01-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1774)
[0638] 25925-2.22-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1775)
[0639] CNE58-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1776)
[0640] 16055-2.3-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1777)
[0641] TH966.8-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1778)
[0642] ZM55.28a-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1779)
[0643] ZM53.12-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1780)
[0644] B1369.9A-chim_sc10ln-IP-10ln-HATM (SEQ ID NO: 1781)
[0645] ZM197.7-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1782)
[0646] 16055-2.3-chim_sc10ln-IP-MPER-TM (SEQ ID NO: 1783)
[0647] ZM55.28a-chim_sc15ln-SOS-DS-10ln-HATM (SEQ ID NO: 1784)
[0648] A FACS-based assay was used to interrogate the antigenicity of the membrane anchored HIV-1 Env ectodomain trimers. Briefly, expression vectors encoding an immunogen of interest were transfected into cells in a 96-well format. The cells were harvested 2 or 3 days following transfection, and stained with antibodies specific for trimeric HIV-1 Env (such as VRC26, PGT145, or PGT151), non-trimer specific but broadly neutralizing antibodies (such as VRC01 or PGT128) and non-trimer specific poorly neutralizing antibodies (such as 447-52D). The cells were then stained with appropriate secondary antibody, and analyzed by FACS to assay for antigenicity and expression.
[0649]
Example 13
HIV-1 Env Ectodomain Trimer Immunogens Based on Ontogeny of Broadly Neutralizing Antibodies
[0650] This example illustrates chimeric HIV-1 Env ectodomain trimer immunogens stabilized in the prefusion mature closed conformation that include a V1V2 domain sequence that (1) bind to mature broadly neutralizing antibodies that target the V1V2 domain, as well as immature somatic precursors thereof, and that (2) are from a strain of HIV-1 that can be neutralized by V1V2-directed broadly neutralizing antibodies produced by multiple donors.
[0651] Antibodies capable of neutralizing a majority of circulating HIV-1 isolates develop in approximately half of those infected with HIV-1 for over five years (Hraber, P. et al. AIDS 28, 163-9 (2014). Intense interest has focused on these antibodies, as they provide clues to how an effective vaccine might be developed (Burton, D. R. et al. Nat Immunol 5, 233-6 (2004); Haynes, B. F., Kelsoe, G., Harrison, S. C. & Kepler, T. B. Nature biotechnology 30, 423-33 (2012). In specific, broadly neutralizing antibodies (bNAbs)—that arise in multiple donors and share common features of Env recognition and B-cell ontogeny—may have utility as vaccine templates, due to the potential for similar antibodies to be elicited by a common immunogen (or common set of immunogens) in the general population (Kwong, P. D. & Mascola, J. R. Immunity 37, 412-25 (2012), Jardine, J. et al. Science 340, 711-6 (2013).
[0652] An increasing number of such “multidonor” bNAbs have been identified, such as those of the VRC01 class (named for the first antibody of the class), which share ‘class’ features of molecular recognition and B-cell ontogeny (Scheid, J. F. et al., Science 333, 1633-7 (2011); Wu, X. et al., Science 333, 1593-602 (2011); Zhou, T. et al. Immunity 39, 245-58 (2013); Zhou, T. et al., Cell 161, 1280-92 (2015)). This commonality has motivated the development of immunogens, designed to target class-specific features of recognition and to overcome class-specific roadblocks in developmental ontogeny, and success with this strategy has been achieved with immunogens capable of priming the initial stage of VRC01-class development in mouse models (Dosenovic, P. et al. Cell 161, 1505-15 (2015); Jardine, J. G. et al. Science 349, 156-61 (2015), each of which is incorporated by reference herein).
[0653] Structures of the ligand-free forms of these antibodies reveal a protruding third heavy chain complementarity determining region (CDR H3), which is anionic, often tyrosine sulfated, and critical for Env interaction. The epitope appears to be quaternary in nature and to include an N-linked glycan at residue 160 along with strand C of V1V2. In terms of B-cell ontogeny, approximations of the unmutated common ancestor (UCA) have been inferred for V1V2-directed bNAb lineages from donors CH0219 and CAP256 (Bonsignori, M. et al. J Virol 85, 9998-10009 (2011); Doria-Rose, N. A. et al. Nature 509, 55-62 (2014), each of which his incorporated by reference herein), which indicate the long anionic CDR H3 to be a product of recombination. Initial recognition of UCA (or of V-gene reverted approximations) appears to be restricted to select strains of HIV-1 (e.g. CAP256-SU or ZM233), to use similar D genes and in some cases related V genes, and to contain similar motifs (e.g. YYD) in the CDR H3.
[0654] While antibodies against the same supersite of HIV-1 vulnerability often show diverse modes of recognition, bNAbs against the membrane-distal V1V2 apex of pre-fusion closed conformation of HIV-1 Env appear to share a number of characteristics. Thus far, V1V2-directed bNAbs have been identified in four donors: the CH0219 donor, with bNAbs CH01-CH04 (Bonsignori, M. et al. J Virol 85, 9998-10009 (2011)); the CAP256 donor, with bNAbs CAP256-VRC26.01-12 (Doria-Rose, N. A. et al. Nature 509, 55-62 (2014); the IAVI 24 donor, with bNAbs PG9 and PG16 (Walker, L. M. et al. Science 326, 285-9 (2009); and the IAVI 84 donor with bNAbs PGT141-145 (Walker, L. M. et al. Nature 477, 466-70 (2011) and PGDM1400-1412 (Sok, D. et al. Recombinant HIV envelope trimer selects for quaternary-dependent antibodies targeting the trimer apex. Proc Natl Acad Sci USA 111, 17624-9 (2014).
[0655] Neutralization screening with UCA and intermediates of V1V2-directed bNAbs was used to engineer antigens capable of interacting with developmental intermediates. Altogether the structural similarities in antibody recognition along with ontogeny similarities (and differences) in development indicate the V1V2-directed bNAbs to form an ‘extended class’, which do not necessarily share genetic commonalities, but nonetheless display a characteristic mode of antigen interaction. Extended-class immunogens—such as the soluble chimeric trimers disclosed herein through an ontogeny-based chimera strategy-provide a general means for eliciting bNAbs against specific sites of Env vulnerability.
V1V2 Chineras
[0656] Several HIV-1 Env molecules that specifically bind to mature broadly neutralizing antibodies that target the V1V2 domain, as well as immature somatic precursors thereof, were identified (
[0657] With regard to
[0658] HIV-1 strains neutralized by the broadly neutralizing antibody revertants shown in
TABLE-US-00009 Mature Non-Mature Intermediate Germline and Earliest Strain All Abs Abs Abs Abs UCA Abs neutralizers Fold enhancement of interaction probability for each selected strain WITO.33 2.07 1.23 4.28 3.45 14.98 23.02 ZM233.6 2.24 1.63 4.28 2.3 29.96 23.02 T250-4 2.36 1.63 4.28 4.6 0 11.51 CH070.1 1.77 1.23 3.21 2.3 14.98 11.51 BB201.B42 2.07 1.63 3.21 2.3 14.98 11.51 KER2018.11 2.07 1.63 3.21 2.3 14.98 11.51 Q23.17 2.07 1.63 3.21 2.3 14.98 11.51 A244 2.36 1.63 4.28 3.45 14.98 11.51 CAP256.SU 2.07 1.63 3.21 3.45 0 11.51 Fold enhancement of interaction probability for using the nine selected strains 3.25 1.63 7.48 5.76 29.96 46.04
[0659] Chimeric HIV-1 Env ectodomain timer immunogens were produced that include the V1V2 domain sequence (positions 126-196) of the CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strains of HIV-1, with the remainder including BG505.SOSIP.DS.368R sequence (including gp120 positions 31-125 and 197-511 and gp41 positions 512-644), as follows: Q23.17 chimera (SEQ ID NO: 2126), ZM233.6 chimera (SEQ ID NO: 2125), WITO.33 chimera (SEQ ID NO: 2128), A244 chimera (SEQ ID NO: 2127), BB201.B42 chimera (SEQ ID NO: 2122), KER2018.11 chimera (SEQ ID NO: 2123), CH070.1 chimera (SEQ ID NO: 2124), CAP256.SU chimera (SEQ ID NO: 2121), and T-250-4 chimera (SEQ ID NO: 2129).
[0660] The transplanted V1V2 region is illustrated in
426c and d45-01dG5 Chimeras
[0661] Additional chimeras were generated that combine the BG505 “platform” described in Example 5, with a V1V2 domain from a CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33 strain as described in this example, with the remainder of the gp120 portion of the HIV-1 Env ectodomain from a HIV-1 Env molecule known to interact with mature and UCA forms of VRC01-class antibodies (such as Env from the clade C 426c strain with N276D, N460D, N463D substitutions (see Wu et al., Cell, 161, 470-485, 2015, which is incorporated by reference herein), or Env from the clade B d45-01dG5 strain (see McGuire et al., J Exp. Med., 210, 655-663, 2013, incorporated by reference herein).
[0662] The amino acid sequence of 426c Env with N276D, N460D, N463D substitutions is provided as SEQ ID NO: 2144. The amino acid sequence of d45-01dG5 Env is provided as SEQ ID NO: 2145. These ectodomain trimers have unique antigenic characteristics that provide for binding to mature and UCA forms of multiple classes or broadly neutralizing antibodies (targeting the CD4 binding site and the V1V2 domain) and can be used to induce an immune response to HIV-1 Env in a subject. These immunogens are of particular interest for use as a “prime” immunogen in a prime-boost immunization protocol for eliciting an immune response to HIV-1 Env.
[0663] The chimeric Env ectodomains included the sequences from the following (HXB2 numbering):
For the 426c chimera:
[0664] BG505 “platform”: 31-45 and 478-507, 512-664;
[0665] V1V2 domain: positions 126-196 from CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33
[0666] 426c: 46-125, 197-478
[0667] This chimeric Env ectodomain further included SOSIP substitutions, DS substitutions (201C/433C), and N276D, N460D, N463D substitutions to eliminate the glycosylation sites at positions 276, 460, 463.
For the d45-01dG5 chimera:
[0668] BG505: 31-45 and 478-507, 512-664 with SOSIP substitutions;
[0669] V1V2 domain: 126-196 positions 126-196 from CAP256.SU, BB201.B42, KER2018.11, CH070.1, ZM233.6, Q23.17, A244, T250-4, or WITO.33
[0670] This chimeric Env ectodomain further included SOSIP substitutions and DS substitutions (201C/433C). The donor 45_01dG5 Env naturally lacks a glycan at 276 and 460 and this is sufficient to allow UCA forms of VRC-01 class antibodies to bind. Specific examples of sequences of such chimeric HIV-1 Env ectodomains are provided as SEQ ID NOs: 2146-2159.
[0671] As proof-of-principle, a chimera was generated that includes the BG505 “platform” (positions 31-45 and 478-507, 512-664), with the remainder of gp120 from the 426c strain with mutations of the glycan sequon at positions 276, 460 and 463, and the “DS” substitutions (201C/433C) and tested antigenically (
[0672] UCA and intermediate matured antibodies related to known broadly neutralizing antibodies that can be used to interrogate the antigenicity of the disclosed chimeras are known. Non-limiting examples include UCA and intermediate matured antibodies related to VRC26, PGT145, CH01, PG9 (see, e.g., Alam et al., PNAS, 110, 18214-9, 2013; Bonsignori et al, J Virol, 85, 9998-10009, 2011; Bonsignori et al, J Virol, 86, 4688-4692, 2012; doria-rose et al, Nature, 509, 55-62, 2014; Pancera et al., J Virol, 84, 8098-8110, 2010; Walker et al., Nature, 477, 466-470, 2011; each of which is incorporated by reference herein) and VRC01 (see, e.g., Jardine, J. et al. Science 340, 711-6, 2013, which is incorporated by reference herein).
Example 14
Recombinant HIV-1 Env Ectodomain Trimers Including BG505 and JRFL Sequences
[0673] This example describes chimeric HIV-1 Env ectodomain trimers that include chimeric sequences having a BG505 “platform,” as well as other BG505 structural elements (such as a V1, V2, and/or V3 domain), with the remaining sequence of the HIV-1 ectodomain based on the JRFL strain of HIV-1.
[0674] Chimeric HIV-1 Env ectodomains were expressed that include HIV-1 Env positions 31-507 joined by a 6R cleavable linker to gp41 positions 512-664. The BG505 sequence was used for gp120 positions 31-45 and 478-507 and gp41 residues 512-664. Some constructs also included BG505 residues for “Interface Residue Set A” or “Int. Res. Set A:” gp120 positions 46-54, 70-75, 84-89, 99, 102, 106, 107, 114, 215, 220-224, 226, 244, 471-473, and 476-477. Some constructs also included BG505 sequence for particular structural elements, such as the:
[0675] V1 loop (gp120 positions 119-153)
[0676] V2 loop (gp120 positions 154-205)
[0677] Strand C of the V1V2 domain (gp120 positions 166-173)
[0678] V3 domain (gp120 positions 296-331)
[0679] Positions 191-205
[0680] V2 loop and V3 domain
[0681] Strand C and V3 domain
[0682] Positions 191-205 and Strand C
[0683] V1 and V3
[0684] V1, Strand C, and V3
[0685] V1, V2, and V3
HIV1 Env positions 191-205 are a set of residues in strand D of the V1V2 which forms extensive contacts with the B20-B21 sheets and may help to stabilize the chimeric JRFL molecule. The recombinant HIV-1 Env proteins also included the SOSIP and 201C/433C substitutions (for stabilization) and an E168K substitution to maximize binding to V1V2-directed broadly neutralizing antibodies.
[0686] The JRFL sequence was used for the remaining HIV-1 Env sequence. The following recombinant HIV-1 Env ectodomain trimers were expressed according to methods described in Examples 1 and 2, and their antigenicity was assayed using a panel of antibodies (
TABLE-US-00010 SEQ Name Chimeric positions ID NO JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, V2, V3, gp41 1732 chim, I201C, A433C,_v2_v3 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, V3; gp41 512- 1735 chim, I201C, A433C,_v3 664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1736 chim, +int I201C, A433C,_strC_v3 Strand C, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1738 chim, +int I201C, A433C,_191-205_v3 positions 191-205, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1739 chim, +int I201C, A433C,_v1_v3 positions 191-205, V1, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1741 chim, +int I201C, A433C,_v3 V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1742 chim, +int I201C, A433C,_v2_v3 V2, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1744 chim, +int I201C, A433C,_v1_strC_v3 V1, Strand C, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, V1, V3; gp41 1758 chim, I201C, A433C,_v1_v3 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1759 chim, +int I201C, A433C,_v1_191-205_v3 V1, positions 191-205, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, positions 191- 1760 chim, I201C, A433C,_191-205_v3 205, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1761 chim, +int I201C, A433C,_strC_191-205_v3 Strand C, positions 191-205, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, Int. Res. Set A, 1762 chim, +int I201C, A433C,_v1_v2_v3 V1, V2, V3; gp41 512-664; JRFL: remainder JRFLgp140.6R.SOSIP.664.E168K, BG505 gp41 BG505: gp120 positions 31-45 and 478-507, V1, Strand C, V3; 1763 chim, I201C, A433C,_v1_strC_v3 gp41 512-664; JRFL: remainder
Each of the recombinant HIV-1 Env ectodomain trimers listed in the above table also included the SOSIP, R6, 664, E168K, 1201C, and A433C substitutions.
[0687] As illustrated in
Example 15
[0688] The following table (Table 13) provides a description of sequences provided herein. Sequence of particular interest for use as immunogens to induce an immune response to HIV-1 Env are marked with a
TABLE-US-00011 5 Mutations 1 4 Compared SEQ Native to 6 ID 2 3 Back- Native Additional 7 NO Code Name ground Background mutations Comment 0001 0 HXB2 VIRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVH NVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTD LK NDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVIT QACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEE WI RSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWN NTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSN N TEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGD MRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQA R QLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVP WNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNIT N WLWYIKLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDR SIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSA V SLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL 0002 0 BG505 BG505 MRVMGIQRNCQHLFRWGTMILGMIIICSAAENLWVTVYYGVPVWKDAETTLFCASDAKAYETEKHNV WATHACVPTDPNPQEIHLENVTEEFNMWKNNMVEQMHTDIISLWDQSLKPCVKLTPLCVTLQCTNVT N NITDDMRGELKNCSFNMTTELRDKKQKVYSLFYRLDWQINENQGNRSNNSNKEYRLINCNTSAITQA CPKVSFEPIPIHYCAPAGFAILKCKDKKFNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEVM IR SENITNNAKNILVQFNTPVQINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCTVSKATWNET LGKVVKQLRKHFGNNTIIRFANSSGGDLEVTTHSFNCGGEFFYCNTSGLFNSTWISNTSVQGSNSTG SN DSITLPCRIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGLILTRDGGSTNSTTETFRPGGGDMRDN WRSELYKYKVVKIEPLGVAPTRAKRRVVGREKRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLL S GIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTNVPWNSS WSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALDKWASLWNWFDISNWLW Y IKIFIMIVGGLIGLRIVFAVLSVIHRVRQGYSPLSFQTHTPNPRGLDRPERIEEEDGEQDRGRSTRL VSGFLALAWDDLRSLCLFCYHRLRDFILIAARIVELLGHSSLKGLRLGWEGLKYLWNLLAYWGRELK I SAINLFDTIAIAVAEWTDRVIEIGQRLCRAFLHIPRRIRQGLERALL 0003 A001 BG505 SOSIP BG505 SOSIP 0004 A002 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y191F Stabilized V1V2 cap T332N_ T332N Y191F 0005 A003 BG505, SOSIP, R6, 664, BG505 SOSIP, R6, 664, Y191W Stabilized V1V2 cap T332N_ T332N Y191W 0006 A004 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A433P Disrupt CD4-bound T332N_ T332N sheet conf. A433P 0007 A005 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q432P Disrupt CD4- T332N_ T332N bound sheet conf. Q432P 0008 A006 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S174C/A319C DS (disulfide) T332N_ T332N S174C/A319C 0009 A007 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L175C/T320C DS T332N_ T332N L175C/T320C 0010 A008 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P220C/A578C DS T332N_ T332N P220C/A578C 0011 A009 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A221C/A582C DS T332N_ T332N A221C/A582C 0012 A010 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A200C/P313C DS T332N_ T332N A200C/P313C 0013 A011 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 498C/W610C DS T332N_ T332N 498C/W610C 0014 A012 BG505.IP.R6.664. BG505 IP, R6, 664, G41C/Q540C DS-non SOS context T332N_ T332N G41C/Q540C 0015 A013 BG505.IP.R6.664. BG505 IP, R6, 664, P43C/A526C DS-non SOS context T332N_ T332N P43C/A526C 0016 A014 BG505.IP.R6.664. BG505 IP, R6, 664, A221C/A582C DS-non SOS T332N_ T332N A221C/A582C 0017 A015 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G527C/N88C DS T332N_ T332N G527C/N88C 0018 A016 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q540C/P43C DS T332N_ T332N Q540C/P43C 0019 A017 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, E164C/N197C DS T332N_ T332N E164C/N197C 0020 A018 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P124C/R166C DS T332N_ T332N P124C/R166C 0021 A019 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D18OC/I423C DS T332N_ T332N D18OC/I423C 0022 A020 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N195C/I423C DS T332N_ T332N N195C/I423C 0023 A021 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N195C/A433C DS T332N_ T332N N195C/A433C 0024 A022 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S199C/A433C DS T332N_ T332N S199C/A433C 0025 A023 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 5199C/G431C DS T332N_ T332N S199C/G431C 0026 A024 *BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I201C/A433C DS T332N_ T332N I201C/A433C AENLWVTVYYGVPVWKDAETTLFCASDAKAYETEKHNVWATHACVPTDPNPQEIHLENVTEEFNMWK NNMVEQMHTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGELKNCSFNMTTELRDKKQKV Y SLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSACTQACPKVSFEPIPIHYCAPAGFAILKCKDKK FNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEVMIRSENITNNAKNILVQFNTPVQINCTRP N NNTRKSIRIGPGQAFYATGDIIGDIRQAHCNVSKATWNETLGKVVKQLRKHFGNNTIIRFANSSGGD LEVTTHSFNCGGEFFYCNTSGLFNSTWISNTSVQGSNSTGSNDSITLPCRIKQIINMWQRIGQcMYA P PIQGVIRCVSNITGLILTRDGGSTNSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRR VVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTV0ARNLLSGIVQQQSNLLRAPEAQQHLLKLT V WGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISN YTQIIYGLLEESQNQQEKNEQDLLALD 0027 A025 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T320C/P438C DS T332N_ T332N T320C/P438C 0028 A026 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D180C/K421C DS T332N_ T332N D180C/K421C 0029 A027 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M530W CavF at gp41- T332N_ T332N tryptophan clasp. M530W Stabilize gp41- tryptophan clasp interactions 0030 A028 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F159Y CavF at gp120 V1/V2. T332N_ T332N Substitute Y or F159Y W, stabilize V1/V2/V3 0031 A029 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F223W CavF at gp120 beta-5. T332N_ T332N Substitute Y or F223W W. stabilize gp120/gp41 interface 0032 A030 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L544Y, F223W CavF at gp41 tip of T332N_ T332N α-6. 544: F, Y, or L544Y_F223W W 223: Y or W. stabilize gp120/gp41 interface 0033 A031 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L523F Fusion Peptide T332N_ T332N Cavity Fill L523F 0034 A032 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F522Y Fusion Peptide T332N_ T332N Cavity Fill F522Y 0035 A033 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W35Q Exposed Nterm T332N_ T332N hydrophobic W35Q resurfaced 0036 A034 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A200C/P313C, nonSOS_multiple T332N_ T332N A221C/A582C cyscys A200C/P313C_A221C/ A582C 0037 A035 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q432E Disrupt CD4-bound T332N sheet conf. T332N_ Q432E 0038 A036 BG505.SOSIP. BG505 SOSIP, R6, 664, Q432D Disrupt CD4-bound R6.664. T332N sheet conf. T332N_ Q432D 0039 A037 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M434P Disrupt CD4-bound T332N sheet conf. T332N_ M434P 0040 A038 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y435P Disrupt CD4-bound sheet conf. T332N_ T332N Y435P 0041 A039 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P436P Disrupt CD4-bound sheet conf. T332N_ T332N A436P 0042 A040 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P437A proline removal T332N_ T332N P437A 0043 A041 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P438A proline removal T332N_ T332N P438A 0044 A042 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P437A, P438A proline removal T332N_ T332N P438A.P437A 0045 A043 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F139W, I326R CavF at the interface of V1V2 and V3 T332N_ T332N loops. Sustitute- T139W.I326R T139: F, M, I, Y; I326: M, W, F, Y. stabilize V1V2/V3 loop interactions in mature closed state 0046 A044 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T179W CavF at V1V2 loop gp120 core T332N_ T332N interface. L179W Substitute-F, Y M, I. stabilize interaction between V1V2 loop and gp120 core in mature closed state 0047 A045 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y39F, S534V CavF. add hydrophobicity at T332_NY39F.S534V T332N gp120/gp41 interface Substitute- S534: I, W, F, A, M; Y39: W, M, I 0048 A046 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y39W, S534A CavF. add hydrophobicity at T332N_ T332N gp120/gp41 interface. A Y39W.S534A 0049 A047 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y39F, S534V, T37V, T499V CavF. add hydrophobicity at T332N_ T332N gp120/gp41 interface 39F.S534V.T37V.T499V 0050 A048 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y39F, Y40F, S534V, CavF. add hydrophobicity at T332N_ T332N T37V, T499V gp120/gp41 interface Y39F.Y40F.S534V.T37V. F499V 0051 0 CAP256.SU CAP256.SU 0052 A049 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N425C/I430C S-Stabilizes CD4 binding loop T332N_ T332N N425C I430C 0053 A050 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y318C/437C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; Y318C P437C G473A reduce CD4 binding 0054 A051 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426W CavF at CD4bs. Substitute-F, Y, T332N_ T332N L, V, I. M426W Constrains CD4 binding loop 0055 A052 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S174C/A319C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; S174C A319C G473A reduce CD4 binding 0056 A053 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L175C/T320C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; L175C T320C G473A reduce CD4 binding 0057 A054 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F176C/D180C DS-Restrain PGT122 bound T332N_ T332N conformation F176C D180C 0058 A055 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204C/A436C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; A204C A436C G473A reduce CD4 binding 0059 A056 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204C/M434C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; A204C M434C G473A reduce CD4 binding 0060 A057 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P212C/K252C DS-Restrain PGT122 bound T332N_ T332N conformation P212C K252C 0061 A058 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P220C/A200C DS-Restrain PGT122 bound T332NP220CA200C T332N conformation 0062 A059 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G314C/A200C DS-Restrain PGT122 bound T332N_ T332N conformation G314C A200C 0063 A060 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204C/M434C DS-Restrain PGT122 bound T332N_ T332N conformation A204C M434C 0064 A061 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L122C/L125C DS-Restrain PGT122 bound T332N_ T332N conformation L122C L125C 0065 A062 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G473A CavF at CD4bs. Substitute-any. T332NG473A T332N sterically interfere with CD4 binding, without affecting Ab binding 0066 A063 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G473S Same as Seq_0065 T332N_ T332N G473S 0067 A064 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G473Y Same as Seq_0065 T332N_ T332N G473Y 0068 A065 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G431P Same as Seq_0065 T332N_ T332N G431P 0069 A066 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N425C/A433C DS-Fixes PGT122 bound state T332N_ T332N N425C A433C 0070 A067 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120C/Q315C DS-Fixes PGT122 bound state T332N_ T332N V120C Q315C 0071 A068 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P124C/T164C DS-Fixes PGT122 bound state T332N_ T332N P124C T164C 0072 A069 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T128C/T167C, G473A DS-Restrain PGT122 bound T332N_ T332N conformation; T128C T167C G473A reduce CD4 binding 0073 A070 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I424C/F382C DS-Fixes PGT122 bound state T332N_ T332N I424C F382C 0074 A071 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R298C/A329C DS-Fixes PGT122 bound state T332N_ T332N R298C A329C 0075 A072 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426P CavF at CD4bs. Substitute-P. T332N_ T332N Rigidities CD4 binding loop M426P 0076 A073 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y191W G473A CavF at CD4bs and V1/V2 cap T332N_ T332N Y191W G473A 0077 A074 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q203C/1122C DS-Fixes PGT122 bound state T332N_ T332N Q203C L122C 0078 A075 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426A CavF at CD4bs. Substitute-G, V, T332N_ T332N I, L, I, Y, W, R, K. prevents M426A triggering on CD4 binding 0079 A076 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y191W A433P CavF at CD4bs and V1/V2 cap T332N_ T332N Y191W A433P 0080 A077 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T372C/S364C DS-Fixes PGT122 bound state T332N_ T332N T372C S364C 0081 0 BB201.B42 BB201.B42 0082 A078 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V36C/V608C DS-Fixes PGT122 bound state T332N_ T332N V36C V608C 0083 A079 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426F CavF at CD4bs. Substitute-Y, W, T332N_ T332N L, I, V, R, K, G, A. Blocks M426F transition to CD4 bound conformation 0084 A080 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W69P helix 0 disruption T332N_ T332N W69P 0085 A081 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V68P helix 0 disruption T332N_ T332N V68P 0086 A082 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T71P helix 0 disruption T332N_ T332N T71P 0087 A083 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, H66C/K207C disulfide T332N_ T332N H66C/K207C 0088 A084 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A73C/G572C disulfide T332N_ T332N A73C/G572C 0089 A085 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F53C/G575C disulfide T332N_ T332N F53C/G575C 0090 A086 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V75W CavF at gp120/gp41 interface T332N_ T332N V75W 0091 A087 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V75F CavF at gp120/gp41 interface T332N_ T332N V75F 0092 A088 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V75M CavF at gp120/gp41 interface T332N_ T332N V75M 0093 A089 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V208W CavF between α1 and the strand T332N_ T332N leading into what V208W forms the bridging sheet in the CD4-bound form. Destabilize CD4-bound state 0094 A090 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V208Y Same as Seq_0093 T332N_ T332N V208Y 0095 A091 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V208F Same as Seq_0093 T332N_ T332N V208F 0096 A092 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V208M Same as Seq_0093 T332N_ T332N V208M 0097 A093 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A58C/T77C helix 0 disruption T332N_ T332N A58C/T77C 0098 A094 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D57C/T77C helix 0 disruption T332N_ T332N D57C/T77C 0099 A095 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V68C/S209C helix 0 disruption T332N_ T332N V68C/S209C 0100 A096 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V68C/208C helix 0 disruption T332N_ T332N V68C/V208C 0101 A097 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V66C/S209C helix 0 disruption T332N_ T332N V66C/S209C 0102 A098 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V67P helix 0 disruption T332N_ T332N N67P 0103 A099 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N66P helix 0 disruption T332N_ T332N H66P 0104 A100 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N67P/H66P helix 0 disruption T332N_ T332N N67P/H66P 0105 A101 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A58C/T77C, N67P, H66P helix 0 disruption T332N_ T332N A58C/T77C/N67P/H66P 0106 A102 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D57C/T77C, N67P, H66P helix 0 disruption T332N_ T332N D57C/T77C/N67P/H66 P 0107 0 KER2018.11 KER2018.11 0108 A103 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V68C/V208C, N67P, H66P helix 0 disruption T332N_ T332N V68C/V208C/N67P/H6 6P 0109 A104 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V68C/S209C, N67P, H66P helix 0 disruption T332N_ T332N V68C/S209C/N67P/ H66P 0110 A105 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D474A, R476A Destabilization of CD4 binding site T332N_ T332N D474A/R476A 0111 A106 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W112I Destabilization of CD4 binding site T332N_ T332N W112I 0112 A107 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W112M Destabilization of CD4 binding site T332N_ T332N WH2M 0113 A108 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W427I Destabilization of CD4 binding site T332N_ T332N W427I 0114 A109 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, W427M Destabilization of CD4 binding site T332N_ T332N W427M 0115 A110 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R429N Destabilization of CD4 binding site T332N_ T332N R429N 0116 A111 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R429L Destabilization of CD4 binding site T332N_ T332N R429L 0117 A112 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R429L, W427M Destabilization of CD4 binding site T332N_ T332N R429L/W427M 0118 A113 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D474A Destabilization of CD4 binding site T332N_ T332N D474A 0119 A114 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R476A T332N_ T332N R476A 0120 A115 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I201C/A433C, F159Y DS and CavF at gp120 V1/V2. T332N_ T332N stabilize V1/V2/V3 I201C/A433C_F159Y 0121 A116 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R166CG/V1270 V1V2 disulfide T332N_ T332N stabilization, prevent R166CG/V127C v1v2 from adopting cd4-bound- conformation 0122 A117 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G314C/S199C, V1V2V3 disulfide stabilization. T332N_ T332N R166CG/V127C prevent v1v2 from adopting cd4- G314C/S199C/R166CG/ V127C bound-conformation 0123 A118 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K421W, D180L CavF at V1V2 interaction near Res. T332N_ T332N 180 with V3 and K421W.D180L base of beta-21, substitute-421: F, W, Y; 180: L, V, I, M. prevent v1v2 to V3 along with B21 from adopting cd4-bound- conformation 0124 A119 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G431GC/S199C DS T332N_ T332N G431.GC.S199C 0125 A120 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R166C/V127GC DS T332N_ T332N R166C.V127GC 0126 A121 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G314C/S199C DS T332N_ T332N G314C.S199C 0127 A122 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G314CG/S199C DS T332N_ T332N G314CG.S199C 0128 A123 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120W CavF at N-term of β-2. Substitute-F, T332N_ T332N W, Y, L, I, M. β-2 extends in cd4- V120W bound state, this stabilizes small hydrophobic pocket in ground state 0129 A124 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120W, Q203V Same as Seq_0128 T332N_ T332N V120W.Q203V 0130 A125 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, delP124 proline removal. Removal of ground T332N_ T332N state destabilization/flexibility deltaP124 0131 A126 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125W, delP124 proline removal and CavF at Cavity T332N_ T332N between N-term of V1V2 domain and L125W_deltaP124 V3 near Res. 127 and 126-196 disulfide of V1V2. Substitute-F, W, Y, L, I, M, V. Removal of ground state destabilization/flexibility 0132 A127 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R151E, E153W, Q.328W CavF at V1 loop at resi 153. T332N_ T332N Substitute-153: R151E.E153W.Q, 328W F, W, Y, L, I, M, V; 328 F, W, Y, L, I, M, V. Adding hydrophobic patch at V1 loop to V3 loop 0133 A128 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F159W CavF at Primary hydrophobic pocket T332N_ T332N etween V1V2 and V3 near resi 159. F159W Substitute-W or Y. Stabilizing the hydrophobic core of the V1V2-V3 interactions 0134 A129 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F317W Same as Seq_0133 T332N_ T332N F317W 0135 A130 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M161W CavF at Hydrophobic patch at Cterm T332N_ T332N of V1V2 strand B. Substitute- M161W F, W, Y, L, I. Stabilizing strand B to V3 near trimeric interface 0136 A131 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I309W Same as Seq_0135 T332N_ T332N I309W 0137 A132 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125R, F317D Salt bridge. Salt bridge T332N_ T332N interaction in L125R.F317D hyrophobic shell 0138 A133 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125WE, F317R Salt bridge. Salt bridge T332N_ T332N interaction in L125WE.F317R hyrophobic shell 0139 A134 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S115W CavF at C-term of α-1. Substitute-F, T332N_ T332N W, Y, L, I, M, V. Will S115W fill cavity at top of α-1 which shifts conformation in CD4-bound state 0140 A135 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P118W CavF/proline removal at C-term of α- T332N_ T332N 1. Substitute-F, W, Y, L, P118W I, M, V. Will fill cavity at top of α-1 which shifts conformation in CD4-bound state 0141 A136 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 3206A proline removal. Removal of ground T332N_ T332N state destabilization/flexibility P206A 0142 A137 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, delP206 proline removal. Removal of ground T332N_ T332N state destabilization/flexibility deltaP206 0143 A138 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A70Y CavF-extension of T332N_ T332N hydrophobic/aromatic patch- A70Y gp41/gp120 stabilization (a7/a0cavity close to A70). Substitute-F, Y, W 0144 A139 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A70F Same as Seq_0143 T332N_ T332N A70F 0145 A140 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L111Y Same as Seq_0143 T332N_ T332N L111Y 0146 A141 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L111F Same as Seq_0143 T332N_ T332N L111F 0147 A142 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T202P disrupt bridging sheet/ T332N_ T332N destabilizing T202P CD4 bound state 0148 A143 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120P Same as Seq_0147 T332N_ T332N V120P 0149 A144 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120T Same as Seq_0147 T332N_ T332N V120T 0150 A145 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L122K Same as Seq_0147 T332N_ T332N L122K 0151 A146 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P313C/A200C, T51C/K574C Ds T332NP313C/A200C/T51C/K5 T332N 74C 0152 A147 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P313C/A200C, F53C/K574C Ds T332N_ T332N P313C/A200C/F53C/K5 74C 0153 A148 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 313C/A200C, T51C/A578C Ds T332N_ T332N P313C/A200C/T51C/A5 78C 0154 A149 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T128C/L165C, P313C/A200C, Ds T332N_ T332N T51C/K574C T128C/L165C/P313C/A 200C/T51C/K574C 0155 A150 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T128C/L165C, P313C/A200C, Ds T332N_ T332N F53C/K574C T128C/L165C/P313C/A 200C/F53C/K574C 0156 A151 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T128C/L165C, P313C/A200C, Ds T332N_ T332N F51C/A578C T128C/L165C/P313C/A 200C/T51C/A578C 0157 A152 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I573T destabilize gp41 helix bundle T332N_ T332N I573T 0158 A153 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G594N destabilize gp41 helix bundle T332N_ T332N G594N 0159 A154 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I573T-G594N destabilize gp41 helix bundle T332N_ T332N I573T-G594N 0160 A155 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I573T-G594N-K574E destabilize gp41 helix bundle T332N_ T332N I573T-G594N-K574E 0161 A156 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I573T-G594N-K574T destabilize gp41 helix bundle T332N_ T332N I573T-G594N-K574T 0162 A157 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A433C/L122C T332N_ T332N A433C L122C 0163 A158 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q428C/E560C T332N_ T332N Q428C E560C 0164 A159 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q428C/A561C T332N_ T332N Q428C A561C 0165 A160 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q428C/Q562C T332N_ T332N Q428C Q562C 0166 A161 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K574C/D107C T332N_ T332N K574C D107C 0167 A162 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q575C/Q550C T332N_ T332N Q575C Q550C 0168 A163 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q575C/Q551C T332N_ T332N Q575C Q551C 0169 A164 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R579C/Q550C T332N_ T332N R579C_Q550C 0170 A165 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426C/E370C T332N_ T332N M426C E370C 0171 A166 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426C/G380C T332N_ T332N M426C_G380C 0172 A167 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T123W CavF at trimer axis. Substitute- T332N_ T332N L, Y, L, M, V. stabilize T123W prefusion axis interactions 0173 A168 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I423W, I201W CavF at parallel b-strand #. T332N_ T332N Substitute- I423W_I201W F, Y, L, M, V. prevent bridging sheet formation 0174 0 CH070.1 CH070.1 0175 A169 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K117W CavF at trimer axis. T332N_ T332N Substitute-F, Y, L, K117W I, H, R, E, D, M, V. stabilize prefusion axis interactions 0176 A170 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K117E CavF/charged at trimer axis. T332N_ T332N Substitute-F, Y, L, I, H, K117E R, E, D, M, V. stabilize prefusion axis interactions 0177 A171 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K121E CavF/charged at trimer axis. T332N_ T332N Substitute-F, Y, L, I, H, K121E R, E, D, M, V. stabilize prefusion axis interactions 0178 A172 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S110W CavF at trimer axis/gp41 interface T332N_ T332N boundary. Substitute- S110W F, Y, L, I, M, V. stabilize prefusion axis interactions/gp41 interface/ prevent helix movement 0179 A173 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q114W Same as Seq_0178 T332N_ T332N Q114W 0180 A174 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P220W CavF at gp41 interface. Substitute- T332N_ T332N F, Y, L, I, M, V. stabilize P220W gp41 interface 0181 A175 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T50W CavF at gp41 interface. Substitute- T332N_ T332N F, Y, L, I, M, V. stabilize T50W gp41 interface 0182 A176 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R429W CavF at parallel b-strand #. T332N_ T332N Substitute-F, Y, L, I, M, V. R429W prevent bridging sheet formation 0183 A177 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120W, I201C/A433C ds/CavF under V1V2 cap. Substitute- T332N_ T332N F, Y, L, I, H, R, V120W_I201C_A433C E, D, M, V. stabilize prefusion axis interactions/ combined with DS 0184 A178 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K121W, I201C/A433C ds/CavF at trimer axis. Substitute- T332N_ T332N F, Y, L, M, V. K121W_I201C_A433C stabilize prefusion axis interactions/combined with DS 0185 A179 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T123W, I201C/A433C Same as Seq_0184 T332N_ T332N T123W I201C A433C 0186 A180 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K117W, I201C/A433C ds/CavF at trimer axis. Substitute- T332N_ T332N F, Y, L, I, H, R, E, K117W_I201C_A433C D, M, V. stabilize prefusion axis interactions/ combined with DS 0187 A181 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K117E, I201C/A433C ds/CavF/charged at trimer axis. T332N_ T332N Substitute-F, Y, L, I, K117E_I201C_A433C H, R, E, D, M, V. stabilize prefusion axis interactions/combined with DS 0188 A182 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, K121E, I201C/A433C ds/CavF/charged at trimer axis. T332N_ T332N Substitute-F, Y, L, I, H, R, K121E_l201C_A433C E, D, M, V. stabilize prefusion axis interactions/combined with DS 0189 A183 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M426W, I201C/A433C ds/CavF at parallel b-strand #. T332N_ T332N Substitute-F, Y, L, I, H, R, M426W_I201C_A433C E, D, V. stabilize prefusion axis interactions/ combined with DS 0190 A184 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S110W, I201C/A433C ds/CavF at trimer axis/gp41 T332N_ T332N interface boundary. Substitute- S110W_I201C_A433C F, Y, L, I, M, V. stabilize prefusion axis interactions/gp41 interface/prevent helix movement/combined with DS 0191 A185 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q114W, I201C/A433C Same as Seq_0190 T332N_ T332N Q114W I201C A433C 0192 A186 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P3220W, I201C/A433C ds/CavF at gp41 interface. T332N_ T332N Substitute-F, Y, L, I, M, V. P220W_I201C_A433C stabilize gp41 interface/ combined with DS 0193 A187 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T50W, I201C/A433C ds/CavF at gp41 interface. T332N_ T332N Substitute-F, Y, L, I, M, V. T50W_I201C_A433C stabilize gp41 interface/ combined with DS 0194 A188 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, R429W, I201C/A433C ds/CavF at parallel b-strand #. T332N_ T332N Substitute-F, Y, L, I, M, V. R429W_I201C_A433C prevent bridging sheet formation/combined with DS 0195 A189 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y61W CavF at Middle of α-1. T332N_ T332N Will fill a Y61W cavity between gp120 and gp41 to revent CD4 induced α-1 disruption and α0 formation 0196 A190 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S209R, V68L CavF at Loop between α-1 and beta 0 T332N_ T332N and loop between beta 3 and beta 4. S209R_V68L Substitute-F, W, Y, L, I, M, V. Fills cavities that are otherwise filled by CD4 induced α0 formation 0197 A191 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, :53W, Q246W CavF at gp120-gp41 interface, T332N_ T332N N-term F53W_Q246W of beta-2, middle of beta-8, Substitute-246 F, W, Y, L, I, M, V. Will fill a cavity between gp120 and zp41 to stabilize gp41 disordered region and interaction between gp120 and gp41 0198 A192 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y177W, I323F CavF at C-term of beta C, T332N_ T332N C-term of Y177W_I323F beta V3B. Substitute-323 F, Y, W. Fills cavity between V3 and gp120 core to stabilize closed cap 0199 A193 BG505SOS.R6.664. BG505 SOS, R6, 664, G41C/A541C DS-Fixes ground state, DS between T332N_ T332N gp120 and gp41 G41C A541C 0200 A194 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G41C/A541C S-Fixes ground state, DS between T332N_ T332N gp120 and gp41 G41C A541C 0201 A195 BG505.R6.664. BG505 R6, 664, G41C/A541C DS, non SOSIP-Fixes T332N_ T332N ground state, DS G41CA541C between gp120 and gp41 0202 A196 BG505, SOS.R6.664. BG505 SOS, R6, 664, 547-GGPGGPGG-569 Prevent α6 to α7 transition T332N_ T332N 547-GGPGGPGG-569 0203 A197 BG505, SOS.R6.664. BG505 SOS, R6, 664, 547-GGGGPGGPG-569 Prevent α6 to α7 transition T332N_ T332N 547-GGGGPGGPG-569 0204 A198 BG505, SOS.R6.664. BG505 SOS, R6, 664, 547-GGGPGGG-569 Prevent α6 to α7 transition T332N_ T332N 547-GGGPGGG-569 0205 A199 BG505, SOS.R6.664. BG505 SOS, R6, 664, 547-GGPGGGGPGG-569 Prevent α6 to α7 transition T332N_ T332N 547-GGPGGGGPGG-569 0206 A200 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q551P Prevent α6 to α7 transition T332N_ T332N Q551P 0207 A201 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L556P Prevent α6 to α7 transition T332N_ T332N L556P 0208 A202 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, H564P Prevent α6 to α7 transition T332NH564P T332N 0209 A203 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L568P Prevent α6 to α7 transition T332NL 568P T332N 0210 B001 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N, 10 A.A. linker no SOS; bC-10ln with I559P 0211 B002 BG505, IP.664. BG505 IP, 664, 508(REKR)511 replaced Single chain; T332N_ T332N by A.A. linker, no SOS; bC-10ln_R166W R166W with I559P; with R166W 0212 B003 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 11 A.A. linker no SOS; bC-11ln with I559P 0213 B004 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 11 A.A. linker, R166W bC-11ln R166W 0214 B005 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 12 A.A. linker no SOS; bC-12ln with I559P 0215 B006 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 12 A.A. linker, R166W bC-12ln R166W 0216 B007 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 13 A.A. linker no SOS; bC-13ln with I559P 0217 B008 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 13 A.A. linker, R166W bC-13ln_R166W 0218 B009 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 14 A.A. linker no SOS; bC-14ln with I559P 0219 B010 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 14 A.A. linker, R166W bC-14ln_R166W 0220 B011 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 15 A.A. linker no SOS; bC-15ln with I559P 0221 B012 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 15 A.A. linker, R166W bC-15ln_R166W 0222 B013 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 1 A.A. linker no SOS; bC-11ln with I559P 0223 B014 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 1 A.A. linker, R166W bC-11ln_R166W 0224 B015 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 20 A.A. linker no SOS; bC-20ln with I559P 0225 B016 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 20 A.A. linker, R166W bC-20ln_R166W 0226 B017 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 2 A.A. linker no SOS; bC-2ln with I559P 0227 B018 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 2 A.A. linker, R166W bC-2ln_R166W 0228 B019 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 3 A.A. linker no SOS; bC-3ln with I559P 0229 B020 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 3 A.A. linker, R166W bC-3ln_R166W 0230 B021 BG505, IP.664. BG505 IP, 664, 508(REKR)511 replaced Single chain; T332N_ T332N by 4 A.A. linker no SOS; bC-4ln with I559P 0231 B022 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 4 A.A. linker, R166W bC-4ln R166W 0232 B023 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 5 A.A. linker no SOS; bC-5ln with I559P 0233 B024 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 5 A.A. linker, R166W bC-5ln_R166W 0234 B025 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 6 A.A. linker no SOS; bC-6ln with I559P 0235 B026 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 6 A.A. linker, R166W bC-6ln_R166W 0236 B027 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 7 A.A. linker no SOS; bC-7ln with I559P 0237 B028 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 7 A.A. linker, R166W bC-7ln_R166W 0238 B029 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 8 A.A. linker no SOS; bC-8ln with I559P 0239 B030 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 8 A.A. linker, R166W bC-8ln R166W 0240 B031 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 9 A.A. linker no SOS; bC-9ln with I559P 0241 B032 BG505, IP.664. BG505 IP, 664, 508(REKR)511 .fwdarw. Same as Seq_211 T332N_ T332N 9 A.A. linker, R166W bC-9ln R166W 0242 B033 BG505.664. BG505 564, T332N 508(REKR)511 .fwdarw. Single chain; T332N_ 10 A.A. linker no SOSIP C-10ln 0243 B034 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 10 A.A. linker; no SOS; C-10ln_Q551F Q551F withQ551F 0244 B035 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 11 A.A. linker no SOSIP C-11ln 0245 B036 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 12 A.A. linker no SOSIP C-12ln 0246 B037 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 13 A.A. linker no SOSIP C-13ln 0247 B038 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 14 A.A. linker no SOSIP C-14ln 0248 B039 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 15 A.A. linker no SOSIP C-15ln 0249 B040 BG505.664. BG505 564, T332N 508(REKR)511 .fwdarw. Single chain; T332N_ 1 A.A. linker no SOSIP C-1ln 0250 B041 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 2 A.A. linker no SOSIP C-2ln 0251 B042 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 3 A.A. linker no SOSIP C-3ln 0252 B043 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 4 A.A. linker no SOSIP C-4ln 0253 B044 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 5 A.A. linker no SOSIP C-5ln 0254 B045 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 6 A.A. linker no SOSIP C-6ln 0255 B046 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 7 A.A. linker no SOSIP C-7ln 0256 B047 BG505.664. BG505 564, T332N 508(REKR)511 .fwdarw. Single chain; T332N_ 8 A.A. linker no SOSIP C-8ln 0257 B048 BG505.664. BG505 664, 508(REKR)511 .fwdarw. Single chain; T332N_ T332N 9 A.A. linker no SOSIP C-9ln 0258 B049 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N Gp120-HR2-HR1 0259 B050 BG505.IP.664. BG505 IP, 664, linker gp120-HR1 T332N_ T332N Gp120-Linker-HR1-GCN4 0260 B051 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit2noC 0261 B052 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit3-noFus 0262 B053 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit4noC-noFus 0263 B054 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit9-GCN4coredownCC 0264 B055 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit14-HR1envHR2- GCN4coredown 0265 B056 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit15-HR1envHR2- GCN4coredown 0266 B057 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit16-HR1envHR2- GCN4coredown 0267 B058 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit17-HR1envHR2 0268 B059 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit18-HR1envHR2 0269 B060 BG505.IP.664. BG505 IP, 664, circular permutant single chain T332N_ T332N SOScircuit4noC-noFus_CMVR- 3c-His-R166W 0270 B061 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circ. Permut. single chain in ZM53, T332N_ T332N with R166W 1.ZM53.R166W 0271 B062 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circ. Permut. single chain in ZM53, T332N_ T332N with R166W 10.ZM53.R166W 0272 B063 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N_ T332N 10_BG505_Nterm_Hl 0273 B064 BG505.IP.664. BG505 IP, 664, P313W, circ. permut. circular permutant single chain T332N_ T332N 10_BG505_Nterm_H1_P313W 0274 B065 BG505.IP.664. BG505 IP, 664, P313W, R166W, circ. circular permutant single chain T332N_ T332N permut. -R166W _10_BG505_Nterm_H1_P313W 0275 B066 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N_ T332N 10_BG505_Nterm_H1_R166W 0276 B067 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N_ T332N 11.ZM53.R166W 0277 B068 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N_ T332N 11_BG505_Nterm_Hl 0278 B069 BG505.IP.664. BG505 IP, 664, P313W, circ. permut. circular permutant single chain T332N_ T332N 11_BG505_Nterm_Hl_P313W 0279 B070 BG505.IP.664. BG505 IP, 664, P313W, R166W, circ. circular permutant single chain T332N.-R166W T332N permut. _11_BG505_Nterm_H1_P313W 0280 B071 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N_ T332N 11_BG505_Nterm_Hl_R166W 0281 B072 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N_ T332N 12.ZM53.R166W 0282 B073 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N_ T332N 12_BG505_Nterm_Hl 0283 B074 BG505.IP.664. BG505 IP, 664, P313W, circ. permut. circular permutant single chain T332N_ T332N 12_BG505_Nterm_Hl_P313W 0284 B075 BG505.IP.664. BG505 IP, 664, P313W, R166W, circ. circular permutant single chain T332N.-R166W T332N permut. _12_BG505_Nterm_H1_P313W 0285 B076 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N_ T332N 12_BG505_Nterm_H1_R166W 0286 B077 BG505.IP.664. BG505 IP, 664, Linker at cleavage site Linker at cleavage site T332N_ T332N 13_BG505_6RLinked 0287 B078 BG505.IP.664. BG505 IP, 664, Linker at cleavage site Linker at cleavage site T332N_ T332N 14_BG505_6RLinked 0288 B079 BG505.IP.664. BG505 IP, 664, Linker at cleavage site Linker at cleavage site T332N_ T332N 15_BG505_6RLinked 0289 B080 BG505.IP.664. BG505 IP, 664, Linker at cleavage site Linker at cleavage site T332N_ T332N 16_BG505_6RLinked 0290 B081 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N_ T332N 1_BG505_Nterm_H1 0291 B082 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain T332N.__l_BG505_ T332N Nterm_H1_R166W 0292 B083 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N_ T332N 2_BG505_Nterm_H1 0293 B084 BG505.IP.664. BG505 IP, 664, circ. permut. circular permutant single chain T332N.__3_BG505_Nterm_H1 T332N 0294 B085 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain in T332N_ T332N ZM53, with R166W 4.ZM53.R166W 0295 B086 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 4_BG505_Nterm_Hl 0296 B087 BG505.IP.664. BG505 IP, 664, R166W, circ. permut. circular permutant single chain, T332N_ T332N with R166W 4_BG505_Nterm_H1_R166W 0297 B088 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 5_BG505_Nterm_H1 0298 B089 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 6_BG505_Nterm_H1 0299 B090 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 7_BG505_Nterm_H1 0300 B091 BG505.IP.664. BG505 IP, 664, R166W circ. permut. circular permutant single chain, T332N_ T332N with R166W 7_BG505_Nterm_H1_R166W 0301 B092 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 8_BG505_Nterm_H1 0302 B093 BG505.IP.664. BG505 IP, 664, circ. permut. Circular permutant single chain T332N_ T332N 9_BG505_Nterm_H1 0303 B094 BG505.SOSIP.664. BG505 SOSIP, 664, A433P, circ. permut. circular permutant single chain, T332N_ T332N with A433P 29_gp120-HR2_A433P 0304 B095 BG505.SOSIP.664. BG505 SOSIP, 664, A433P, circ. permut. circular permutant single chain, T332N_ T332N with A433P 30_gp120-HR2_A433P 0305 B096 CH117.4_332N_IP_10ln CH117.4 IP; 508(REKR)511 .fwdarw. Single chain; 664; 10 A.A. linker; no SOS; T332N 332N with I559P 0306 B097 CNE58_IP_10ln CNE58 IP; 508(REKR)511 .fwdarw. Single chain; 664 10 A.A. linker no SOS; with I559P 0307 B098 Cap256-SU_IP_10ln Cap256-SU IP; Same as Seq_307 Single chain; 664 no SOS; with I559P 0308 B099 SHIV-1157ipd3N4_IP_10ln 1157ipd3N4 IP; Same as Seq_307 Single chain; 664 no SOS; with I559P 0309 B100 ZM53_IP_10ln ZM53 IP; Same as Seq_307 Single chain; 664 no SOS; with I559P 0310 B101 C-10ln_Q551F BG505 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker; with I559P; Q551F with Q551F 0311 B102 TF-B_THRO_TFl_10ln_Q551F THRO_TF1 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker; withQ551F Q551F 0312 B103 TF-C_1245045_10ln_Q551F 1245045 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker; withQ551F Q551F 0313 B104 3301_V1_C24_10ln_Q551F 3301_V1_C24 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker; withQ551F Q551F 0314 B105 TF-C_19157834_v1_ 19157834_v1 664 664; Single chain; 10ln_Q551F_P162T 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker; withQ551F 0551F; P162T 0315 B106 25925-2.22_10ln_Q551F 25925-2.22 IP, 664 508(REKR)511 .fwdarw. Single chain; 10 A.A. linker; no SOS; Q551F withQ551F 0316 B107 CAP210.E8_10ln_Q551F CAP210.E8 IP, 664 508(REKR)511 .fwdarw. Single chain; 10 A.A. linker; no SOS; Q551F withQ551F 0317 B108 CNE58_IP_10ln_SU-strandC CNE58 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker with I559P; strand-C from CAP256-SU 0318 B109 CNE58_10ln_Q551F_ CNE58 IP, 664 508(REKR)511 .fwdarw. Single chain; SU-strandC 10 A.A. linker; no SOS; 0551F withQ551F; strand-C from CAP256-SU 0319 B110 TF-B_THRO_TF1_IP_10ln THRO_TF1 IP, 664 Same as Seq_307 Single chain; no SOS; with I559P 0320 B111 25925-2.22_IP_10ln 25925-2.22 IP, 664 508(REKR)511 .fwdarw. Single chain; 10 A.A. linker no SOS; with I559P 0321 B112 CAP210.E8_IP_10ln CAP210.E8 IP, 664 508(REKR)511 .fwdarw. Single chain; 10 A.A. linker no SOS; with I559P 0322 B113 TF-C_19157834_v1_ 19157834_v1 IP, 664 664; Single chain; IP_10ln_P162T 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker, with I559P P162T 0323 B114 3301_V1_C24_IP_10ln 3301 V1 C24 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker with I559P 0324 B115 TF-C_1245045_IP_10ln 1245045 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker with I559P 0325 B116 00836-2.5_332N_IP_10ln 00836-2.5 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker, with I559P 332N 0326 B117 6322_V4_C1_332N_IP_10ln 6322_V4_C1 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker, with I559P 332N 0327 B118 ZM53-R166W_bC-10ln_IP ZM53 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 10 A.A. linker, with I559P R166W 0328 B119 ZM53-R166W_bC-15ln_IP ZM53 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 15 A.A. linker, with I559P R166W 0329 B120 ZM53-R166W_bC-20ln_IP ZM53 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 20 A.A. linker, with I559P R166W 0330 B121 ZM53-R166W_bC-7ln_IP ZM53 IP, 664 664; Single chain; 508(REKR)511 .fwdarw. no SOS; 7 A.A. linker, with I559P R166W 0331 B122 ZM53-R166W_C-10ln BG505 664 508(REKR)511 .fwdarw. Single chain; 10 A.A. linker, R166W no SOS 0332 B123 ZM53-R166W_C-15ln BG505 664 508(REKR)511 .fwdarw. Single chain; 15 A.A. linker, R166W no SOS 0333 B124 ZM53-R166W_C-20ln BG505 664 508(REKR)511 .fwdarw. Single chain; 20 A.A. linker, R166W no SOS 0334 B125 ZM53-R166W_C-7ln BG505 664 508(REKR)511 .fwdarw. Single chain; 7 A.A. linker, R166W no SOS 0335 B126 BG505.SOSIP.664. BG505 SOSIP, 664, 504-518 .fwdarw. Single chain + N-term of gp41; T332N_ T332N 5 A.A. linker with del504-518_5ln SOS; with I559P 0336 B127 BG505.SOSIP.664. BG505 SOSIP, 664, 504-518 .fwdarw. Same as Seq_0335 T332N_ T332N 10 A.A. linker del504-518_10ln 0337 B128 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-518 .fwdarw. Same as Seq_0335 T332N_ T332N 15 A.A. linker del504-518_15ln 0338 B129 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-518 .fwdarw. Same as Seq_0335 T332N_ T332N 20 A.A. linker del504-518_20ln 0339 B130 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-518 .fwdarw. Same as Seq_0335 T332N_ T332N 5 A.A. linker del505-518_5ln 0340 B131 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-518 .fwdarw. Same as Seq_0335 T332N_ T332N 10 A.A. linker del505-518_10ln 0341 B132 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-518 .fwdarw. Same as Seq_0335 T332N_ T332N 15 A.A. linker del505-518_15ln 0342 B133 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-518 .fwdarw. Same as Seq_0335 T332N_ T332N 20 A.A. linker del505-518_20ln 0343 B134 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-521 .fwdarw. Same as Seq_0335 T332N_ T332N 5 A.A. linker del504-521_5ln 0344 B135 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-521 .fwdarw. Same as Seq_0335 T332N_ T332N 10 A.A. linker del504-521_10ln 0345 B136 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-521 .fwdarw. Same as Seq_0335 T332N_ T332N 15 A.A. linker del504-521_15ln 0346 B137 BG505.SOSIP.664. BG505 SOSIP, 664, segment 504-521 .fwdarw. Same as Seq_0335 T332N_ T332N 20 A.A. linker del504-521_20ln 0347 B138 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-521 .fwdarw. Same as Seq_0335 T332N_ T332N 5 A.A. linker del505-521_5ln 0348 B139 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-521 .fwdarw. Same as Seq_0335 T332N_ T332N 10 A.A. linker del505-521_10ln 0349 B140 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-521 .fwdarw. Same as Seq_0335 T332N_ T332N 15 A.A. linker del505-521_15ln 0350 B141 BG505.SOSIP.664. BG505 SOSIP, 664, segment 505-521 .fwdarw. Same as Seq_0335 T332N_ T332N 20 A.A. linker del505-521_20ln 0351 B142 BG505.SOSIP.664. BG505 SOSIP, 664, 508(REKR)511 .fwdarw. Same as Seq_0335 T332N_ T332N 5 A.A. linker c5ln 0352 B143 BG505.SOSIP.664. BG505 SOSIP, 664, 508(REKR)511 .fwdarw. Same as Seq_0335 T332N_ T332N 10 A.A. linker c10ln 0353 B144 BG505.SOSIP.664. BG505 SOSIP, 664, 508(REKR)511 .fwdarw. Same as Seq_0335 T332N_ T332N 15 A.A. linker cl5ln 0354 B145 BG505.SOSIP.664. BG505 SOSIP, 664, 508(REKR)511 .fwdarw. Same as Seq_0335 T332N_ T332N 20 A.A. linker c20ln 0355 B146 BG505.IP.664. BG505 IP, 664, segment 505-521 .fwdarw. Single chain + N-term of gp41; T332N_ T332N 5 A.A. linker no del505-521_5ln SOS; with I559P 0356 B147 BG505.IP.664. BG505 IP, 664, segment 505-521 .fwdarw. Single chain + N-term of gp41; T332N_ T332N 10 A.A. linker no del505-521_10ln SOS; with I559P 0357 B148 BG505.IP.664. BG505 IP, 664, segment 505-521 .fwdarw. Single chain+ N-term of gp41; T332N_ T332N 15 A.A. linker no SOS; del505-521_15ln with I559P 0358 B149 BG505.IP.664. BG505 IP, 664, segment 505-521 .fwdarw. Single chain+ N-term of gp41; T332N_ T332N 20 A.A. linker no SOS; del505-521_20ln with I559P 0359 B150 BG505.SOSIP.664. BG505 SOSIP, 664, cleavage site and NT Same as Seq_0335 T332N_ T332N effusion peptide sc BZI replaced by a flexible linker 0360 B151 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ2 0361 B152 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ3 0362 B153 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ4 0363 B154 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ5 0364 B155 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ6 0365 B156 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ7 0366 B157 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ8 0367 B158 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ9 0368 B159 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ10 0369 B160 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ11 0370 B161 BG505.SOSIP.664. BG505 SOSIP, 664, Same as Seq_0359 Same as Seq_0335 T332N_ T332N sc BZ12 0371 B162 BG505.SOSIP.664. BG505 SOSIP, 664, cleavage site and NT Same as Seq_0335 T332N_ T332N of fusion peptide sc BZ2 replaced by a G312C/S199C/R166C/V127C flexible linker; G312C/S199C/R166C/V127C 0372 B163 BG505.SOSIP.664. BG505 SOSIP, 664, cleavage site and NT Same as Seq_0335 T332N_ T332N of fusion peptide sc BZ3 replaced by a G312C/S199C/R166C/V127C flexible linker; G312C/S199C/R166C/V127C 0373 B164 BG505.IP. BG505 IP, 664, on ferritin with ferritin for linker 664. a 5-linker replacement of T332N_ T332N gp120-gp41 cleavage site; bC10ln-5ln- no SOS; HpyFerritin with I559P 0374 B165 BG505.IP. BG505 IP, 664, on ferritin with Same as Seq_0373 664. a 10-1 inker T332N_ T332N bC10ln-10ln- HpyFerritin 0375 B166 BG505.IP.664. BG505 IP, 664, on ferritin with Same as Seq_0373 T332N_ T332N a 15-1 inker bC10ln-15ln- HpyFerritin 0376 B167 BG505.664. BG505 664, on ferritin ferritin for linker T332N_ with a 5-linker; replacement of FC10ln-5ln-HpyFerritin T332N Q551F gp120-gp41 cleavage site; no SOS; with Q551F 0377 B168 BG505.664. BG505 564, T332N on ferritin with Same as Seq_0376 T332N_ a 10-1 inker; FC10ln-10ln-HpyFerritin Q551F 0378 B169 BG505.664. BG505 564, T332N on ferritin with Same as Seq_0376 T332N_ a 15-1 inker; FC10ln-15ln-HpyFerritin Q551F 0379 H009 Cap256-SU_bg505- Cap256-SU/BG505 SOSIP; 3G505 Platform, NCgp120 + chimera 664; remainder = Cap256-SU gp41.SOSIP R6 0380 H010 1157ipd3N4_bg505- 1157ipd3N4/BG505 SOSIP; BG505 Platform, NCgp120 + gp41.SOSIP chimera 664; remainder = R6 1157ipd3N4 0381 H011 CH117.4_332N_bg505- CH117.4_332N/BG505 SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP 664; remainder = R6 chimera CH117.4_332N 0382 H012 CNE58_SU-strandC_bg505- CNE58_SU-strandC/ SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP BG505 664; Res. 166-173 (strand C) chimera R6 From CAP256-SU, remainder = CNE58 0383 H013 25925-2.22_bg505- 25925-2.22/BG505 SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP chimera 664; remainder = 25925-2.22 R6 0384 H014 3301_V1_C24_bg505- 3301_V1_C24/BG505 SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP chimera 664; remainder = R6 3301 V1 C24 0385 H015 ZM53-R166W_bg505- ZM53-R166W/BG505 SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP chimera 664; remainder = ZM53- R6 R166W 0386 H016 ZM53_bg505- ZM53/BG505 SOSIP; 3G505 Platform, NCgp120 + gp41.SOSIP chimera 664; remainder = ZM53 R6 SP120 0387 B170 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant Link gp120 Cterm T332N_ T332N to gp41 resi 664, SC_1 and circ. Permutate thru rest of gp41, end at 518 0388 B171 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant same as PA SC 1 T332N_ T332N above, vary linker SC_2 0389 B172 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant same as PA_SC_1 and PA_SC_2 T332N_ T332N above, vary linker SC_3 0390 B173 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant connects gp120 C term to region T332N_ T332N around 606-609, and extends SC_4 Forward, turncating at different regions) 0391 B174 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant only the innercircle of T332N_ T332N helices to hold SC_5 the trimer together 0392 B175 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant Same as Seq_0391 T332N_ T332N SC_6 0393 B176 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant Same as Seq_0391 T332N_ T332N SC_7 0394 B177 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant Same as Seq_0391 T332N_ T332N SC_8 0395 B178 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant Start from resi 518, go to 664, T332N_ T332N connect to C-term of gp120, circ. SC_9 permutate thru gp120 0396 B179 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant same as PA SC 9, change linker T332N_ T332N SC_10 0397 B180 BG505.SOSIP.664. BG505 SOSIP, 664, Circular permutant same as PA SC 9, change linker T332N_ T332N SC_11 0398 B181 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant single chain T332N_ T332N 1.2 0399 B182 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant single chain T332N_ T332N 1.3 0400 B183 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant single chain T332N_ T332N 2.1 0401 B184 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant single chain T332N_ T332N 2.2 0402 B185 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant single chain T332N_ T332N 2.3 0403 B186 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant T332N_ T332N single chain 3.1 0404 B187 BG505.IP.664. BG505 SOSIP, 664, Circular permutant Circular permutant T332N_ T332N single chain 3.3 0405 B188 BG505.IP.664. BG505 IP, 664, 44-500-gsg-34-43- Circular permutant T332N.scl T332N gsgg-526-664 single chain 0406 B189 BG505.SOSIP.664. BG505 SOSIP, 664, 44-502-ggsgg-34-43- Circular permutant T332N.sc2 T332N gsgg-526-664 single chain 0407 B190 BG505.IP.664. BG505 IP, 664, 44-500-gsg-34-42- Circular permutant gsgg-525-664 single chain T332N.sc3 T332N 0408 B191 BG505.SOSIP.664. BG505 SOSIP, 664, 44-502-ggsgg-34- Circular permutant 42-gsgg-525-664 single chain T332N.sc4 T332N 0409 C001 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T90C gp140-35O22complex- T332N_ T332N disulfide to T90 35O22_S80 0410 C002 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, P238C gp140-35O22complex- T332N_ disulfide to P238 T332N 35O22_P77 0411 C003 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F529C gp140-35O22complex- T332_NT529 disulfide to T332N 35O22_D111 0412 C004 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D624C gp140-35O22complex- T332N_ disulfide to D624 T332N 35O22_L109 or G112 0413 C005 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V625C gp140-35O22complex- T332N_N625 disulfide to T332N 35O22_L109 0414 C006 35O22_P77C Ab 35O22 P77C gp140-35O22complex- 3G505.SOSIP.R6.664. T332N_ P238 0415 C007 35O22_S80C Ab 35O22 S80C gp140-35O22complex- 3G505.SOSIP.R6.664. T332N_ T90 0416 C008 35O22_L109C Ab 35O22 L109C gp140-35O22complex- BG505.SOSIP.R6.664. T332N_ D624 or BG505.SOSIP.R6.664. T332N_ N625 0417 C009 35O22_D111C Ab 35O22 D111C gp140-35O22complex- 3G505.SOSIP.R6.664. T332N_ T529 0418 C010 35O22_G112C Ab 35O22 G112C gp140-35O22complex- 3G505.SOSIP.R6.664. T332N_ D624 0419 C011 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, D624C gp140-35O22complex T332N_ T332N D624C 0420 C012 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G459C gp140-VRC01complex T332N_ T332N G459C 0421 C013 JRFL IP 3C Strep G459C JRFL IP 3C Strep G459C gp140-VRC01complex 0422 C014 BS208.B1 SOSIP, R6, 664, BS208.B1 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0423 C015 KER2018.11 SOSIP, R6, 664, KER2018.11 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0424 C016 C4118.09 SOSIP, R6, 664, C4118.09 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0425 C017 TH966.8 SOSIP, R6, 664, TH966.8 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0426 C018 WIT0.33 SOSIP, R6, 664, WITO.33 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0427 C019 CH181.12 SOSIP, R6, 664, CH181.12 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0428 C020 BB201.B42 SOSIP, R6, 664, BB201.B42 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0429 C021 Q842.dl2 SOSIP, R6, 664, Q842.dl2 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0430 C022 AC10.29 SOSIP, R6, 664, AC10.29 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0431 C023 BX08 16SOSIP, R6, 664, BX08_16 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0432 C024 257102.43 SOSIP, R6, 664, 257102.43 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0433 C025 259252.22 SOSIP, R6, 664, 259252.22 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0434 C026 SO18_18 SOSIP, R6, 664, SO18_18 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0435 C027 X1193.C1 SOSIP, R6, 664, X1193.C1 SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0436 C028 SU SOSIP, R6, 664, SU SOSIP, R6, 664 G459C gp140-VRC01complex G459C 0437 C029 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap BB201.B42 gp140-VRC01complex V1V2 Swap BB201.B42 0438 C030 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap KER2018.11 gp140-VRC01complex V1V2 Swap KER2018.11 0439 C031 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap CH070.1 gp140-VRC01complex V1V2 Swap CH070.1 0440 C032 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap ZM233.6 gp140-VRC01complex V1V2 Swap ZM233.6 0441 C033 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap Q23.17 gp140-VRC01complex V1V2 Swap Q23.17 0442 C034 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 SwapA244 gp140-VRC01complex V1V2 Swap A244 0443 C035 BG505.SOSIP G459C BG505 SOSIP G459C, V1V2 Swap WITO.33 gp140-VRC01complex V1V2 Swap WIT0.33 0444 C036 BG505 Cap256G459CSU BG505 SOSIP G459C, SU V1V2 swap gp140-VRC01complex V1V2 swap 0445 C037 VRC01 HA60C-His VRC01 H Ab A60C 0446 C038 VRC01 H R61C-His VRC01 H Ab A61C 0447 C039 VRC01 L VRC01L Ab 0448 C040 VRC01 H-His VRC01 H Ab 0449 C041 VRC01LH scFvTbn-His-Strep VRC01 Ab GGGGSGGGGSGGGGS GGGGSGGGGSGGGGS 0450 C042 VRC01LH scFvTbn-His VRC01 Ab GGGGSGGGGSGGGGS GGGGSGGGGSGGGGS 0451 C043 VRC01LH scFv C60Tbn-His VRC01 Ab GGGGSGGGGSGGGGS GGGGSGGGGSGGGGS 0452 C044 simVRC01.2 (Thr) H VRC01 H Ab 0453 C045 simVRC01.2 C60 (Thr) H VRC01 H Ab A60C 0454 C046 simVRC01.2 C60 (Thr) HS VRC01 H Ab A60C 0455 C047 simVRC01.2 L VRC01L Ab 0456 C048 simVRC01.2 C60 (Thr) H VRC01 H Ab A60C 0457 C049 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I323C covalently bonded gp140- T332N_ T332N PGT122complex I323C 0458 C050 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G324C covalently bonded gp140- T332NG324C T332N PGT122complex 0459 C051 G122LH F67C PGT122 H Ab F67C 0460 C052 G122LH G29C PGT122 H Ab G29C 0461 D001 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 504N/506T Glycan at R504 T332N_ T332N Glyc504 0462 D002 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 561N/663T Glycan at L661 T332N_ T332N Glyc661 0463 D003 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 504N/506T, 661N/663T Glycans at R504 and L661 T332N_ T332N Glyc504-661 0464 D004 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, K502N/R504T Glycan at K502 T332N_ T332N K502N R504T 0465 D005 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, Q658N/L660T Glycan at Q658 T332N_ T332N Q658N L660T 0466 D006 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, W35T Glycan at N33 T332N_ T332N W35T 0467 D007 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, W35N Glycan at W35 T332N_ T332N W35N 0468 D008 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, W35N, R504N/V506T Glycan at W35 and R504 T332N_ T332N W35N R504N V506T 0469 D009 BG505, SOSIP.R6.664. BG505 SOSIP, R6, 664, W35T, gly661 Glycan at N33 and L661 T332N_ T332N W35T_gly661 0470 D010 BG505, BG505 SOSIP, R6, 664, W35T, K502N/R504T, gly661 Glycan at K502 and L661 SOSIP.R6.664. T332N T332N_ W35T_K502N_R504T_gly661 0471 F001 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, onto ferritin HIV-1 En trimer on nanoparticles T332N_ T332N ferritin 0472 F002 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, onto Luminase synthase HIV-1 En trimer on nanoparticles T332N_ T332N LS 0473 F003 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Helicobacter pylori SOSIP-linker-particle T332N_ T332N ferritin 3bve_ferr-24_1ln 0474 F004 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Helicobacter pylori SOSIP-linker-particle T332N_ T332N ferritin 3bve_ferr-24_3ln 0475 F005 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Helicobacter pylori SOSIP-linker-particle T332N_ T332N ferritin 3bve_ferr-24_15ln 0476 F006 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, lumazine synthase from SOSIP-linker-particle T332N_ T332N aquifex aeolicus 1hqk_ls-60_3ln 0477 F007 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, lumazine synthase from SOSIP-linker-particle T332N_ T332N aquifex aeolicus 1hqk_ls-60_15ln 0478 F008 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, DSDNA bacteriophage SOSIP-linker-particle T332N_ T332N HK97 mature lohg_bph-hk97- empty capsid 420_1ln 0479 F009 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, DSDNA bacteriophage SOSIP-linker-particle T332N_ T332N HK97 mature lohg_bph-hk97- empty capsid 420_3ln 0480 F010 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, DSDNA bacteriophage SOSIP-linker-particle T332N_ T332N HK97 mature lohg_bph-hk97- empty capsid 420_5ln 0481 F011 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, DSDNA bacteriophage SOSIP-linker-particle T332N_ T332N HK97 mature lohg_bph-hk97- 420_15ln 0482 F012 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE Q BETA SOSIP-linker-particle T332N_ T332N CAPSID iqbe_bph-qB-180_7ln 0483 F013 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE Q BETA SOSIP-linker-particle T332N_ T332N CAPSID lqbe_bph-qB-180_15ln 0484 F014 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, bacteriophage PP7from SOSIP-linker-particle T332N_ T332N Pseudomonas aeruginosa ldwn_bph-pp7- 180_10ln 0485 F015 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, bacteriophage PP7from SOSIP-linker-particle T332N_ T332N Pseudomonas aeruginosa ldwn_bph-pp7- 180_15ln 0486 F016 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, bacteriophage PRR1 SOSIP-linker-particle T332N_ T332N 2vf9_bph-prr1- 180_101_n 0487 F017 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, bacteriophage PRR2 SOSIP-linker-particle T332N_ T332N 2vf9_bph-prr1- 180_15ln 0488 F018 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE GA SOSIP-linker-particle T332N_ T332N PROTEIN CAPSID Igav_bph-gα-180_10ln 0489 F019 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE GA SOSIP-linker-particle T332N_ T332N PROTEIN CAPSID Igav_bph-gα-180_15ln 0490 F020 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, caulobacter bacteriophage SOSIP-linker-particle T332N_ T332N 5-virus-like 2w4y_bph-5-180_10ln particle 0491 F021 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, caulobacter bacteriophage SOSIP-linker-particle T332N_ T332N 5-virus-like 2w4y_bph-5-180_15ln particle 0492 F022 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE FR CAPSID SOSIP-linker-particle T332N_ T332N lfrs_bph-fr-180_10ln 0493 F023 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, BACTERIOPHAGE FR CAPSID SOSIP-linker-particle T332N_ T332N lfrs_bph-fr-180_15ln 0494 F024 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, PHAGE MS2 PROTEIN CAPSID SOSIP-linker-particle T332N_ T332N lmva_ph-ms2-180_7ln 0495 F025 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, PHAGE MS2 PROTEIN CAPSID SOSIP-linker-particle T332N_ T332N lmva_ph-ms2- 180_15ln 0496 F026 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, tomato bushy stunt virus, particle-linker-SOSIP T332N_ T332N v. coat protein 2tbv_tom-v-180_7ln 0497 F027 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, tomato bushy stunt virus, particle-linker-SOSIP T332N_ T332N v. coat protein 2tbv_tom-v-180_15ln 0498 F028 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, SESBANIA MOSAIC VIRUS particle-linker-SOSIP T332N_ T332N COAT PROTEIN lsmv_sesb-mv-180_7ln 0499 F029 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, SESBANIA MOSAIC VIRUS particle-linker-SOSIP T332N_ T332N COAT PROTEIN lsmv_sesb-mv- 180_15ln 0500 F030 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, RICE YELLOW MOTTLE VIRUS particle-linker-SOSIP T332N_ T332N lf2n_rice-ymv-180_7ln 0501 F031 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, RICE YELLOW MOTTLE VIRUS particle-linker-SOSIP T332N_ T332N lf2n_rice-ymv- 180_15ln 0502 F032 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Cocksfoot mottle virus particle-linker-SOSIP T332N_ T332N IngO_cfmv-180_7ln 0503 F033 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Cocksfoot mottle virus particle-linker-SOSIP T332N_ T332N IngO_cfmv-180_15ln 0504 F034 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, protein cage by particle-linker-SOSIP T332N_ T332N Escherichia coli 2- 2wqt_mhpd-60_1ln hydroxypentadienoic acid hydratase 0505 F035 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Same as Seq_0504 particle-linker-SOSIP T332N_ T332N 2wqt_mhpd-60_3ln 0506 F036 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Same as Seq_0504 particle-linker-SOSIP T332N_ T332N 2wqt_mhpd-60_5ln 0507 F037 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Same as Seq_0504 particle-linker-SOSIP T332N_ T332N 2wqt_mhpd-60_15ln 0508 G001 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. GGSGG GCN4 Trimerization domain T332N_ T332N GGSGG GCN4 0509 G002 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. GGSGSGG N 3HSH Trimerization domain T332N_ T332N atgp120 N-term GGSGSGG N 3HSH 0510 G003 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. GG C 3HSH Trimerization domain T332N_ T332N at gp41 C-term GG C 3HSH 0511 H001 BG505.SOSIP.R6.664. BG505 5OSIP.R6.664. V1V2 Swap CAP256.SU V1V2 Swap CAP256.SU T332N, V1V2 Swap CAP256.SU T332N 0512 H002 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. V1V2 Swap BB201.B42 V1V2 Swap BB201.B42 T332N, V1V2 Swap BB201.B42 T332N 0513 H003 BG505.SOSIP.R6.664. BG505 5OSIP.R6.664. V1V2 Swap KER2018.11 V1V2 Swap KER2018.11 T332N, V1V2 Swap KER2018.11 T332N 0514 H004 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. V1V2 Swap CH070.1 V1V2 Swap CH070.1 T332N, V1V2 Swap CH070.1 T332N 0515 H005 BG505.SOSIP.R6.664. BG505 5OSIP.R6.664. V1V2 Swap ZM233.6 V1V2 Swap ZM233.6 T332N, V1V2 Swap ZM233.6 T332N 0516 H006 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. V1V2 Swap Q23.17 V1V2 Swap Q23.17 T332N, V1V2 Swap Q23.17 T332N 0517 H007 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. V1V2 Swap A244 V1V2 Swap A244 T332N, V1V2 Swap A244 T332N 0518 H008 BG505.SOSIP.R6.664. BG505 SOSIP.R6.664. V1V2 Swap WITO.33 V1V2 Swap WITO.33 T332N, V1V2 Swap WITO.33 T332N 0519 Z001 0520 Z002 0521 Z003 0522 Z004 0523 Z005 0524 Z006 0525 Z007 0526 Z008 0527 Z009 0528 Z010 0529 Z011 0530 Z012 0531 Z013 0532 Z014 0533 Z015 0534 Z016 0535 Z017 0536 Z018 0537 Z019 0538 Z020 0539 Z021 0540 Z022 0541 Z023 0542 Z024 0543 T001 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N C-6ln-HATM 0544 T002 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N C-10ln-HATM 0545 T003 bC-10ln_IP-6ln-HATM BG505 Transmembrane 0546 T004 bC-10ln_IP-10ln-HATM BG505 Transmembrane 0547 T005 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N N-NATM-6ln-C-6ln- HATM 0548 T006 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N C-10ln-HATM 0549 T007 bC-10ln_IP-N-NATM- BG505 Transmembrane 6ln-6ln-HATM 0550 T008 bC-10ln_IP-10ln-HATM BG505 Transmembrane 0551 T009 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A201C/A433C Transmembrane T332N_ T332N A201C/A433C-N-NATM- 6ln-C-6ln-HATM 0552 T010 BG505SOSIP.R6.664. BG505 5OSIP.R6.664. A201C/A433C Transmembrane T332N_ T332N A201C/A433C-C-10ln- HATM 0553 T011 bC-10ln_IP-A201C/A433C- BG505 Transmembrane N-NATM-6ln-C-6ln-HATM 0554 T012 bC-10ln_IPA201C/A433C BG505 Transmembrane 10ln-HATM 0555 T013 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A201C/A433C Transmembrane T332N_ T332N A201C/A433C-C-6ln- HATM 0556 T014 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A201C/A433C Transmembrane T332N_ T332N A201C/A433C-C-10ln- HATM 0557 T015 bC-10ln_IP-A201C/ BG505 Transmembrane A433C-6ln-HATM 0558 T016 bC-10ln_IP-A201C/ BG505 Transmembrane A433C-10ln-HATM 0559 T017 bC-10ln_IPA201C/A433C- BG505 Transmembrane N-NATM-6ln-C-6ln-HATM 0560 T018 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N N-NATM-6ln 0561 T019 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. Transmembrane T332N_ T332N N-10ln-NATM 0562 T020 bC-10ln_IP-6ln-N-NATM BG505 Transmembrane 0563 T021 bC-10ln_IP-10ln-N-NATM BG505 Transmembrane 0564 T022 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A433P Transmembrane T332N_ T332N A433P-N-NATM-6ln-C- 6ln-HATM 0565 T023 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A433P Transmembrane T332N_ T332N A433P-C-10ln-HATM 0566 T024 bC-10ln_IPA433P-N- BG505 Transmembrane NATM-6ln-6ln-HATM 0567 T025 bC-10ln_IPA433P 10ln-HATM BG505 Transmembrane 0568 T026 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A433P Transmembrane T332N_ T332N A433P-C-6ln-HATM 0569 T027 BG505SOSIP.R6.664. BG505 SOSIP.R6.664. A433P Transmembrane T332N_ T332N A433P-C-10ln-HATM 0570 T028 bC-10ln_IPA433P--6ln-HATM BG505 Transmembrane 0571 T029 bC-10ln_IPA433P 10ln-HATM BG505 Transmembrane 0572 Z025 0573 Z026 0574 Z027 0575 Z028 Ferritin subunit 0576 Z029 lumazine synthase subunit 0577 Z030 Sulfer Oxygenase Reductase subunit 0578 Z031 Foldon domain 0579 H017 Cap256-SU_bg505- CAP256-SU/BG505 SOSIP, R6, 664 BG505 Platform Chimeric gp140 with BG505 NCgp120 + chimera (Res. 31-45, 478-507, zp4lecto/gp120-NC+ Interface Res. int + gp41.SOSIP 512-664), BG505 set A “platform” and heterologous Interface gpl20 (Int.) Res. set ft (Res. 46-54; 70-75; 84-89; 99; 102; 106; 107; 114; 215; 220-224; 226; 244; 471- 473; 476-477), remainder = Cap256-SU 0580 H018 SHIV-1157ipd3N4_bg505- 5HIV-1157ipd3N4/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder- SHIV-1157ipd3N4 0581 H019 CH117.4_332N_bg505- CH117.4/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-CH117.4 gp120 0582 H020 CNE58_SU-strandC_bg505- CNE58_SU-strandC/ SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + BG505 BG505 Int. Res. set A; int + gp41.SOSIP chimera remainder-CNE58 SU-strand C 0583 H021 25925-2.22_bg505- 25925-2.22/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-25925-2.22 0584 H022 3301_V1_C24_bg505- 3301_V1_C24/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-3301 VI C24 0585 H023 ZM53-R166W_bg505- ZM53/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder- ZM53-R166Wgp120 0586 H024 ZM53_bg505- ZM53/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-ZM53 0587 H025 KER2018.11_bg505- KER2018.11/BG505 SOSIP, R6, 664 BG505 Platform, heterologous gp120 NCgp120 + gp41.SOSIP chimera remainder- with (gp41 + KER2018.11 gp120-NC (Res. 31-45; 478-507) from 3G505.SOSIP) 0588 H026 KER2018.11_bg505- KER2018.11/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-KER2018.il 0589 H027 ZM233.6_bg505- ZM233.6/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41.SOSIP chimera remainder-ZM233.6 0590 H028 ZM233.6_bg505- ZM233.6/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0579 NCgp120 + chimera BG505 Int. Res. set A; int + gp41.SOSIP remainder-ZM233.6 0591 H029 UG037.8_bg505- UG037.8/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41.SOSIP chimera BG505 Int. Res. set A; remainder-UG037.8 0592 H030 C13_psv02_bg505- C13/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41.SOSIP chimera BG505 Int. Res. set A; remainder-C13 0593 H031 45_01dG5_bg505- 45_01dG5/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41.SOSIP chimera BG505 Int. Res. set A; remainder-45 01dG5 0594 H032 ZM215.8-dCD4bsGlyc_bg505- ZM215.8/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41.SOSIP chimera BG505 Int. Res. set A; remainder-ZM215.8- dCD4bsGlyc 0595 H033 426c-dCD4bsGlyc_bg505- 426c/BG505 SOSIP, R6, 664 BG505 Platform, Same as Seq_0379 NCgp120 + gp41. chimera BG505 Int. Res. set A; SOSIP remainder- 426c-dCD4bsGlyc 0596 F038 3g505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PP7 sosip-linker-particle ldwn_bph-pp7-180_3-127_Sin_mut1 T332N 0597 F039 bg505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PP7 Same as Seq_0596 ldwn_bph-pp7-180_3-127_8ln_mut1 T332N 0598 F040 g505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PP7 Same as Seq_0596 ldwn_bph-pp7-180_3-127_8ln_mut1 T332N 0599 F041 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE Q BETA Same as Seq_0596 lqbe_bph-qB-180_6-132_3ln_mut1 T332N CAPSID 0600 F042 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE Q BETA Same as Seq_0596 lqbe_bph-qB-180_6-132_Sin_mut1 T332N CAPSID 0601 F043 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE Q BETA Same as Seq_0596 lqbe_bph-qB-180_6-132_10ln_mut1 T332N CAPSID 0602 F044 bg505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PRR1 Same as Seq_0596 2vf9_bph-prr1-180_6-131-3ln_mut1 T332N 0603 F045 bg505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PRR1 Same as Seq_0596 2vf9_bph-prr1-180_6-131-5ln_mut1 T332N 0604 F046 bg505.sosip_ BG505 SOSIP, R6, 664, bacteriophage PRR1 Same as Seq_0596 2vf9_bph-prr1- T332N 180_6-131-10ln_mut1 0605 F047 3g505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE GA Same as Seq_0596 lgav_bph-gα- T332N PROTEIN CAPSID 180_7-129_3ln_mut1 0606 F048 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE GA PROTEIN Same as Seq_0596 lgav_bph-gα- T332N CAPSID 180_7-129_5ln_mut1 0607 F049 3g505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE GA PROTEIN Same as Seq_0596 lgav_bph-gα- T332N CAPSID 180_7-129_10ln_mut1 0608 F050 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE FR CAPSID Same as Seq_0596 lfrs_bph-fr- T332N 180_7-129_5ln_mut1 0609 F051 sg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE FR CAPSID Same as Seq_0596 lfrs_bph-fr- T332N 180_7-129_10ln_mut1 0610 F052 bg505.sosip_ BG505 SOSIP, R6, 664, BACTERIOPHAGE FR CAPSID Same as Seq_0596 lfrs_bph-fr-180_ T332N 7-129_15ln_mut1 0611 F053 3g505.sosip_ BG505 SOSIP, R6, 664, PHAGE MS2 PROTEIN CAPSID Same as Seq_0596 lmva_ph-ms2-180_ T332N 7-129_Sin_mut1 0612 F054 bg505.sosip_ BG505 SOSIP, R6, 664, PHAGE MS2 PROTEIN CAPSID Same as Seq_0596 lmva_ph-ms2-180_ T332N 7-129_10ln_mut1 0613 F055 3g505.sosip_ BG505 SOSIP, R6, 664, PHAGE MS2 PROTEIN CAPSID Same as Seq_0596 lmva_ph-ms2-180_ T332N 7-129_15ln_mut1 0614 F056 bg505.sosip_ BG505 SOSIP, R6, 664, LUMAZINE SYNTHASE Same as Seq_0596 1hqk_ls-60_9ln_mut1 T332N FROM AQUIFEX AEOLICUS 0615 F057 bg505.sosip_ BG505 SOSIP, R6, 664, Helicobacter pylori Same as Seq_0596 3bve_ferr-24_9ln_mut1 T332N ferritin 0616 F058 BG505.SOSIP. BG505 SOSIP, R6, 664, M1 protein sosip-self- linker_1AA7_Ln9 T332N assembling protein cage 0617 F059 BG505.SOSIP. BG505 SOSIP, R6, 664, M1 protein sosip-self- linker_1AA7_Lnl2 T332N assembling protein cage 0618 F060 BG505.SOSIP. BG505 SOSIP, R6, 664, M1 protein sosip-self- inker_1AA7_Lnl5 T332N assembling protein cage 0619 F061 BG505.SOSIP. BG505 SOSIP, R6, 664, M1 protein sosip-self- linker_1AA7_Lnl8 T332N assembling protein cage 0620 F062 BG505SOSIP- BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- linker3-3VDX T332N assembling protein cage 0621 F063 BG505SOSIP- BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- linker8-3VDX T332N assembling protein cage 0622 F064 BG505SOSIP-linker9-3VDX BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- T332N assembling protein cage 0623 F065 BG505SOSIP-linkerl2-3VDX BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- T332N assembling protein cage 0624 F066 BG505SOSIP-linkerl5-3VDX BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- T332N assembling protein cage 0625 F067 BG505SOSIP-linkerl8-3VDX BG505 SOSIP, R6, 664, 3VDX Cage sosip-self- T332N assembling protein cage 0626 F068 BG505.SOSIP.T332N_ BG505 Circ. permut., Circ. permut., ZM233_NtermH1_4_Ferritin SOSIP, V1V2 swap, T332N, 664, anoparticle V1V2swap, anoparticle 0627 F069 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 Ker2018_NtermH1_4_Ferritin 0628 F070 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 201C, 433C Same as Seq_0626 ZM233_201C433C_NtermH1_4 Ferritin 0629 F071 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 201C, 433C Same as Seq_0626 Ker2018_201C433C_NtermH1 _4_Ferritin 0630 F072 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233 NtermHl 6 Ferritin 0631 F073 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018 NtermHl 6 Ferritin 0632 F074 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233_NtermH1_6_longer_Fe rritin 0633 F075 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018_NtermH1_6_longer_ Ferritin 0634 F076 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233 NtermHl 12 Ferritin 0635 F077 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018_NtermH1_12_Ferritin 0636 F078 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233 NtermHl Tri Ferritin 0637 F079 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018_NtermH1_Tri_ Ferritin 0638 F080 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018 Circ LS 0639 F081 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018 Circ short LS 0640 F082 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018 Circ long LS 0641 F083 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233 Circ LS 0642 F084 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 201C, 433C Same as Seq_0626 ZM233 201C433C Circ LS 0643 F085 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 ZM233 NtermHl Tri LS 0644 F086 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 Same as Seq_0626 KER2018 NtermHl Tri LS 0645 F087 BG505.SOSIP.T332N_ BG505 Same as Seq_0626 201C, 433C Same as Seq_0626 ZM233_NtermH1_Tri_201C433 C LS 0646 A204 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I225C/V245C DS T332N_ T332N I225C/V245C 0647 A205 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V36C_T606C DS T332N_ T332N V36C/T606C 0648 A206 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F37C_T606C DS T332N_ T332N T37C/T606C 0649 A207 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V36C_V496C DS T332N_ T332N V36C/V496C 0650 A208 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V36C_P498C DS T332N_ T332N V36C/P498C 0651 A209 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F37C_A497C DS T332N_ T332N T37C/A497C 0652 A210 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V38C_V496C DS T332N_ T332N V38C/V496C 0653 A211 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A200C/Q432C DS T332N_ T332N A200C/Q432C 0654 A212 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F202C_M434C DS T332N_ T332N T202C/M434C 0655 A213 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T202C_M434C_G431F DS, CavF at gp120 C4 T332N_ T332N substitued with T202C/M434C/G431F F and stablize gp120, interprotomer 0656 A214 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F202C_A433C DS T332N_ T332N T202C_A433C 0657 A215 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V182D salt bridge at gp120 V2 T332N_ T332N to stablize V2 V182D by subtitution of D, 0658 A216 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I251F/L260F hydrophobic core betwwen gp120 T332N_ T332N V2/V3 with double F I251F/L26OF substitution to stabilize V1/V2/V3 0659 A217 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I225C/V488C DS T332N_ T332N I225C/V488C 0660 A218 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N478F CavF at gp120 C terminus T332N_ T332N substitued N478F with F and stablize gp120 C terminus 0661 A219 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F163D_Q170R salt bridge at gp120 T332N_ T332N V2 to stablize T163D_Q170R V1/V2 with D and R substitution 0662 A220 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F163C_Q170C DS T332N_ T332N T163C_Q170C 0663 A221 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 309R_Q315D salt bridge at gp120 T332N_ T332N V3 to stablize I309R_Q315D V1/V2/V3 with D and R subtitution 0664 A222 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 294C_V333C DS T332N_ T332N I294C_V333C 0665 A223 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 294D_V333R salt bridge at gp120 T332N_ T332N V3 to stablize I294D_V333R V1/V2/V3 with D and R subtitution 0666 A224 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G380F_P437F hydrophobic core at gp120 C T332N_ T332N terminus with double-F G380F_P437F substitution to stabilize gp120 C terminus 0667 A225 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G380F CavF at gp120 C4 with F T332N_ T332N substitution G380F to stablize gp120 0668 A226 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 3437F CavF at gp120 C terminus with F T332N_ T332N substitution and P437F stablize gp120 C terminus 0669 A227 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V254F_L260F_L261F_ hydrophobic core at gp120 C2 with T332N_ T332N G263F four-F substitution to V254F_L260F_L261F_G stabilize gp120 263F 0670 A228 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V254F CavF at gp120 C2 with F substitution T332N_ T332N to stablize gp120 V254F 0671 A229 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L260F CavF at gp120 C2 with F substitution T332NL260F T332N to stablize gp120 0672 A230 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L261F CavF at gp120 C2 with F substitution T332N_ T332N to stablize gp120, interprotomer L261F 0673 A231 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, G263W CavF at gp120 C2 with W substitution T332N_ T332N to stablize gp120, interprotomer G263W 0674 A232 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A55F_V75F hydrophobic core at gp120 C1 with T332N_ T332N double-F substitution to stabilize A55F_V75F gp120 N terminus 0675 A233 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T77F_V245F hydrophobic core at gp120 C1/C2 T332N_ T332N with double-F substitution T77F_V245F to stabilize gp120 N terminus 0676 A234 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, T77F CavF at gp120 C1 with T332N_ T332N F substitution T77F to stablize gp120 N terminus 0677 A235 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S56H_P76E salt bridge at gp120 T332N_ T332N C1 to stablize S56H_P76E gp120 N terminus with H and E subtitution 0678 A236 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A55F CavF at gp120 C1 with T332N_ T332N F substitution A55F to stablize gp120 N terminus 0679 A237 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A55F_P81W hydrophobic core at gp120 C1 with F T332N_ T332N and W substitution to A55F_P81W stabilize gp120 V terminus 0680 A238 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L52F_I215W hydrophobic core at gp120 C1/C2 T332N_ T332N with double-F substitution to L52F_I215W stabilize gp120 N terminus 0681 A239 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 109KO428E salt bridge at gp120 C1/C4 T332N_ T332N to stablize I109K_Q428E gp120 N/C terminus with K and E substitution 0682 A240 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F257C S375C DS T332N_ T332N T257C S375C 0683 A241 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A55C T77C DS T332N_ T332N A55C T77C 0684 A242 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125F_L193W hydrophobic core at gp120 V1/V2 T332N_ T332N with F or W substitution to stabilize L125F_L193W gp120Vl/V2 0685 A243 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125F CavF at gp120 V1/V2. Substitute F to T332N_ T332N stabilize V1/V2/V3 L125F 0686 A244 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N136W CavF at gp120 V1 Substitute W to T332N_ T332N stabilize V1/V2/V3 N136W 0687 A245 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N136W_L154W hydrophobic core at gp120 V1 with T332N_ T332N double W substitution N136W_L154W to stabilize gp120 Vl/V2 0688 A246 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L193F_N195C_I423C DS, CavF at gp120 V1 substituted with T332N_ T332N F and stabilize V1/V2, interprotomer L193F_N195C_I423C 0689 A247 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I323W_I326F hydrophobic core at gp120 V3 with W T332N_ T332N or F substitution to I323W_I326F stabilize gp120 V1/V2/V3 0690 A248 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I323W CavF at gp120 V3. Substitute F to T332N_ T332N stabilize V1/V2/V3 I323W 0691 A249 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I326F CavF at gp120 V3. Substitute F to T332N_ T332N stabilize V1/V2/V3 I326F 0692 A250 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M475F-N478F hydrophobic core at gp120 V3 with W T332N_ T332N or F substitution to M475F_N478F stabilize gp120 V1/V2/V3 0693 A251 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q130H salt bridge at gp120 T332N_ T332N C1 to stabilize Q130H gp120 N/C terminus with H substitution 0694 A252 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q103D_T106K salt bridge at gp120 C1 T332N_ T332N to stabilize Q103D_T106K gp120 N/C terminus with K and D substitution 0695 A253 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, S110H_Q114E salt bridge at gp120 T332N_ T332N C1 to stabilize $110H_Q114E gp120 N/C terminus with H and E substitution 0696 A254 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M150F_I326W hydrophobic core at gp120 V1/V3 T332N_ T332N with W or F substitution M150F_I326W to stabilize gp120 V1/V2/V3 0697 A255 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L111W CavF at gp120Cl. Substitute W to T332N_ T332N stabilize gp120 terminus L111W 0698 A256 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204F_V208W hydrophobic core at gp120 C2 with W T332N_ T332N or F substitution to stabilize gp120 A204F_V208W V1/V2/V3, interprotomer 0699 A257 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L537C_G41C DS T332N_ T332N L537C_G41C 0700 A258 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V245F CavF at gp120C2. T332N_ T332N Substitute F to V245F stabilize gp120 V1/V2/V3, interprotomer 0701 A259 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L125W, I195W Cavity filling of T332N_ T332N V1V2-V3 interface L125W.I195W near 126-196 disulfide bond 0702 A260 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F139W, D140l, G324l, hydrophobic patch between V1V2 T332N_ T332N D325W and V3 near base of V3 V2V3_Hyd2 and Variable loop 1 in V1V2 0703 A261 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Y173W CavF at gp120 V1/V2/V3. 173: T332N_ T332N Substitute W or F Y173W 0704 A262 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L179W Stabilized V1V2 cap T332N_ T332N L179W 0705 A263 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L175F CavF: V1V2-V3 interface, T332N_ T332N Substitute F or W, L175F 0706 A264 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L175W CavF: V1V2-V3 interface, T332N_ T332N Substitute F or W, L175W 0707 A265 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, E153F CavF: V1V2-V3/gp120core interface, T332N_ T332N Substitute F or W, E153F 0708 A266 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, E153W CavF: V1V2-V3/gp120core interface, T332N_ T332N Substitute F or W, E153W 0709 A267 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L154F CavF at gp120Vl/V2. Substitute F, Y T332N_ T332N or W, stabilize V1/V2/V3 L154F 0710 A268 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L154W CavF at gp120 V1/V2. Substitute F, Y T332N_ T332N or W, stabilize V1/V2/V3 L154W 0711 A269 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, E164F CavF: inter-protomer, Substitute F or T332N_ T332N W, E164F 0712 A270 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, E164W CavF: inter-protomer, Substitute F or T332N_ T332N W, E164W 0713 A271 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F198F CavF: V1V2-gp120core interface T332N_ T332N T198F 0714 A272 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F202F CavF: V1V2-gp120core interface, T332N_ T332N Substitute F or W, T202F 0715 A273 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F202W CavF: V1V2-gp120core interface T332N_ T332N T202W 0716 A274 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204F CavF: V1V2-gp120core interface, T332N_ T332N Substitute F or W, A204F 0717 A275 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I423F CavF: gp120core- V1V2 interface, T332N_ T332N Substitute F or W, I423F 0718 A276 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 423W CavF: gp120core- V1V2 interface T332N_ T332N I423W 0719 A277 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q432F CavF: stabilize unliganded T332N_ T332N conformation of bridging sheet Q432F region. Substitute F or W, 0720 A278 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, Q432W, Substitute CavF: stabilize unliganded T332N_ T332N For W, conformation of bridging Q432W sheet region 0721 A279 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A436M CavF: stabilize unliganded T332N_ T332N conformation of A436M bridging sheet region, Substitute F, M or W, 0722 A280 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A436F Same as Seq_0721 T332N_ T332N A436F 0723 A281 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A436W Same as Seq_0721 T332N_ T332N A436W 0724 A282 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, A204W CavF: V1V2-gp120core interface, T332N_ T332N Substitute F or W, A204W 0725 A283 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, N302F CavF: V3- V1V2/gp120core interface, T332N_ T332N Substitute F or W, N302F 0726 A284 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, M302W CavF: V3- V1V2/gp120core interface, T332N_ T332N Substitute F or W, N302W 0727 A285 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 307W V1V2/V3 stabilization/packing, T332N_ T332N Substitute F or W, I307W 0728 A286 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I307F V1V2/V3 stabilization/packing/non- T332N_ T332N bridging sheet, Substitute F or W, I307F 0729 A287 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F210A α-1 helix/destablize CD4-bound T332N_ T332N conformation F210A 0730 A288 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F176W/I323Y CavF at gp120 V1/V2/V3. T332N_ T332N 176: Substitute Y or W; F176W_I323Y 323: F, Y, or W; stabilize V1/V2/V3 0731 A289 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F176W/L154W CavF at gp120 V1/V2. 176: Substitute T332N_ T332N V or W; F176W_L154W 154: F, Y, or W; stabilize V1/V2/V3 0732 A290 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F159Y/L154W CavF at gp120 V1/V2. 159: Substitute T332N_ T332N Y or W; F159Y_L154W 154: F, Y, or W; stabilize V1/V2/V3 0733 A291 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F176W CavF at gp120 V1/V2. Substitute Y or T332N_ T332N W, stabilize V1/V2/V3 F176W 0734 A292 BG505.R6.664_G41C_L537C BG505 R6, 664 G41C_L537C DS between gp120 and gp41 0735 A293 BG505.R6.664_G41C_A541C BG505 R6, 664 G41C_A541C dS between gp120 and gp41 0736 A294 BG505.R6.664_P43C_A526C BG505 R6, 664 343C_A526C DS between gp120 and gp41 0737 A295 BG505.R6.664_A73C_G572C BG505 R6, 664 A73C_G572C DS between gp120 and gp41 0738 A296 BG505.R6.664_I84C_G521C BG505 R6, 664 I84C_G521C DS between gp120 and gp41 0739 A297 BG505.R6.664_V89C_G527C BG505 R6, 664 V89C_G527C DS between gp120 and gp41 0740 A298 BG505.IP.R6.664. BG505 IP, R6, 664, A73C_G572C DS between gp120 and gp41 T332N_ T332N A73C_G572C 0741 A299 BG505.IP.R6.664. BG505 IP, R6, 664, I84C_G521C DS between gp120 and gp41 T332N_ T332N I84C_G521C 0742 A300 BG505.IP.R6.664. BG505 IP, R6, 664, V89C_G527C DS between gp120 and gp41 T332N_ T332N V89C_G527C 0743 A301 BG505.SOSIP.R6.664. BG505 IP, R6, 664, R304C/Q440C DS T332N_ T332N R304C/Q440C 0744 F088 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I201C/A433C polymeric Fc-fusion protein T332N_ T332N I201C/A433C_ polymer hFc fusion 0745 0 ZM233.6 ZM233.6 0746 0 Q23.17 Q23.17 0747 0 A244 A244 0748 0 WITO.33 WITO.33 0749 0 ZM53.12 ZM53.12 0750 0 CNE58 CNE58 0751 0 3301_V1_C24 3301_V1_C24 0752 Z032 foldon domain 0753 Z033 foldon domain 0754 Z034 foldon domain 0755 Z035 foldon domain 0756 Z036 Encapsulin subunit 0757 Z037 DNA encoding SEQ ID NO: 352 0758 Z038 BG505 transmembrane domain 0759 Z039 DNA encoding BG505 transmembrane domain 0760 Z040 Influenza A Hemagglutinin transmembrane domain 0761 Z041 DNA encoding Influenza A Hemagglutinin transmembrane domain 0762 Z042 Influenza A Neuraminidase transmembrane domain 0763 Z043 DNA encoding Influenz a A Neuraminidase transmembrane domain 0764 H034 Cap256-SU_bg505- CAP256-SU/BG505 SOSIP, R6, 664 CAP256-SU gp120 Heterologous NCgp120 + gp41. chimera With gp120 with SOSIP_ (gp41 + gp120-NC (gp41 + ds201-433 from BG505.SOSIP) gp120-NC (Res. 31-45; 478-507) from 3G505. SOSIP 0765 H035 3301_bg505- 3301_V1_C24/BG505 SOSIP, R6, 664 3301_V1_C24 gp120 Same as Seq_0764 NCgp120 + gp41. chimera with (gp41 + gp120- SOSIP_ MCfrom BG505.SOSIP) ds201-433 0766 H036 ZM53_bg505- ZM53/BG505 SOSIP, R6, 664 ZM53 gp120 with Same as Seq_0764 NCgp120 + gp41. chimera (gp41 + gp120-NC from SOSIP_ BG505.SOSIP) ds201-433 0767 H037 Cap256-SU_bg505- CAP256-SU/BG505 SOSIP, R6, 664 CAP256-SU gp120 BG505 Platform + Int. NCgp120 + gp41. chimera with (gp41 + gp120-NC Res. Set A SOSIP + int_ ds201- 433 from BG505.SOSIP) 0768 H038 3301_bg505- 3301_V1_C24/BG505 SOSIP, R6, 664 3301_V1_C24 gp120 Same as Seq_0767 NCgp120 + gp41. chimera with (gp41 + gp120- SOSIP + int_ NCfrom BG505.SOSIP) ds201-433 0769 H039 ZM53_bg505- ZM53/BG505 SOSIP, R6, 664 ZM53 gp120 with Same as Seq_ 0767 NCgp120 + gp41. chimera (gp41 + gp120-NC from SOSIP + int_ 3G505.SOSIP) ds201-433 0770 H040 CNE58-SUstrandC_bg505- CNE58/BG505 SOSIP, R6, 664 CNE58 gp120 with BG505 Platform and NCgp120 + chimera (gp41 + gp120-NC Res. 166-173 gp41. from BG505.SOSIP) from CAP256-SU SOSIP_ and (strand C from ds201-433 CAP256-SU) 0771 H041 CNE58-SUstrandC_bg505- CNE58/BG505 SOSIP, R6, 664 CNE58 gp120 with BG505 Platform NCgp120 + gp41. chimera (gp41 + gp120-NC and Res. 166-173 SOSIP_ from BG505.SOSIP) from ds304-440 and (strand C from CAP256-SU CAP256-SU) 0772 H042 BG505.SOSIP.664. BG505/CAP45 SOSIP, R6, 664, CAP45 as BG505.SOSIP.664. R6.T332N chimera T332N gp41 sequence R6.T332N_ construct with gp41 from CAP45 0773 A302 JR-FLgp140.6R. JR-FL SOSIP, R6, 664, 201C/A433C SOSIP.664. E168K E168K_I201C/A433C 0774 A303 JR-FLgp140.6R. JR-FL SOSIP, R6, 664, A433P SOSIP.664. E168K E168K_A433P 0775 A304 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, Q432P E168K_Q432P E168K 0776 A305 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, S174C/A319C E168K_S174C/A319C E168K 0777 A306 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, N195C/A433C E168K_N195C/A433C E168K 0778 A307 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, S199C/A433C E168K_S199C/A433C E168K 0779 A308 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, R304C/Q440C E168K_R304C/Q440C E168K 0780 A309 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, F223W E168K_F223W E168K 0781 A310 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, G473Y E168K_G473Y E168K 0782 A311 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, G431P E168K_G431P E168K 0783 A312 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, N425C_A433C E168K_N425C_A433C E168K 0784 A313 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, V120C_Q315C E168K_V120C_Q315C E168K 0785 A314 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, O203C_L122C E168K_Q203C_L122C E168K 0786 A315 IR- JR-FL SOSIP, R6, 664, 201C/A433C/R304C/ FLgp140.6R.SOSIP.664. E168K Q440C E168K_I201C/A433C/R304C/ Q440C 0787 A316 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, 3304C/R440C Lock V3 to gp120 to prevent E168K_R304C/R440C E168K exposure/opening 0788 A317 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, Q203C/F317C Same as Seq_0787 E168K_Q203C/F317C E168K 0789 A318 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, L122C/F317C Same as Seq_0787 E168K_L122C/F317C E168K 0790 A319 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, 437C/Y318C Same as Seq_0787 E168K_P437C/Y318C E168K 0791 A320 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, E172C/I307C Locking V3 to V1V2 to prevent E168K_E172C/I307C E168K exposure/opening 0792 A321 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, P206C/Y318C Same as Seq_0787 E168K_P206C/Y318C E168K 0793 A322 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, A174C/T319C Same as Seq_0791 E168K_A174C/T319C E168K 0794 A323 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, S164C/H3O8C Same as Seq_0791 E168K_S164C/H308C E168K 0795 A324 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, F320C/L175C Same as Seq_0791 E168K_T320C/L175C E168K 0796 A325 JR-FLgp140.6R.SOSIP.664. JR-FL SOSIP, R6, 664, T320C/P438C Same as Seq_0791 E168K_T320C/P438C E168K 0797 F089 KER2008.12_ V1V2V3CAP_ KER2008 V1V2V3 V1V2V3 constructed fer_15ln_gyc nanoparticle; at distances circ. permut., defined by the inter- 4TVP structure subunit disulfide, ferritin 0798 F090 KER2008.12_V1V2V3CAP_ KER2008 Same as Seq_0797 Same as Seq_0797 fer_101_n_gyc 0799 F091 KER2008.12_V1V2V3CAP_ KER2008 Same as Seq_0797 Same as Seq_0797 fer_101_n_gyc 0800 F092 Q23.17_V1V2V3CAP_ Q23.17 Same as Seq_0797 Same as Seq_0797 fer_15ln_gyc 0801 F093 Q23.17_V1V2V3CAP_ Q23.17 Same as Seq_0797 Same as Seq_0797 fer_10ln_gyc 0802 F094 Q23.17_V1V2V3CAP_ Q23.17 Same as Seq_0797 Same as Seq_0797 fer_5ln_gyc 0803 F095 KER2008.12_ KER2008 V1V2V3 Same as Seq_0797 V1V2V3CAP_ Nanoparticle LS_15ln_gyc circ. permut., inter- subunit disulfide, lumazine synthase 0804 F096 KER2008.12_ KER2008 Same as Seq_0803 Same as Seq_0797 V1V2V3CAP_LS_10ln_gyc 0805 F097 KER2008.12_V1V2V3CAP_ KER2008 Same as Seq_0803 Same as Seq_0797 LS_10ln_gyc 0806 F098 Q23.17_V1V2V3CAP_LS_ Q23.17 Same as Seq_0803 Same as Seq_0797 15ln_gyc 0807 F099 Q23.17_V1V2V3CAP_LS_ Q23.17 Same as Seq_0803 Same as Seq_0797 10ln_gyc 0808 F100 Q23.17_V1V2V3CAP_LS_ Q23.17 Same as Seq_0803 Same as Seq_0797 5ln_gyc 0809 F101 KER2008.12_ds175_320_ KER2008 V1V2V3 Same as Seq_0797 V1V2V3CAP_ nanoparticle fer_15ln__gyc circ. permut., inter- subunit disulfide, intra-subunit disulfide, Ferritin 0810 F102 KER2008.12_ds175_320_ KER2008 Same as Seq_0809 Same as Seq_0797 V1V2V3CAP_fer_10ln_gyc 0811 F103 KER2008.12_ds175_320_ KER2008 Same as Seq_0809 Same as Seq_0797 V1V2V3CAP_fer_10ln_gyc 0812 F104 Q23.17_ds174_319_ Q23.17 Same as Seq_0809 Same as Seq_0797 V1V2V3CAP_fer_15ln_gyc 0813 F105 Q23.17_ds174_319_ Q23.17 Same as Seq_0809 Same as Seq_0797 V1V2V3CAP_fer_10ln_gyc 0814 F106 Q23.17_ds174_319_ Q23.17 Same as Seq_0809 Same as Seq_0797 V1V2V3CAP_fer_5ln_gyc 0815 F107 KER2008.12_ds175_ KER2008 V1V2V3 nanoparticle Same as Seq_0797 320_ V1V2V3CAP_ LS_15ln_gyc circ. permut., inter- subunit disulfide, lumazine synthase, ntra-subunit disulfide 0816 F108 KER2008.12_ds175_320_ KER2008 Same as Seq_0815 Same as Seq_0797 V1V2V3CAP_LS_10ln_gyc 0817 F109 KER2008.12_ds175_320_ KER2008 Same as Seq_0815 Same as Seq_0797 V1V2V3CAP_LS_10ln_gyc 0818 F110 Q23.17_ds174_319_ Q23.17 Same as Seq_0815 Same as Seq_0797 V1V2V3CAP_LS_15ln_gyc 0819 F111 Q23.17_ds174_319_ Q23.17 Same as Seq_0815 Same as Seq_0797 V1V2V3CAP_LS_10ln_gyc 0820 F112 Q23.17_ds174_319_ Q23.17 Same as Seq_0815 Same as Seq_0797 V1V2V3CAP_LS_5ln_gyc 0821 F113 BG505 119-1364- BG505 V1V2V3 nanoparticle Same as Seq_0797 ln4-296-33H-ln + circ. permut. 151-2054-1ln + ferr 0822 F114 CNE58_SU-strandC_119-136 + CNE58 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 1ln + ferr 0823 F115 3301_V1_C24_119-1364-ln + 3301 V1V2V3 nanoparticle Same as Seq_0797 296-3314-ln4-151- circ. permut. 205 + 1ln + ferr 0824 F116 ZM53-R166W_119-136 + ZM53 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 1ln + ferr 0825 F117 ZM233.6_119-1364-ln4-296- ZM233 V1V2V3 nanoparticle Same as Seq_0797 3314-ln + 151-2054-1ln4-ferr circ. permut. 0826 F118 BG505_119-136 + BG505 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151-205 + 5ln + ferr 0827 F119 CNE58_SU-strandC_119-136 + CNE58 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 5ln + ferr 0828 F120 3301_V1_C24_119-136 + 3301 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 5ln + ferr 0829 F121 ZM53-R166W_119-136 + ZM53 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 5ln + ferr 0830 F122 ZM233.6_119-136 + ZM233 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151-205 + 5ln + ferr 0831 F123 BG505_119-136 + BG505 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151-205 + 10ln + ferr 0832 F124 CNE58_SU-strandC_119-136 + CNE58 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 101_n + ferr 0833 F125 3301_V1_C24_119-136 + 3301 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 101_n + ferr 0834 F126 ZM53-R166W_119-136 + ZM53 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 101_n + ferr 0835 F127 ZM233.6_119-136 + ZM233 V1V2V3 nanoparticle Same as Seq_0797 ln + 296-331 + circ. permut. ln + 151- 205 + 101_n + ferr 0836 E001 KER2008.12_ V1V2V3CAP_ KER2008 V1V2V3 scaffold Same as Seq_0797 lVH8cp_10ln_gyc circ. permut., inter- subunit disulfide, 1VH8 0837 E002 KER2008.12_ V1V2V3CAP_ KER2008 V1V2V3 scaffold circ. Same as Seq_0797 lVH8cp_15ln_gyc permut., inter- subunit disulfide, 1VH8 0838 E003 Q23.17_ V1V2V3CAP_ Q23.17 V1V2V3 scaffold Same as Seq_0797 lVH8cp_10ln_gyc circ. permut., inter- subunit disulfide, 1VH8 0839 E004 Q23.17_ V1V2V3CAP_ Q23.17 V1V2V3 scaffold Same as Seq_0797 lVH8cp_15ln_gyc circ. permut., inter- subunit disulfide, 1VH8 0840 E005 KER2008.12_ds175_ KER2008 V1V2V3 scaffold Same as Seq_0797 320_ V1V2V3CAP_ circ. permut., inter- lVH8cp_10ln gyc subunit disulfide, 1VH8, intra-subunit disulfide 0841 E006 KER2008.12_ds175_ KER2008 V1V2V3 scaffold Same as Seq_0797 320_ V1V2V3CAP_ circ. permut., inter- lVH8cp_15ln subunit disulfide, _gyc 1VH8, intra-subunit disulfide 0842 E007 Q23.17_ds174_ Q23.17 V1V2V3 scaffold Same as Seq_0797 319_ V1V2V3CAP_ circ. permut., inter- lVH8cp_10ln_gyc subunit disulfide, 1VH8, intra-subunit disulfide 0843 E008 Q23.17_ds174_319_ V1V2V3CAP_ Q23.17 V1V2V3 scaffold Same as Seq_0797 lVH8cp_15ln_gyc circ. permut., inter- subunit disulfide, 1VH8, intra-subunit disulfide 0844 G004 BG505_119-136 + BG505 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 3ln + foldon 0845 G005 CNE58_SU-strandC_119-136 + CNE58 V1V2V3 trimerization Same as Seq_0797 ln + 296-331 + -domain circ. ln + 151- permut. 205 + 3ln + foldon 0846 G006 3301_V1_C24_119-136 + 3301 V1V2V3 trimerization Same as Seq_0797 ln + 296-331 + n + 151- -domain circ. 205 + 3ln + foldon permut. 0847 G007 ZM53-R166W_119-136 + ZM53 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 3ln + foldon 0848 G008 ZM233.6_119-136 + ZM233 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 3ln + foldon 0849 G009 BG505_119-136 + BG505 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 7ln + foldon 0850 G010 CNE58_SU-strandC_119-136 + CNE58 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 7ln + foldon 0851 G011 3301_V1_C24_119-1364-ln + 3301 V1V2V3 trimerization- Same as Seq_0797 296-3314-ln4-151- domain circ. 205 + 7ln + foldon permut. 0852 G012 ZM53-R166W_119-136 + ZM53 V1V2V3 trimerization- Same as Seq_0797 ln + 296-331 + domain circ. ln + 151- permut. 205 + 7ln + foldon 0853 G013 ZM233.6_119-1364-ln + ZM233 V1V2V3 trimerization- Same as Seq_0797 296-3314-ln4-151- domain circ. 205 + 7ln + foldon permut. 0854 Z Linker 0855 Z 1VH8 Scaffold 1VH8 0856 H043 *286.36-chim_ 286.36/BG505 SOSIP, R6, 664, Res. 31-45, 478-507, Same as Seq_0379 d7324.201C-433C chimera 201C/433C 512-664 from BG505 (“BG505 Platform”), remainder = 286.36 0857 H044 288.38-chim_ 288.38/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 288.38 0858 H045 3988.25-chim_ 3988.25/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3988.25 0859 H046 5768.04-chim_ 5768.04/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder from 5768.04 0860 H047 6101.1-chim_ 5101.1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6101.1 0861 H048 6535.3-chim_ 5535.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6535.3 0862 H049 7165.18-chim_ 7165.18/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 7165.18 0863 H050 0013095-2.11-chim_ D013095-2.11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 0013095- 2.11 0864 H051 001428-2.42-chim_ D01428-2.42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera remainder = 001428- 201C/433C 2.42 0865 H052 0077_Vl.C16-chim_ D077_Vl.C16/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = D077_V1.C16 0866 H053 00836-2.5-chim_ 00836-2.5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 00836-2.5 0867 H054 0260.v5.c36-chim_ D260.v5.c36/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = D260.v5.c36 0868 H0SS 0330.v4.c3-chim_ 0330.v4.c3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 0330.v4.c3 0869 H056 0439.v5.c1-chim_ 3439.v5.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 0439.v5.c1 0870 H057 0815.V3.C3-chim_ 3815.V3.C3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 0815.V3.C3 0871 H058 *0921.V2.C14-chim_ D921.V2.C14/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 0921.V2.C14 0872 H059 *16055-2.3-chim_ 16055-2.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 16055-2.3 0873 H060 16845-2.22-chim_ 16845-2.22/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 16845-2.22 0874 H061 16936-2.21-chim_ 16936-2.21/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 16936-2.21 0875 H062 231965.c1-chim_ 231965.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 231965x1 0876 H063 235-47-chim_ 235-47/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 235-47 0877 H064 242-14-chim_ 242-14/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 242-14 0878 H065 247-23-chim_ 247-23/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 247-23 0879 H066 25710-2.43-chim_ 25710-2.43/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 25710-2.43 0880 H067 25711-2.4-chim_ 25711-2.4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 25711-2.4 0881 H068 *25925-2.22-chim_ 25925-2.22/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 25925-2.22 0882 H069 26191-2.48-chim_ 26191-2.48/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 26191-2.48 0883 H070 263-8-chim_ 263-8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 263-8 0884 H071 269-12-chim_ 269-12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 269-12 0885 H072 271-11-chim_ 271-11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 271-11 0886 H073 3016.v5.c45-chim_ 3016.v5.c45/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3016.v5.c45 0887 H074 3168.V4.C10-chim_ 3168.V4.C10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3168.V4.C10 0888 H075 *3301.V1.C24-chim_ 3301.V1.C24/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3301.V1.C24 0889 H076 3326.V4.C3-chim_ 3326.V4.C3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3326.V4.C3 0890 H077 3337.V2.C6-chim_ 3337.V2.C6/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3337.V2.C6 0891 H078 3365.v2.c20-chim_ 3365.v2.c20/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3365.v2.c20 0892 H079 3415.V1.c1-chim_ 3415.v1.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3415.v1.c1 0893 H080 3468.V1.C12-chim_ 3468.V1.C12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3468.V1.C12 0894 H081 3589.V1.C4-chim_ 3589.V1.C4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3589.V1.C4 0895 H082 3637.V5.C3-chim_ 3637.V5.C3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3637.V5.C3 0896 H083 3718.v3.c11.chim_ 3718.v3.c11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3718.v3.c1l 0897 H084 3817.v2.c59-chim_ 3817.v2.c59/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3817.v2.c59 0898 H085 3873.V1.C24-chim_ 3873.V1.C24/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3873.V1.C24 0899 H086 398-Fl_F6_20-chim_ 398-Fl_F6_20/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 398- :1 F6 20 0900 H087 57128.vrcl5-chim_ 57128.vrcl5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 57128.vrcl5 0901 H088 6095.V1.C10-chim_ 6095.V1.C10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6095.V1.C10 0902 4089 *620345.c1-chim_ 520345.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 620345x1 0903 H090 6322.V4.C1-chim_ 5322.V4.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6322.V4.C1 0904 H091 6405.v4.c34-chim_ 6405.v4.c34/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 201C/433C 6405.v4.c34 0905 H092 6471.V1.C16-chim_ 5471.V1.C16/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6471.V1.C16 0906 H093 6540.V4.c1-chim_ 5540.v4.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6540.v4.c1 0907 H094 6545.V3.C13-chim_ 6545.V3.C13/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6545.V3.C13 0908 H095 6545.V4.C1-chim_ 5545.V4.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6545.V4.C1 0909 H096 6631.V3.C10-chim_ 6631.V3.C10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6631.V3.C10 0910 H097 6644.V2.C33-chim_ 6644.V2.C33/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6644.V2.C33 0911 H098 6785.V5.C14-chim_ 6785.V5.C14/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6785.V5.C14 0912 H099 6838.V1.C35-chim_ 6838.V1.C35/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 6838.V1.C35 0913 H100 89.6.DG-chim_ 39.6.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 89.6.DG 0914 H101 928-28-chim_ 928-28/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 928-28 0915 H102 96ZM651.02-chim_ 96ZM651.02/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 96ZM651.02 0916 H103 A03349M1.vrc4a-chim_ A03349M1.vrc4a/ SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C BG505 201C/433C remainder = chimera A03349M1.vrc4a 0917 H104 *AC10.29-chim_ AC10.29/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = AC10.29 0918 H105 ADA.DG-chim_ ADA.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ADA.DG 0919 H106 Bal.01-chim_ Bal.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Bal.01 0920 H107 BaL.26-chim_ BaL.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BaL26 0921 H108 BB201.B42-chim_ BB201.B42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BB201.B42 0922 H109 BB539.2B13-chim_ BB539.2B13/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = 3B539.2B13 0923 H110 BG1168.01-chim_ BG1168.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BG1168.01 0924 H111 *BI369.9A-chim_ BI369.9A/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BI369.9A 0925 H112 BL01.DG-chim_ BL01.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BL01.DG 0926 H113 BR025.9-chim_ BR025.9/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BR025.9 0927 H114 BR07.DG-chim_ BR07.DG/BG5O5 chimera SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C 201C/433C remainder = BR07.DG 0928 H115 BS208.Bl-chim_ BS208.B1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BS208.B1 0929 H116 BX08.16-chim_ BX08.16/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = BX08.16 0930 H117 *C1080.c3-chim_ C1080.c3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = C1080.c3 0931 H118 C2101.c1-chim_ C2101.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = C2101.C1 0932 H119 C3347.c11.chim_ C3347.C11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_.0379 d7324.201C-433C chimera 201C/433C remainder = C3347.c1l 0933 H120 *C4118.09-chim_ C4118.09/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = C4118.09 0934 H121 CAAN.A2-chim_ CAAN.A2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CAAN.A2 0935 H122 CAP210.E8-chim_ CAP210.E8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CAP210.E8 0936 H123 CAP244.D3-chim_ CAP244.D3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CAP244.D3 0937 H124 *CAP45.G3-chim_ CAP45.G3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CAP45.G3 0938 H125 *CH038.12-chim_ CH038.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CH038.12 0939 H126 CH070.1-chim_ CH070.1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CH070.1 0940 H127 *CH117.4-chim_ CH117.4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CH117.4 0941 H128 CH181.12-chim_ CH181.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CH181.12 0942 H129 CNElO-chim_ CNE10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE10 0943 H130 CNE12-chim_ CNE12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE12 0944 H131 CNE14-chim_ CNE14/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE14 0945 H132 CNE15-chim_ CNE15/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE15 0946 H133 CNE3-chim_ CNE3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE3 0947 H134 CNE30-chim_ CNE30/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE30 0948 H135 CNE31-chim_ CNE31/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE31 0949 H136 CNE4-chim_ CNE4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE4 0950 H137 CNE40-chim_ CNE40/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE40 0951 H138 CNE5-chim_ CNE5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE5 0952 H139 CNE53-chim_ CNE53/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE53 0953 H140 *CNE55-chim_ CNE55/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE55 0954 H141 CNE56-chim_ CNE56/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE56 0955 H142 CNE57-chim_ CNE57/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE57 0956 H143 CNE58-chim_ CNE58/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE58 0957 H144 CNE59-chim_ CNE59/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE59 0958 H145 CNE7-chim_ CNE7/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = CNE7 0959 H146 DJ263.8-chim_ J263.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DJ263.8 0960 H147 DU123.06-chim_ U123.06/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DU123.06 0961 H148 DU151.02-chim_ U151.02/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DU151.02 0962 H149 *DU156.12-chim_ U156.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DU156.12 0963 H150 DU172.17-chim_ U172.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DU172.17 0964 H151 *DU422.01-chim_ U422.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = DU422.01 0965 H152 HO86.8-chim_ HO86.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = HO86.8 0966 H153 HT593.1-chim_ HT593.1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = HT593.1 0967 H154 JRCSF.JB-chim_ JRCSF.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = JRCSF.JB 0968 H155 JRFL.JB-chim_ JRFL.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = JRFL.JB 0969 H156 KER2008.12-chim_ KER2008.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = KER2008.12 0970 H157 KER2018.11-chim_ KER2018.11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = KER2018.11 0971 H158 KNH1209.18-chim_ KNH1209.18/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = KNH1209.18 0972 H159 M02138-chim_ M02138/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MO2138 0973 H160 *MB201.A1-chim_ MB201.A1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MB201.A1 0974 H161 MB539.2B7-chim_ MB539.287/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MB539.2B7 0975 H162 MI369.A5-chim_ M1369.A5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MI369.A5 0976 H163 MN.3-chim_ MN.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MN.3 0977 H164 MS208.A1-chim_ MS208.A1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MS208.A1 0978 H165 *MW965.26-chim_ MW965.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = MW965.26 0979 H166 NKU3006.ec1-chim_ VKU3006.ec1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C 201C/433C remainder = chimera VKU3006.ec1 0980 H167 PVO.04-chim_ VO.04/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = PVO.04 0981 H168 Q168.a2-chim_ Q168.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q168.a2 0982 H169 Q23.17-chim_ Q23.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q23.17 0983 H170 Q259.17-chim_ Q259.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q259.17 0984 H171 Q461.e2-chim_ 0461.e2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q461.e2 0985 H172 Q769.d22-chim_ Q769.d22/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q769.d22 0986 H173 Q769.h5-chim_ Q769.h5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q769.h5 0987 H174 Q842.dl2-chim_ Q842.d12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = Q842.dl2 0988 H175 QH0515.01-chim_ QH0515.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = QH0515.01 0989 H176 QH0692.42-chim_ QH0692.42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = QH0692.42 0990 H177 *QH209.14M.A2-chim_ QH209.14M.A2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C 201C/433C remainder = chimera QH209.14M.A2 0991 H178 R1166.c1-chim_ R1166.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = R1166.C1 0992 H179 R2184.c4-chim_ R2184.c4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = R2184.c4 0993 H180 R3265.c6-chim_ R3265.c6/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = R3265.c6 0994 H181 REJO.67-chim_ REJO.67/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = REJO.67 0995 H182 RHPA.7-chim_ HPA.7/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = RHPA.7 0996 H183 RW020.2-chim_ RW020.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = RW020.2 0997 H184 SC422.8-chim_ SC422.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = SC422.8 0998 H185 SF162.LS-chim_ SF162.LS/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = SF162.LS 0999 H186 SO18.18-chim_ SO18.18/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = SO18.18 1000 H187 SS1196.01-chim_ SS1196.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = SS1196.01 1001 H188 T250-4-chim_ T250-4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T250-4 1002 H189 T251-18-chim_ T251-18/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T251-18 1003 H190 T253-ll-chim_ T253-ll/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T253-11 1004 H191 T255-34-chim_ T255-34/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T255-34 1005 H192 T257-31-chim_ T257-31/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T257-31 1006 H193 T266-60-chim_ T266-60/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T266-60 1007 H194 T278-50-chim_ T278-50/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T278-50 1008 H195 T280-5-chim_ T280-5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T280-5 1009 H196 T33-7-chim_ T33-7/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = T33-7 1010 H197 *TH966.8-chim_ TH966.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TH966.8 1011 H198 TH976.17-chim_ TH976.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TH976.17 1012 H199 THRO.18-chim_ THRO.18/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = THRO.18 1013 H200 TRJO.58-chim_ TRJO.58/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TRJO.58 1014 H201 TRO-11-chim_ TRO.11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TRO.11 1015 H202 TV1.29-chim_ TV1.29/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TV1.29 1016 H203 TZA125.17-chim_ FZA125.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TZA125.17 1017 H204 TZBD.02-chim_ FZBD.02/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = TZBD.02 1018 H205 UG021.16-chim_ UG021.16/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = UG021.16 1019 H206 UG024.2-chim_ UG024.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = UG024.2 1020 H207 UG037.8-chim_ UG037.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = UG037.8 1021 H208 WITO.33-chim_ WITO.33/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = WITO.33 1022 H209 X2088.c9-chim_ X2088.c9/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = X2088.c9 1023 H210 YU2.DG-chim_ YU2.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = YU2.DG 1024 H211 ZA012.29-chim_ ZA012.29/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZA012.29 1025 H212 *ZM106.9-chim_ ZM106.9/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM106.9 1026 H213 ZM109.4-chim_ ZM109.4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM109.4 1027 H214 ZM135.10a-chim_ ZM135.10a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM135.10a 1028 H215 ZM176.66-chim_ ZM176.66/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM176.66 1029 H216 ZM197.7-chim_ ZM197.7/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM197.7 1030 H217 ZM214.15-chim_ ZM214.15/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM214.15 1031 H218 ZM215.8-chim_ ZM215.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM215.8 1032 H219 ZM233.6-chim_ ZM233.6/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM233.6 1033 H220 ZM249.1-chim_ ZM249.1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM249.1 1034 H221 *ZM53.12-chim_ ZM53.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM53.12 1035 H222 *ZM55.28a-chim_ ZM55.28a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_0379 d7324.201C-433C chimera 201C/433C remainder = ZM55.28a 1036 H223 6101.1-chim + int_ 6101.1 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-6101.1 1037 H224 Bal.01-chim + int_ Bal.01 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-Bal.01 1038 H225 BG1168.01-chim + int_ BG1168.01 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder- BG1168.01 1039 H226 CAAN.A2-chim + int_ CAAN.A2 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-CAAN.A2 1040 H227 DU156.12-chim + int_ U156.12 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-DU156.12 1041 H228 DU422.01-chim + int_ DU422.01 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-DU422.01 1042 H229 JRCSF.JB-chim + int_ JRCSF.JB + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; SOSIP, R6, 664, remainder-JRCSF.JB 1043 H230 JRFL.JB-chim + int_ JRFL.JB + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-JRFL.JB 1044 H231 KER2018.11-chim + int_ KER2018.11 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder- KER2018.11 1045 H232 PVO.04-chim + int_ PVO.04 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-PVO.04 1046 H233 Q168.a2-chim + int_ Q168.a2 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-Q168. a2 1047 H234 Q23.17-chim + int_ Q23.17 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-Q23.17 1048 H235 Q769.h5-chim + int_ Q769.h5 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-Q769.h5 1049 H236 RW020.2-chim + int_ RW020.2 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-RW020.2 1050 H237 THRO.18-chim + int_ THRO.18 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-THRO.18 1051 H238 TRJO.58-chim + int_ TRJO.58 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-TRJ0.58 1052 H239 TRO.11-chim + int_ TRO.11 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-TRO.11 1053 H240 YU2.DG-chim + int_ YU2.DG + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-YU2.DG 1054 H241 ZA012.29-chim + int_ ZAO12.29 + int/BG5O5 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-ZA012.29 1055 H242 ZM106.9-chim + int_ ZM106.9 + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder-ZM106.9 1056 H243 ZM55.28a-chim + int_ ZM55.28a + int/BG505 SOSIP, R6, 664, BG505: Res. 31-45, Same as Seq_0579 d7324.201C-433C chimera 201C/433C 478-507, 512-664 and Int. Res. set A; remainder- ZM55.28a 1057 A326 *6101.1.sosip_ 6101.1 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1058 A327 *Bal.01.sosip_ Bal.01 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1059 A328 *BG1168.01.sosip_ BG1168.01 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1060 A329 *CAAN.A2.sosip_ CAAN.A2 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1061 A330 *DU156.12.sosip_ U156.12 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1062 A331 *DU422.01.sosip_ U422.01 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1063 A332 JRCSF.JB.sosip_ JRCSF.JB SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1064 A333 *JRFL.JB.sosip_ JRFL.JB SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1065 A334 *KER2018.11.sosip_ KER2018.11 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1066 A335 *PVO.04.sosip_ PVO.04 SOSIP, R6, 664, 201C, 433C5 d7324.201C-433C 1067 A336 *Q168.a2.sosip_ Q168.a2 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1068 A337 *Q23.17.sosip_ Q23.17 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1069 A338 *Q769.h5.sosip_ Q769.h5 SOSIP, R6, 664, 201C, 433C5 d7324.201C-433C 1070 A339 *RW020.2.sosip_ 3W020.2 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1071 A340 *THRO.18.sosip_ THRO.18 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1072 A341 *TRJO.58.sosip_ TRJO.58 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1073 A342 *TRO.11.sosip_ TRO-11 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1074 A343 *YU2.DG.sosip_ YU2.DG SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1075 A344 *ZA012.29.sosip_ ZA012.29 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1076 A345 *ZM106.9.sosip_ ZM106.9 SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1077 A346 *ZM55.28a.sosip_ ZM55.28a SOSIP, R6, 664, 201C, 433C d7324.201C-433C 1078 H244 6101.1-chim-sc_ 5101.1/BG505 SOSIP, R6, 664, Seq_0534 linker Chimeric single d7324.201C-433C chimera 201C/433C between 508-511, chain Env with BG505 BG505 Platform, gp41ecto/gp120- remainder = ZM55.28a NC “platform” and heterologous gp120 1079 H245 Bal.01-chim-sc_ Bal.01/BG505 SOSIP, R6, 664, Seq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = Bal.01 1080 H246 BG1168.01-chim-sc_ BG1168.01/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = BG1168.01 1081 H247 CAAN.A2-chim-sc_ CAAN.A2/BG505 SOSIP, R6, 664, Seq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, Res. 31-45, 478-507, 512-664 from BG505, remainder = CAAN.A2 1082 H248 DU156.12-chim-sc_ DU156.12/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = DU156.12 1083 H249 DU422.01-chim-sc_ DU422.01/BG505 SOSIP, R6, 664, Seq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = DU422.01 1084 H250 JRCSF.JB-chim-sc_ JRCSF.JB/BG505 SOSIP, R6, 664, Seq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = JRCSF.JB 1085 H251 JRFL.JB-chim-sc_ JRFL.JB/BG505 SOSIP, R6, 664, 5eq_0534 linker between Same as Seq_1078 d7324.201C-433C chimera 201C/433C 508-511, Res. 31-45, 478-507, 512-664 from BG505, remainder = JRFL.JB 1086 H252 KER2018.11-chim-sc_ KER2018.11/BG505 SOSIP, R6, 664, Seq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = KER2018.11 1087 H253 PVO.04-chim-sc_ VO.04/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = PVO.04 1088 H254 Q168.a2-chim-sc_ Q168.a2/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = Q168.a2 1089 H255 Q23.17-chim-sc_ Q23.17/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = Q23.17 1090 H256 Q769.h5-chim-sc_ Q769.h5/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = Q769.h5 1091 H257 RW020.2-chim-sc_ 3W020.2/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = RW020.2 1092 H258 THRO.18-chim-sc_ THRO.18/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = THRO.18 1093 H259 TRJO.58-chim-sc_ TRJO.58/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = TRJO.58 1094 H260 TRO.11-chim-sc_ TRO.11/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = TRO.11 1095 H261 YU2.DG-chim-sc_ YU2.DG/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = YU2.DG 1096 H262 ZA012.29-chim-sc_ ZA012.29/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = ZA012.29 1097 H263 ZM106.9-chim-sc_ ZM106.9/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = ZM106.9 1098 H264 ZM55.28a-chim-sc_ ZM55.28a/BG505 SOSIP, R6, 664, 5eq_0534 linker Same as Seq_1078 d7324.201C-433C chimera 201C/433C between 508-511, BG505 Platform, remainder = ZM55.28a 1099 H265 ZM53_bg505- ZM53/BG505 SOSIP, R6, 664, BG505 Platform, Ferritin particle NCgp120 + gp41. chimera 201C/433C; remainder = ZM53, with Chimeric gp140 SOSIP_ 332N ferritin linked with BG505 ds201- to gp41-C gp41ecto/gp120-NC 433_3bve-5ln “platform” and heterologous gp120 1100 H266 CNE55-glyc332_bg505- CNE55/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 chimera 201C/433C remainder = CNE55, NCgp120 + gp41. ferritin linked to SOSIP_ gp41-C ds201-433_ferr-5ln 1101 H267 P0402_Cll_bg505- 30402_C11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = SOSIP_ P0402 C11, ds201- ferritin linked 433_ferr-5ln to gp41-C 1102 H268 X1193_C1_bg505- X1193_C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = X1193_C1, SOSIP_ ferritin linked to ds201- gp41-C 433_ferr-5ln 1103 H269 DU156.12_bg505- DU156.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = DU156.12, SOSIP_ ferritin linked to ds201- gp41-C 433_ferr-5ln 1104 H270 DU422.01_bg505- DU422.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = DU422.01, SOSIP_ ferritin linked to ds201- gp41-C 433_ferr-5ln 1105 H271 25925-2.22_bg505- 25925-2.22/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = 25925- SOSIP_ 2.22, ferritin ds201- 433_3bve-5ln linked to gp41-C 1106 H272 3301_V1_C24_bg505- 3301_V1_C24/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = SOSIP_ 33O1_V1_C24, ferritin ds201- linked to gp41-C 433_3bve-5ln 1107 H273 Cap256-SU_bg505- Cap256-SU/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = Cap256-SU, SOSIP_ ferritin linked to ds201- gp41-C 433_3bve-5ln 1108 H274 CH117.4_332N_ CH117.4_332N/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 bg505- chimera 201C/433C remainder = NCgp120 + gp41. CH117.4_332N, ferritin SOSIP_ linked to gp41-C ds201-433_3bve-5ln 1109 H275 CNE58_SU-strandC_ CNE58_SU-strand C/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 bg505- chimera 201C/433C Res. 166-173 (strand C) NCgp120 + gp41. From CAP256-SU, SOSIP_ remainder = CNE58, ds201-433_3bve-5ln Ferritin linked to gp41-C 1110 H276 KER2018.11_bg505- KER2018.11/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = SOSIP_ KER2018.11, ferritin ds201- linked to gp41-C 433_3bve-5ln 1111 H277 ZM233.6_bg505- ZM233.6/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + int + gp41.SOSIP_ chimera 201C/433C remainder = ZM233.6, ds201- ferritin linked to 433_3bve-5ln gp41-C 1112 H278 ZM53_bg505- ZM53/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = ZM53, SOSIP_ ferritin linked to ds201- gp41-C 433_3bve-5ln 1113 H279 45_01dG5_bg505- dG5 from d45/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 NCgp120 + gp41. chimera 201C/433C remainder = dG5, SOSIP_ ferritin linked to ds201- gp41-C 433_3bve_5ln 1114 H280 231965.c1-chim_ 231965.C1/BG505 SOSIP, R6, 664, BG505 Platform, Chimeric gp140 with d7324.201C-433C.mi-cl-min chimera 201C/433C Res. Set B (Res. 133; gp41ecto/gp120-NC 134; “platform” and 164; BG505 Res. Set B, 169; and heterologous 308; gpl20 316) from BG505 (“BG505 Res. Set B”), remainder = 231965x1 1115 H281 288.38-chim_ 288.38/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 288.38 1116 H282 3415.v1.c1-chim_ 3415.v1.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 3415.v1.c1 1117 H283 3817.v2.c59-chim_ 3817.v2.c59/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 3817.v2.c59 1118 H284 57128.vrcl5-chim_ 57128.vrcl5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 57128.vrcl5 1119 H285 6535.3-chim_ 5535.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 6535.3 1120 H286 89.6.DG-chim_ 89.6.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 89.6.DG 1121 H287 A03349M1.vrc4a-chim_ A03349M1.vrc4a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min 201C/433C BG505 Res. Set B, chimera remainder = A03349M1. vrc4a 1122 H288 Bal.01-chim_ Bal.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = Bal.01 1123 H289 BaL.26-chim_ BaL.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = BaL.26 1124 H290 BG1168.01-chim_ BG1168.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = BG1168.01 1125 H291 BR07.DG-chim_ BR07.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = BR07.DG 1126 H292 CNE10-chim_ CNE10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = CNE10 1127 H293 CNE30-chim_ CNE30/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = CNE30 1128 H294 CNE4-chim_ CNE4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, emainder = CNE4 1129 H295 JRCSF.JB-chim_ JRCSF.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = JRCSF.JB 1130 H296 JRFLJJB-chim_ JRFL.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = JRFL.JB 1131 H297 MB539.2B7-chim_ MB539.2B7/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = MB539.2B7 1132 H298 MN.3-chim_ MN.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = MN.3 1133 H299 NKU3006.ec1-chim_ \KU3006.ec1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min 201C/433C BG505 Res. Set B, chimera remainder = NKU3006.ec1 1134 H300 PVO.04-chim_ VO.04/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = PVO.04 1135 H301 Q259.17-chim_ Q259.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = 0, 259.17 1136 H302 QH0692.42-chim_ QH0692.42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = QH0692.42 1137 H303 SF162.LS-chim_ 5F162.LS/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = SF162.LS 1138 H304 SS1196.01-chim_ SS1196.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = SS1196.01 1139 H305 F266-60-chim_ F266-60/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = T266-60 1140 H306 F280-5-chim_ F280-5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = T280-5 1141 H307 UG024.2-chim_ UG024.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = UG024.2 1142 H308 ZM215.8-chim_ ZM215.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1114 d7324.201C-433C.mi-cl-min chimera 201C/433C BG505 Res. Set B, remainder = ZM215.8 1143 H309 231965.c1-chim_ 231965.C1/BG505 SOSIP, R6, 664, BG505 Platform, Chimeric gp140 with d7324.201C-433C.mi-cl1 chimera 201C/433C Res. Set C gp41ecto/ (Res. 49; 133; gp120-NC “platform” and 134; 149; 150; Res. Set C from BG505, and 151; 152; 164; heterologous gp120 169; 188; 190; 211; 223; 252; 281; 293; 308; 316; 336; 340; 352; 360; 362; 363; 369; 372; 393; 410; 432; 442; 444; 446; 474; 476) from BG505 (“BG505 Res. Set C”), remainder = ZM215.8 1144 H310 288.38-chim_ 288.38/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C Res. Set C from BG505, remainder = 288.38 1145 H311 3415.v1.c1-chim_ 3415.v1.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = 3415.v1.c1 1146 H312 3817.v2.c59-chim_ 3817.v2.c59/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, emainder = 3817.v2.c59 1147 H313 57128.vrcl5-chim_ 57128.vrcl5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = 57128.vrcl5 1148 H314 6535.3-chim_ 6535.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = 6535.3 1149 H315 89.6.DG-chim_ 89.6.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = 89.6.DG 1150 H316 A03349M1.vrc4a-chim_ A03349M1.vrc4a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 201C/433C BG505 Res. Set C, chimera remainder = A03349M1.vrc4a 1151 H317 Bal.01-chim_ Bal.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = Bal.01 1152 H318 BaL.26-chim_ BaL.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = BaL.26 1153 H319 BG1168.01-chim_ BG1168.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = BG1168.01 1154 H320 BR07.DG-chim_ BR07.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = BR07.DG 1155 H321 CNE10-chim_ CNE10/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = CNE10 1156 H322 CNE30-chim_ CNE30/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = CNE30 1157 H323 CNE4-chim_ CNE4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = CNE4 1158 H324 JRCSF.JB-chim_ JRCSF.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = JRCSF.JB 1159 H325 JRFL.JB-chim_ JRFL.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = JRFL.JB 1160 H326 MB539.2B7-chim_ MB539.287/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = MB539.2B7 1161 H327 MN.3-chim_ MN.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = MN.3 1162 H328 NKU3006.ec1-chim_ VKU3006.ec1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 201C/433C BG505 Res. Set C, chimera remainder = NKU3006.ec1 1163 H329 PVO.04-chim_ PVO.04/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = PVO.04 1164 H330 Q259.17-chim_ 3259, 17/86505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = Q259.17 1165 H331 QH0692.42-chim_ QH0692.42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = QH0692.42 1166 H332 SF162.LS-chim_ 5F162.LS/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, emainder = SF162.LS 1167 H333 SS1196.01-chim_ SS1196.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = SS1196.01 1168 H334 T266-60-chim_ T266-60/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = T266-60 1169 H335 T280-5-chim_ T280-5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = T280-5 1170 H336 UG024.2-chim_ UG024.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = UG024.2 1171 H337 ZM215.8-chim_ ZM215.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1143 d7324.201C-433C.mi-cl1 chimera 201C/433C BG505 Res. Set C, remainder = ZM215.8 1172 H338 231965.c1-chim_ 231965.C1/BG505 SOSIP, R6, 664, BG505 Platform, Chimeric gp140 with d7324.201C-433C.mi-cl1-2 chimera 201C/433C Res. Set C, + Res. Set D gp41ecto/gp120-NC (46; 60; 62; 63; 84; “platform” and 85; 87; 99; 102; 130; Res. Sets C and D 132; 135; 153; 158; from BG505, and 160; 161; 165; 166; heterologous gp120 167; 171; 172; 173; 175; 177; 178; 181; 184; 185; 189; 202; 232; 234; 236; 240; 268; 269; 270; 271; 275; 277; 287; 289; 292; 295; 297; 305; 315; 317; 319; 322; 328; 330; 332; 333; 334; 335; 337; 339; 343; 344; 345; 346; 347; 350; 351; 357; 371; 375; 379; 387; 389; 394; 411; 412; 413; 415; 424; 426; 429; 440; 460; 461; 465; 475; 477) from BG505 (+37 BG505 Res. Set D+38 ), remainder = 231965x1 1173 H339 288.38-chim_ 288.38/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 288.38 1174 H340 3415.v1.c1-chim_ 3415.v1.c1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 3415.v1.c1 1175 H341 3817.v2.c59-chim_ 3817.v2.c59/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 3817.v2.c59 1176 H342 57128.vrcl5-chim_ 57128.vrcl5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 57128.vrcl5 1177 H343 6535.3-chim_ 5535.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 6535.3 1178 H344 89.6.DG-chim_ 89.6.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = 89.6.DG 1179 H345 A03349M1.vrc4a-chim_ A03349M1.vrc4a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 201C/433C BG505 Res. Sets C + D, chimera remainder = A03349M1.vrc4a 1180 H346 Bal.01-chim_ Bal.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = Bal.01 1181 H347 BaL.26-chim_ BaL.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, emainder = BaL.26 1182 H348 BG1168.01-chim_ BG1168.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = BG1168.01 1183 H349 BR07.DG-chim_ BR07.DG/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = BR07.DG 1184 H350 CNE10-chim_ CNE10/BG505 SOSIP, R6, 664, BG505 Platform BG505 Res. Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C Sets C + D, remainder = CNE10 1185 H351 CNE30-chim_ CNE30/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = CNE30 1186 H352 CNE4-chim_ CNE4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = CNE4 1187 H353 JRCSF.JB-chim_ JRCSF.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = JRCSF.JB 1188 H354 JRFL.JB-chim_ JRFL.JB/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = JRFL.JB 1189 H355 MB539.2B7-chim_ MB539.287/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = MB539.2B7 1190 H356 MN.3-chim_ MN.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = MN.3 1191 H357 NKU3006.ec1-chim_ NKU3006.ec1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = NKU3006.ec1 1192 H358 PVO.04-chim_ VO.04/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = PVO.04 1193 H359 Q259.17-chim_ Q259.17/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = Q259.17 1194 H360 QH0692.42-chim_ QH0692.42/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = QH0692.42 1195 H361 SF162.LS-chim_ SF162.LS/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = SF162.LS 1196 H362 SS1196.01-chim_ SS1196.01/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = SS1196.01 1197 H363 T266-60-chim_ F266-60/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = T266-60 1198 H364 T280-5-chim_ T280-5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = T280-5 1199 H365 UG024.2-chim_ UG024.2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = UG024.2 1200 H366 ZM215.8-chim_ ZM215.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1172 d7324.201C-433C.mi-cl1-2 chimera 201C/433C BG505 Res. Sets C + D, remainder = ZM215.8 1201 H367 0921.V2.C14-chim_ D921.V2.C14/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = 0921.V2.C14, ferritin linked to gp41-C 1202 H368 16055-2.3-chim_ 16055-2.3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = 16055-2.3, ferritin linked to gp41-C 1203 H369 286.36-chim_ 286.36/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = 286.36, ferritin linked to gp41-C 1204 H370 620345.c1-chim_ 620345.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = 620345.c1, ferritin linked to gp41-C 1205 H371 6545.V4.C1-chim_ 6545.V4.C1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder s6545.V4.Cl, ferritin linked to gp41-C 1206 H372 AC10.29-chim_ AC10.29/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = AC10.29, ferritin linked to gp41-C 1207 H373 BI369.9A-chim_ BI369.9A/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = 31369.9A, ferritin linked to gp41-C 1208 H374 C1080.c3-chim_ C1080.c3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = C1080.c3, ferritin linked togp41-C 1209 H375 C4118.09-chim_ C4118.09/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = C4118.09, ferritin linked to gp41-C 1210 H376 CAP45.G3-chim_ CAP45.G3/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder =CAP45.G3, ferritin linked to gp41-C 1211 H377 CH038.12-chim_ CH038.12/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = CH038.12, ferritin linked to gp41-C 1212 H378 CH117.4-chim_ CH117.4/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = CH117.4, ferritin linked to gp41-C 1213 H379 MB201.A1-chim_ MB201.A1/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = MB201.A1, ferritin linked togp41-C 1214 H380 MW965.26-chim_ MW965.26/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = MW965.26, ferritin linked to gp41-C 1215 H381 QH209.14M.A2-chim_ QH209.14M.A2/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr 201C/433C gp140 remainder = Q.H209.14M.A2, ferritin chimera linked to gp41-C 1216 H382 TH966.8-chim_ TH966.8/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = TH966.8, ferritin linked to gp41-C 1217 H383 ZM106.9-chim_ ZM106.9/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = ZM106.9, ferritin linked to gp41-C 1218 H384 ZM55.28a-chim_ ZM55.28a/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1099 201C-433C_5ln-ferr chimera 201C/433C gp140 remainder = ZM55.28a, ferritin linked to gp41-C 1219 0 BI369.9A BI369.9A 1220 0 MB201.A1 MB201.A1 1221 0 QH209.14M.A2 QH209.14M.A2 1222 0 0921.V2.C14 1921.V2.C14 1223 0 16055-2.3 16055-2.3 1224 0 25925-2.22 25925-2.22 1225 0 286.36 286.36 1226 0 CAP45.G3 CAP45.G3 1227 0 CNE58 CNE58 1228 0 DU156.12 DU156.12 1229 0 DU422.01 DU422.01 1230 0 MW965.26 MW965.26 1231 0 ZM53.12 ZM53.12 1232 0 ZM55.28a ZM55.28a 1233 0 ZM106.9 ZM106.9 1234 0 3301.V1.C24 3301.V1.C24 1235 0 6545.V4.C1 5545.V4.C1 1236 0 620345.c1 520345.c1 1237 0 C1080.C3 C1080.C3 1238 0 C4118.09 C4118.09 1239 0 CNE55 CNE55 1240 0 TH966.8 rH966.8 1241 0 4C10.29 4C10.29 1242 0 CH038.12 CH038.12 1243 3 CH117.4 CH117.4 1244 A347 *CH505, BG505 CH505/BG505 SOSIP, R6, 664, I201C/A433C chimera, chimera T332N SOSIP.R6.664 I201C/A433C AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVLKNVTENFNMWK NDMVDQMHEDVISLWDQSLKPCVKLTPLCVTLNCTNATASNSSII EGMKNCSFNITTELRDKREKKNALFYKLDIVQDGNSSQYRLINCNTSVCTQACPKVSFDPIPIHYCA PAGYAILKCNNKTFTGTGPCNNVSTVQCTHGIKPVVSTQLLLNGS LAEGEIIIRSENITNNVKTIIVHLNESVKIECTRPNNKTRTSIRIGPGQAFYATGQVIGDIREAYCN INESKWNETLQRVSKKLKEYFPHKNITFQPSSGGDLEITTHSFNC GGEFFYCNTSSLFNRTYMANSTDMANSTETNSTRTITIHCRIKQIINMWQEVGRCMYAPPIAGNITC ISNITGLLLTRDGGKNNTETFRPGGGNMKDNWRSELYKYKVVK IEPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTV0ARNLLSGIVQQQSNL LRAPEAQQHLLKLTVWGIKQL0ARVLAVERYLRDQQLLGIWGCS GKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1245 A348 BG505.SOSIP. BG505 SOSIP, R6, 664, V134F/L175M/1322M/1326M Cavity Filling/ R6.664. T332N, Hydrophobic core T332N_ I201C/A433C I201C/A433C/V134F/L1 75M/I322M/I326M 1246 A349 BG505.SOSIP. BG505 Same as Seq_1245 V134F/1322Y/1326M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V134F/I3 22Y/I326M 1247 A350 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V1341/1175W/1322F/1326M Cavity Filling/ T332NI201C Hydrophobic core /A433C/V134I/L1 75W/I322F/I326M 1248 A351 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V134F/N136W/M150H/1326M Cavity Filling/ Hydrophobic core T332N_ I201C/A433C/V134F/N 136W/M150H/I326M 1249 A352 BG505.SOSIP. BG505 Same as Seq_1245 V134F/N136W/M150F/1326L Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V134F/N 136W/M150F/I326L 1250 A353 BG505.SOSIP. BG505 Same as Seq_1245 V1341/N136W/M150F/1326L Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V134I/N1 36W/M150F/I326L 1251 A354 BG505.SOSIP.R6. BG505 Same as Seq_1245 V134F/N136F/M150L/1326M Cavity Filling/ 664. Hydrophobic core T332N_ I201C/A433C/V134F/N 136F/M150L/I326M 1252 A355 BG505.SOSIP. BG505 Same as Seq_1245 L154M/N300M/N302M/T320L Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/L154M/N 300M/N302M/T320L 1253 A356 BG505.SOSIP. BG505 Same as Seq_1245 L154F/N300L/N302M/T320L Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/L154F/N3 00L/N302M/T320L 1254 A357 BG505.SOSIP. BG505 Same as Seq_1245 L154W/N300L/N302G/T320F Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/L154W/N 300L/N302G/T320F 1255 A358 BG505.SOSIP. BG505 Same as Seq_1245 V120F/Q203M/Y318M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V120F/Q 203M/Y318M 1256 A359 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V1201/Q203M/Y318W Cavity Filling/ T332NI201C/A433C/ Hydrophobic core V120I/Q2 03M/Y318W 1257 A360 BG505.SOSIP. BG505 Same as Seq_1245 V120W/Q203M/Y318W Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V120W/ Q203M/Y318W 1258 A361 BG505.SOSIP. BG505 Same as Seq_1245 V120F/Q315M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V120F/Q 315M 1259 A362 BG505.SOSIP. BG505 Same as Seq_1245 V120W/Q315F Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/V120W/ Q315F 1260 A363 BG505.SOSIP. BG505 Same as Seq_1245 Y177W/1420M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/Y177W/ I420M 1261 A364 BG505.SOSIP. BG505 Same as Seq_1245 Y177W/Q328F/I420M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/Y177W/ Q328F/I420M 1262 A365 BG505.SOSIP. BG505 Same as Seq_1245 L116M/M426F/Q432M Cavity Filling/ R6.664. Hydrophobic core T332N_ I201C/A433C/L116M/ M426F/Q432M 1263 A366 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L116M/M426F/Q432W Cavity Filling/ T332NI201C/ Hydrophobic core A433C/L116M/ M426F/Q432W 1264 A367 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 VI426F/Q432L Cavity Filling/ T332N_ Hydrophobic core I201C/A433C/M426F/Q 432L 1265 A368 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V134F/L175M/1322M/ Cavity Filling/ T332N_ 1326M/N136W/M Hydrophobic core I201C/A433C/V134F/ 150H L175M/I322M/ I326M/N136W/M150H 1266 A369 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V1341/1175W/1322F/ Cavity Filling/ T332N_ 1326L/N136W/M15 Hydrophobic core I201C/A433C/V134I/ 0F L175W/I322F/ I326L/N136W/M150F 1267 A370 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V120F/Q203M/Y318M/Q315M Cavity Filling/ T332N_ Hydrophobic core I201C/A433C/V120F/ Q203M/ Y318M/Q315M 1268 A371 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V120W/Q203M/Y318W/Q315F Cavity Filling/ T332N_ Hydrophobic core I201C/A433C/V120W/ Q203M/Y318W/Q315F 1269 A372 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L154M/N300M/N302M/ Cavity Filling/ T332N_ T320L/Y177W/I4 Hydrophobic core I201C/A433C/L154M/N 20M 300M/N302M/T320L/ Y177W/I420M 1270 A373 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L154W/N300L/N302G/ Cavity Filling/ T332N_ T320F/Y177W/Q3 Hydrophobic core I201C/A433C/L154W/N 28F/I420M 300L/N302G/T320F/ Y177W/Q328F/I420M 1271 A374 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 E153F Cavity Filling T332N_ I201C/A433C/E153F 1272 A375 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 E153W Cavity Filling T332N_ I201C/A433C/E153W 1273 A376 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L154F Cavity Filling T332N_ I201C/A433C/L154F 1274 A377 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L154W Cavity Filling T332N_ I201C/A433C/L154W 1275 A378 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 E164F Cavity Filling T332N_ I201C/A433C/E164F 1276 A379 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 E164W Cavity Filling T332N_ I201C/A433C/E164W 1277 A380 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V172F Cavity Filling T332N_ I201C/A433C/V172F 1278 A381 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V172W Cavity Filling T332N_ I201C/A433C/V172W 1279 A382 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L175F Cavity Filling T332N_ I201C/A433C/L175F 1280 A383 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 F176W Cavity Filling T332N_ I201C/A433C/F176W 1281 A384 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L179F Cavity Filling T332N_ I201C/A433C/L179F 1282 A385 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L179W Cavity Filling T332N_ I201C/A433C/L179W 1283 A386 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Y191F Cavity Filling T332N_ I201C/A433C/Y191F 1284 A387 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Y191W Cavity Filling T332N_ I201C/A433C/Y191W 1285 A388 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L193F Cavity Filling T332N_ I201C/A433C/L193F 1286 A389 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L193W Cavity Filling T332N_ I201C/A433C/L193W 1287 A390 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L194W Cavity Filling T332N_ I201C/A433C/I194W 1288 A391 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T198F Cavity Filling T332N_ I201C/A433C/T198F 1289 A392 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T198W Cavity Filling T332N_ I201C/A433C/T198W 1290 A393 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T202F Cavity Filling T332N_ I201C/A433C/T202F 1291 A394 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T202W Cavity Filling T332N_ I201C/A433C/T202W 1292 A395 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A204F Cavity Filling T332N_ I201C/A433C/A204F 1293 A396 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A204W Cavity Filling T332N_ 1201C/A433C/A204W 1294 A397 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 N302F Cavity Filling T332N_ I201C/A433C/N302F 1295 A398 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V302W Cavity Filling T332N_ I201C/A433C/N302W 1296 A399 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 R304F Cavity Filling T332N_ I201C/A433C/R304F 1297 A400 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 R304W Cavity Filling T332N_ I201C/A433C/R304W 1298 A401 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 307F Cavity Filling T332N_ I201C/A433C/I307F 1299 A402 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 307W Cavity Filling T332N_ I201C/A433C/I307W 1300 A403 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Q315F Cavity Filling T332N_ I201C/A433C/Q315F 1301 A404 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Q315W Cavity Filling T332N_ I201C/A433C/Q315W 1302 A405 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I423F Cavity Filling T332N_ I201C/A433C/I423F 1303 A406 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I430F Cavity Filling T332N_ I201C/A433C/I430F 1304 A407 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I430W Cavity Filling T332N_ I201C/A433C/I430W 1305 A408 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Q432F Cavity Filling T332N_ I201C/A433C/Q432F 1306 A409 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Q432W Cavity Filling T332N_ I201C/A433C/Q432W 1307 A410 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A436M Cavity Filling T332N_ I201C/A433C/A436M 1308 A411 BG505.SOSIP.R6.664. BG505 Same as Seq. 1245 A436F Cavity Filling T332N_ I201C/A433C/A436F 1309 A412 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A436W Cavity Filling T332N_ I201C/A433C/A436W 1310 A413 BG505.SOSIP. BG505 Same as Seq. 1245 L125W/I194W Cavity Filling R6.664. T332NI201C/ A433C/L125W/ I194W 1311 A414 BG505.SOSIP. BG505 Same as Seq. 1245 F139W/D140I/ Cavity Filling R6.664. G324I/D325W T332N_ I201C/ A433C/T139W/D 140I/G324I/D325W 1312 A415 BG505.SOSIP. BG505 Same as Seq_1245 F210A Destabilization R6.664. of CD4-induced T332N_ conformation I201C/ A433C/F210A 1313 A416 BG505.SOSIP. BG505 Same as Seq_1245 F210S Destabilization R6.664. of CD4-induced T332N_ conformation I201C/ A433C/F210S 1314 A417 BG505.SOSIP. BG505 Same as Seq_1245 Q432P Destabilization R6.664. of CD4-induced T332N_ conformation I201C/ A433C/Q432P 1315 A418 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T538C/Q652C Disulfide T332N_ I201C/A433C/T538C/Q 652C 1316 A419 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 R304C/Q440C Disulfide T332NI201C/A433C/R304C/Q 440C 1317 A420 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 F159Y Cavity Filling T332N_ I201C/A433C/F159Y 1318 A421 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I323Y Cavity Filling T332N_ I201C/A433C/I323Y 1319 A422 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 F159Y/I323Y Cavity Filling T332N_ I201C/A433C/F159Y/I3 23Y 1320 A423 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 F223W Cavity Filling T332N_ I201C/A433C/F223W 1321 A424 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V580L Cavity Filling T332N_ I201C/A433C/V580L 1322 A425 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V583L Cavity Filling T332N_ I201C/A433C/V583L 1323 A426 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V580L/V583L Cavity Filling T332NI201C/A433C/ V580L/V583L 1324 A427 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 W69P helix 0 disruption T332N_ I201C/A433C/W69P 1325 A428 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V68P helix 0 disruption T332N_ I201C/A433C/V68P 1326 A429 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T71P helix 0 disruption T332N_ I201C/A433C/T71P 1327 A430 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V75W Cavity Filling T332N_ I201C/A433C/V75W 1328 A431 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V75F Cavity Filling T332N_ I201C/A433C/V75F 1329 A432 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V75M Cavity Filling T332N_ I201C/A433C/V75M 1330 A433 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V208W Cavity Filling T332N_ I201C/A433C/V208W 1331 A434 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V208F Cavity Filling T332N_ I201C/A433C/V208F 1332 A435 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A58C/T77C Disulfide T332N_ I201C/A433C/A58C/T7 7C 1333 A436 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 D57C/T77C Disulfide T332N_ I201C/A433C/D57C/T7 7C 1334 A437 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 N67P helix 0 disruption T332N_ I201C/A433C/N67P 1335 A438 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 466P helix 0 disruption T332N_ I201C/A433C/H66P 1336 A439 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 N67P/H66P helix 0 disruption T332NI201C/A433C/ N67P/H66P 1337 A440 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 W112I Cavity Filling T332N_ I201C/A433C/W112I 1338 A441 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 W112M Cavity Filling T332N_ I201C/A433C/W112M 1339 A442 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 W427I Cavity Filling T332N_ I201C/A433C/W427I 1340 A443 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 W427M Cavity Filling T332N_ I201C/A433C/W427M 1341 A444 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 3429N Destabilization of CD4 binding site T332N_ I201C/A433C/R429N 1342 A445 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 3429L Destabilization of CD4 binding site T332N_ I201C/A433C/R429L 1343 A446 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 R429L/W427M Destabilization of CD4 binding site T332N_ I201C/A433C/R429L/W 427M 1344 A447 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 G431GC/S199C Disulfide T332N_ I201C/A433C/G431GC/ S199C 1345 A448 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V120W Cavity Filling T332N_ I201C/A433C/V120W 1346 A449 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A316W Cavity Filling T332N_ I201C/A433C/A316W 1347 A450 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I309W Cavity Filling T332N_ I201C/A433C/I309W 1348 A451 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 S115W Cavity Filling T332N_ I201C/A433C/S115W 1349 A452 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 P118W Cavity Filling T332N_ I201C/A433C/P118W 1350 A453 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A70Y Cavity Filling T332N_ I201C/A433C/A70Y 1351 A454 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 A70F Cavity Filling T332N_ I201C/A433C/A70F 1352 A455 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L111Y Cavity Filling T332N_ I201C/A433C/L111Y 1353 A456 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L111F Cavity Filling T332N_ I201C/A433C/L111F 1354 A457 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 T202P disrupt bridging sheet/ T332N_ destabilizing I201C/A433C/T202P CD4 bound state 1355 A458 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 V120T disrupt bridging sheet/ T332N_ destabilizing I201C/A433C/V120T CD4 bound state 1356 A459 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I573T destabilize gp41 helix bundle T332N_ I201C/A433C/I573T 1357 A460 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 G594N destabilize gp41 helix bundle T332N_ I201C/A433C/G594N 1358 A461 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I573T/G594N destabilize gp41 helix bundle T332NI201C/A433C/I573T/G5 94N 1359 A462 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I573T/G594N/K574E destabilize gp41 helix bundle T332N_ I201C/A433C/I573T/G5 94N/K574E 1360 A463 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 I573T/G594N/K574T destabilize gp41 helix bundle T332N_ I201C/A433C/I573T/G5 94N/K574T 1361 A464 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 K117W Cavity Filling T332N_ I201C/A433C/K117W 1362 A465 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 S110W Cavity Filling T332N_ I201C/A433C/S110W 1363 A466 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L544Y Cavity Filling T332N_ I201C/A433C/L544Y 1364 A467 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 L544Y/L537Y Cavity Filling T332N_ I201C/A433C/L544Y/ L537Y 1365 A468 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 544Y/F223W Cavity Filling T332NI201C/A433C/L544Y/ F223W 1366 A469 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 544Y/L537Y/F223W Cavity Filling T332N_ I201C/A433C/L544Y/L5 37Y/F223W 1367 A470 BG505.SOSIP.R6.664. BG505 Same as Seq_1245 Delta_P206 proline removal. T332N_ Removal of ground I201C/A433C/Delta_ state destabilization/ P206 flexibility 1368 A471 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, I194W/T198M/N425F Cavity Filling/ T332N_ T332N Hydrophobic core I194W/T198M/N425F 1369 A472 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, F198M/N425F Cavity Filling/ T332N_ T332N Hydrophobic core T198M/N425F 1370 A473 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 194W/T198Y/ Cavity Filling/ T332N_ T332N N425F Hydrophobic core I194W/T198Y/N425F 1371 A474 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, 194F/T198L Cavity Filling/ /N425W Hydrophobic core T332N_ T332N I194F/T198L/N425W 1372 A475 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V134F/L175M/ Cavity Filling/ T332N_ T332N 1322M/1326M Hydrophobic core V134F/L175M/I322M/I 326M 1373 A476 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V134F/1322Y/ Cavity Filling/ T332N_ T332N 1326M Hydrophobic core V134F/I322Y/I326M 1374 A477 BG505.SOSIP. BG505 SOSIP, V1341/1175W/ Cavity Filling/ R6.664. R6, 664, 1322F/1326M Hydrophobic core T332N_ T332N V134I/ L175W/I322F/I3 26M 1375 A478 BG505.SOSIP.R6.664. BG505 SOSIP, V134F/N136W/ Cavity Filling/ T332N_ R6, 664, M150H/1326M Hydrophobic core V134F/N136W/M150H T332N /I326M 1376 A479 BG505.SOSIP. BG505 SOSIP, R6, 664, V134F/N136W/ Cavity Filling/ R6.664. M150F/1326L Hydrophobic core T332N_ T332N V134F/ N136W/M150F/ I326L 1377 A480 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V1341/N136W/ Cavity Filling/ T332N_ T332N M150F/1326L Hydrophobic core V134I/ N136W/M150F/ I326L 1378 A481 BG505.SOSIP. BG505 SOSIP, V134F/N136F/ Cavity Filling/ R6.664. R6, 664, M150L/1326M Hydrophobic core T332N_ T332N V134F/ N136F/M150L/ T326M 1379 A482 BG505.SOSIP.R6.664. BG505 SOSIP, L154M/N300M/N302M/ Cavity Filling/ T332N_ R6, 664, T320L Hydrophobic core L154M/ T332N N300M/N302M /T320L 1380 A483 BG505.SOSIP. BG505 SOSIP, L154F/N300L/ Cavity Filling/ R6.664. R6, 664, N302M/T320L Hydrophobic core T332N_ T332N L154F/ N300L/N302M/ T320L 1381 A484 BG505.SOSIP. BG505 SOSIP, R6, L154W/N300L/ Cavity Filling/ R6.664. 664, N302G/T320F Hydrophobic core T332N_ T332N L154W/ N300L/N302G/ T320F 1382 A485 BG505.SOSIP. BG505 SOSIP, R6, 664, V120F/Q203M/Y318M Cavity Filling/ R6.664. T332N Hydrophobic core T332N_ V120F/Q203M/Y318M 1383 A486 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V1201/Q203M/Y318W Cavity Filling/ T332N_ T332N Hydrophobic core V120I/Q203M/Y318W 1384 A487 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120W/Q203M/Y318W Cavity Filling/ T332N_ T332N Hydrophobic core V120W/Q203M/Y318W 1385 A488 BG505.SOSIP.R6.664. BG505 SOSIP, V120F/Q315M Cavity Filling/ T332N_ R6, 664, Hydrophobic core V120F/Q315M T332N 1386 A489 BG505.SOSIP.R6.664. BG505 SOSIP, V120W/Q315F Cavity Filling/ T332N_ R6, 664, Hydrophobic core V120W/Q315F T332N 1387 A490 BG505.SOSIP.R6.664. BG505 SOSIP, Y177W/I420M Cavity Filling/ T332N_ R6, 664, Hydrophobic core Y177W/I420M T332N SOSIP, 1388 A491 BG505.SOSIP.R6.664. BG505 SOSIP, Y177W/Q328F/1420M Cavity Filling/ T332N_ R6, 664, Hydrophobic core Y177W/Q328F/I420M T332N 1389 A492 BG505.SOSIP.R6.664. BG505 SOSIP, L116M/M426F/Q432M Cavity Filling/ T332N_ R6, 664, Hydrophobic core L116M/M426F/Q432M T332N 1390 A493 BG505.SOSIP.R6.664. BG505 SOSIP, L116M/M426F/Q432W Cavity Filling/ T332N_ R6, 664, Hydrophobic core L116M/M426F/Q432W T332N 1391 A494 BG505.SOSIP.R6.664. BG505 SOSIP, M426F/Q432L Cavity Filling/ T332N_ R6, 664, Hydrophobic core M426F/Q432L T332N 1392 A495 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V134F/L175M/1322M/ Cavity Filling/ T332N_ T332N 1326M/N136W/M Hydrophobic core V134F/ L50H L175M/I322M/I 326M/N136W/M150H 1393 A496 BG505.SOSIP. BG505 SOSIP, R6, V134l/L175W/l322F/ Cavity Filling/ R6.664. 664, l326L/N136W/M15 Hydrophobic core T332N_ T332N DF V134I/ L175W/I322F/I3 26L/N136W/M150F 1394 A497 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120F/Q203M/ Cavity Filling/ T332N_ T332N Y318M/Q315M Hydrophobic core V120F/ Q203M/Y318M/ Q315M 1395 A498 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, V120W/Q203M/ Cavity Filling/ T332N_ T332N Y318W/Q315F Hydrophobic core V120W/Q203M/Y318 W/Q315F 1396 A499 BG505.SOSIP.R6.664. BG505 SOSIP, R6, 664, L154M/N300M/N302M/ Cavity Filling/ T332N_ T332N T320L/Y177W/I4 Hydrophobic core L154M/N300M/N302M 20M /T320L/Y177W/I420M 1397 A500 BG505.SOSIP. BG505 SOSIP, R6, 664, L154W/N300L/N302G/ Cavity Filling/ R6.664. T332N T320F/Y177W/Q3 Hydrophobic core T332N_ 28F/I420M L154W/N300L/N302G/ r320F/Y177W/Q, 328F/l420M 1398 A501 703010505.TF. 703010505.TF SOSIP, R6, 664 I201C/A433C sosip_ d7324, R6, 664, 1201C/A433C 1399 A502 703010505.TF. 703010505.TF SOSIP, R6, 664 I201C/A433C trimer association SOSip_ domain mutations d7324_ tad, R6, 664, I201C/A433C/E47D/K49E/ V65K/E106T/E429R/R432 Q/E500R 1400 A503 286.36.sosip_ 286.36 SOSIP, R6, 664 I201C/A433C d7324 1401 A504 288.38.sosip_ 288.38 SOSIP, R6, 664 I201C/A433C d7324 1402 A505 3988.25.sosip_ 3988.25 SOSIP, R6, 664 I201C/A433C d7324 1403 A506 5768.04.sosip_ 5768.04 SOSIP, R6, 664 I201C/A433C d7324 1404 A507 6101.1.sosip_ 5101.1 SOSIP, R6, 664 I201C/A433C d7324 1405 A508 6535.3.sosip_ 5535.3 SOSIP, R6, 664 I201C/A433C d7324 1406 A509 7165.18.sosip_ 7165.18 SOSIP, R6, 664 I201C/A433C d7324 1407 A510 00130952.11.sosip_ 130952.11 SOSIP, R6, 664 I201C/A433C d7324 1408 A511 0014282.42.sosip_ 14282.42 SOSIP, R6, 664 I201C/A433C d7324 1409 A512 0077_V1.C16.sosip_ 1077_V1.C16 SOSIP, R6, 664 I201C/A433C d7324 1410 A513 008362.5.sosip_ 3362.5 SOSIP, R6, 664 I201C/A433C d7324 1411 A514 0260.v5.c36.sosip_ 1260.v5.c36 SOSIP, R6, 664 I201C/A433C d7324 1412 A515 0330.v4.c3.sosip_ 1330.v4.c3 SOSIP, R6, 664 I201C/A433C d7324 1413 A516 D439.v5.c1.sosip_ 1439.v5.c1 SOSIP, R6, 664 I201C/A433C d7324 1414 A517 0815.V3.C3.sosip_ 1815.V3.C3 SOSIP, R6, 664 I201C/A433C d7324 1415 A518 0921.V2.C14.sosip_ 1921.V2.C14 SOSIP, R6, 664 I201C/A433C d7324 1416 A519 160552.3.sosip_ 160552.3 SOSIP, R6, 664 I201C/A433C d7324 1417 A520 168452.22.sosip_ 168452.22 SOSIP, R6, 664 I201C/A433C d7324 1418 A521 169362.21.sosip_ 169362.21 SOSIP, R6, 664 I201C/A433C d7324 1419 A522 231965.c1.sosip_ 231965.C1 SOSIP, R6, 664 I201C/A433C d7324 1420 A523 23547.sosip_ 23547 SOSIP, R6, 664 I201C/A433C d7324 1421 A524 24214.sosip_ 24214 SOSIP, R6, 664 I201C/A433C d7324 1422 A525 24723.sosip_ 24723 SOSIP, R6, 664 I201C/A433C d7324 1423 A526 257102.43.sosip_ 257102.43 SOSIP, R6, 664 I201C/A433C d7324 1424 A527 257112.4.sosip_ 257112.4 SOSIP, R6, 664 I201C/A433C d7324 1425 A528 259252.22.sosip_ 259252.22 SOSIP, R6, 664 I201C/A433C d7324 1426 A529 261912.48.sosip_ 261912.48 SOSIP, R6, 664 I201C/A433C d7324 1427 A530 2638.sosip_ 2638 SOSIP, R6, 664 I201C/A433C d7324 1428 A531 26912.sosip_ 26912 SOSIP, R6, 664 I201C/A433C d7324 1429 A532 27111.sosip_ 27111 SOSIP, R6, 664 I201C/A433C d7324 1430 A533 3016.v5.c45.sosip_ 3016.v5.c45 SOSIP, R6, 664 I201C/A433C d7324 1431 A534 3168.V4.C10.sosip_ 3168.V4.C10 SOSIP, R6, 664 I201C/A433C d7324 1432 A535 3301.V1.C24.sosip_ 3301.V1.C24 SOSIP, R6, 664 I201C/A433C d7324 1433 A536 3326.V4.C3.sosip_ 3326.V4.C3 SOSIP, R6, 664 I201C/A433C d7324 1434 A537 3337.V2.C6.sosip_ 3337.V2.C6 SOSIP, R6, 664 I201C/A433C d7324 1435 A538 3365.v2.c20.sosip_ 3365.v2.c20 SOSIP, R6, 664 I201C/A433C d7324 1436 A539 3415.v1.c1.sosip_ 3415.v1.c1 SOSIP, R6, 664 I201C/A433C d7324 1437 A540 3468.V1.C12.sosip_ 3468.V1.C12 SOSIP, R6, 664 I201C/A433C d7324 1438 A541 3589.V1.C4.sosip_ 3589.V1.C4 SOSIP, R6, 664 I201C/A433C d7324 1439 A542 3637.V5.C3.sosip_ 3637.V5.C3 SOSIP, R6, 664 I201C/A433C d7324 1440 A543 3718.v3.c11.sosip_ 3718.v3.c1l SOSIP, R6, 664 I201C/A433C d7324 1441 A544 3817.v2.c59.sosip_ 3817.v2.c59 SOSIP, R6, 664 I201C/A433C d7324 1442 A545 3873.V1.C24.sosip_ 3873.V1.C24 SOSIP, R6, 664 I201C/A433C d7324 1443 A546 398F1_F6_20.sosip_ 398F1_F6_20 SOSIP, R6, 664 I201C/A433C d7324 1444 A547 57128.vrc15.sosip_ 57128.vrc15 SOSIP, R6, 664 I201C/A433C d7324 1445 A548 6095.V1.C10.sosip_ 5095.V1.C10 SOSIP, R6, 664 I201C/A433C d7324 1446 A549 620345.c1.sosip_ 520345.c1 SOSIP, R6, 664 I201C/A433C d7324 1447 A550 6322.V4.Cl.sosip_ 5322.V4.C1 SOSIP, R6, 664 I201C/A433C d7324 1448 A551 6405.v4.c34.sosip_ 5405.v4.c34 SOSIP, R6, 664 I201C/A433C d7324 1449 A552 6471.V1.C16.sosip_ 5471.V1.C16 SOSIP, R6, 664 I201C/A433C d7324 1450 A553 6540.v4.c1.sosip_ 5540.v4.c1 SOSIP, R6, 664 I201C/A433C d7324 1451 A554 6545.V3.C13.sosip_ 5545.V3.C13 SOSIP, R6, 664 I201C/A433C d7324 1452 A555 6545.V4.C1.sosip_ 5545.V4.C1 SOSIP, R6, 664 I201C/A433C d7324 1453 A556 6631.V3.C10.sosip_ 5631.V3.C10 SOSIP, R6, 664 I201C/A433C d7324 1454 A557 6644.V2.C33.sosip_ 5644.V2.C33 SOSIP, R6, 664 I201C/A433C d7324 1455 A558 6785.V5.C14.sosip_ 5785.V5.C14 SOSIP, R6, 664 I201C/A433C d7324 1456 A559 6838.V1.C35.sosip_ 5838.V1.C35 SOSIP, R6, 664 I201C/A433C d7324 1457 A560 89.6.DG.sosip_ 39.6.DG SOSIP, R6, 664 I201C/A433C d7324 1458 A561 92828.sosip_ 92828 SOSIP, R6, 664 I201C/A433C d7324 1459 A562 96ZM651.02.sosip_ 96ZM651.02 SOSIP, R6, 664 I201C/A433C d7324 1460 A563 A03349M1.vrc4a.sosip_ A03349M1.vrc4a SOSIP, R6, 664 I201C/A433C d7324 1461 A564 4C10.29.sosip_ AC10.29 SOSIP, R6, 664 I201C/A433C d7324 1462 A565 ADA.DG.SOSip_ ADA.DG SOSIP, R6, 664 I201C/A433C d7324 1463 A566 Bal.01.sosip_ Bal.01 SOSIP, R6, 664 I201C/A433C d7324 1464 A567 BaL.26.sosip_ BaL.26 SOSIP, R6, 664 I201C/A433C d7324 1465 A568 BB201.B42.sosip_ BB201.B42 SOSIP, R6, 664 I201C/A433C d7324 1466 A569 BB539.2B13.sosip_ BB539.2B13 SOSIP, R6, 664 I201C/A433C d7324 1467 A570 BG1168.01.sosip_ BG1168.01 SOSIP, R6, 664 I201C/A433C d7324 1468 A571 BI369.9A.sosip_ BI369.9A SOSIP, R6, 664 I201C/A433C d7324 1469 A572 BLOl.DG.sosip_ BL01.DG SOSIP, R6, 664 I201C/A433C d7324 1470 A573 BR025.9.SOSip_ BRO25.9 SOSIP, R6, 664 I201C/A433C d7324 1471 A574 BRO7.DG.sosip_ BR07.DG SOSIP, R6, 664 I201C/A433C d7324 1472 A575 BS208.B1.sosip_ BS208.B1 SOSIP, R6, 664 I201C/A433C d7324 1473 A576 BX08.16.sosip_ BX08.16 SOSIP, R6, 664 I201C/A433C d7324 1474 A577 C1080.c3.sosip_ C1080.C3 SOSIP, R6, 664 I201C/A433C d7324 1475 A578 C2101.c1.sosip_ C2101.c1 SOSIP, R6, 664 I201C/A433C d7324 1476 A579 C3347.c11.sosip_ C3347.cH SOSIP, R6, 664 I201C/A433C d7324 1477 A580 C4118.09.sosip_ C4118.09 SOSIP, R6, 664 I201C/A433C d7324 1478 A581 CAAN.A2.sosip_ CAAN.A2 SOSIP, R6, 664 I201C/A433C d7324 1479 A582 CAP210.E8.sosip_ CAP210.E8 SOSIP, R6, 664 I201C/A433C d7324 1480 A583 CAP244.D3.SOSip_ CAP244.D3 SOSIP, R6, 664 I201C/A433C d7324 1481 A584 CAP45.G3.sosip_ CAP45.G3 SOSIP, R6, 664 I201C/A433C d7324 1482 A585 CH038.12.sosip_ CH038.12 SOSIP, R6, 664 I201C/A433C d7324 1483 A586 CH070.1.sosip_ CH070.1 SOSIP, R6, 664 I201C/A433C d7324 1484 A587 CH117.4.sosip_ CH117.4 SOSIP, R6, 664 I201C/A433C d7324 1485 A588 CH181.12.sosip_ CH181.12 SOSIP, R6, 664 I201C/A433C d7324 1486 A589 CNE10.sosip_ CNE10 SOSIP, R6, 664 I201C/A433C d7324 1487 A590 CNE12.sosip_ CNE12 SOSIP, R6, 664 I201C/A433C d7324 1488 A591 CNE14.sosip_ CNE14 SOSIP, R6, 664 I201C/A433C d7324 1489 A592 CNE15.sosip_ CNE15 SOSIP, R6, 664 I201C/A433C d7324 1490 A593 CNE3.sosip_ CNE3 SOSIP, R6, 664 I201C/A433C d7324 1491 A594 CNE30.sosip_ CNE30 SOSIP, R6, 664 I201C/A433C d7324 1492 A595 CNE31.sosip_ CNE31 SOSIP, R6, 664 I201C/A433C d7324 1493 A596 CNE4.sosip_ CNE4 SOSIP, R6, 664 I201C/A433C d7324 1494 A597 CNE40.sosip_ CNE40 SOSIP, R6, 664 I201C/A433C d7324 1495 A598 CNE5.sosip_ CNE5 SOSIP, R6, 664 I201C/A433C d7324 1496 A599 CNE53.sosip_ CNE53 SOSIP, R6, 664 I201C/A433C d7324 1497 A600 CNE55.sosip_ CNE55 SOSIP, R6, 664 I201C/A433C d7324 1498 A601 CNE56.sosip_ CNE56 SOSIP, R6, 664 I201C/A433C d7324 1499 A602 CNE57.sosip_ CNE57 SOSIP, R6, 664 I201C/A433C d7324 1500 A603 CNE58.sosip_ CNE58 SOSIP, R6, 664 I201C/A433C d7324 1501 A604 CNE59.sosip_ CNE59 SOSIP, R6, 664 I201C/A433C d7324 1502 A605 CNE7.sosip_ CNE7 SOSIP, R6, 664 I201C/A433C d7324 1503 A606 DJ263.8.sosip_ J263.8 SOSIP, R6, 664 I201C/A433C d7324 1504 A607 DU123.06.sosip_ U123.06 SOSIP, R6, 664 I201C/A433C d7324 1505 A608 DU151.02.sosip_ U151.02 SOSIP, R6, 664 I201C/A433C d7324 1506 A609 DU156.12.sosip_ U156.12 SOSIP, R6, 664 I201C/A433C d7324 1507 A610 DU172.17.sosip_ U172.17 SOSIP, R6, 664 I201C/A433C d7324 1508 A611 DU422.01.sosip_ U422.01 SOSIP, R6, 664 I201C/A433C d7324 1509 A612 HO86.8.sosip_ H086.8 SOSIP, R6, 664 I201C/A433C d7324 1510 A613 HT593.1.sosip_ HT593.1 SOSIP, R6, 664 I201C/A433C d7324 1511 A614 JRCSF.JB.sosip_ JRCSF.JB SOSIP, R6, 664 I201C/A433C d7324 1512 A615 JRFL.JB.sosip_ JRFL.JB SOSIP, R6, 664 I201C/A433C d7324 1513 A616 KER2008.12.sosip_ KER2008.12 SOSIP, R6, 664 I201C/A433C d7324 1514 A617 KER2018.11.sosip_ KER2018.11 SOSIP, R6, 664 I201C/A433C d7324 1515 A618 KNH1209.18.sosip_ KNH1209.18 SOSIP, R6, 664 I201C/A433C d7324 1516 A619 M02138.sosip_ M02138 SOSIP, R6, 664 I201C/A433C d7324 1517 A620 MB201.A1.sosip_ MB201.A1 SOSIP, R6, 664 I201C/A433C d7324 1518 A621 MB539.2B7.sosip_ MB539.287 SOSIP, R6, 664 I201C/A433C d7324 1519 A622 MI369.A5.sosip_ M1369.A5 SOSIP, R6, 664 I201C/A433C d7324 1520 A623 MN.3.sosip_ MN.3 SOSIP, R6, 664 I201C/A433C d7324 1521 A624 MS208.A1.sosip_ MS208.A1 SOSIP, R6, 664 I201C/A433C d7324 1522 A625 MW965.26.sosip_ MW965.26 SOSIP, R6, 664 I201C/A433C d7324 1523 A626 NKU3006.ec1.sosip_ NKU3006.ec1 SOSIP, R6, 664 I201C/A433C d7324 1524 A627 PVO.04.sosip_ PVO.04 SOSIP, R6, 664 I201C/A433C d7324 1525 A628 Q168.a2.sosip_ Q168.a2 SOSIP, R6, 664 I201C/A433C d7324 1526 A629 Q23.17.sosip_ Q23.17 SOSIP, R6, 664 I201C/A433C d7324 1527 A630 Q259.17.sosip_ Q259.17 SOSIP, R6, 664 I201C/A433C d7324 1528 A631 Q461.e2.sosip_ 0461.e2 SOSIP, R6, 664 I201C/A433C d7324 1529 A632 Q769.d22.sosip_ Q769.d22 SOSIP, R6, 664 I201C/A433C d7324 1530 A633 Q769.h5.sosip_ Q769.h5 SOSIP, R6, 664 I201C/A433C d7324 1531 A634 Q842.dl2.sosip_ Q842.d12 SOSIP, R6, 664 I201C/A433C d7324 1532 A635 QH0515.01.sosip_ QH0515.01 SOSIP, R6, 664 I201C/A433C d7324 1533 A636 QH0692.42.sosip_ QH0692.42 SOSIP, R6, 664 I201C/A433C d7324 1534 A637 QH209.14M.A2.sosip_ QH209.14M.A2 SOSIP, R6, 664 I201C/A433C d7324 1535 A638 R1166.c1.sosip_ R166.c1 SOSIP, R6, 664 I201C/A433C d7324 1536 A639 R2184.c4.sosip_ R2184.c4 SOSIP, R6, 664 I201C/A433C d7324 1537 A640 R3265.c6.sosip_ 33265.c6 SOSIP, R6, 664 I201C/A433C d7324 1538 A641 REJO.67.sosip_ REJO.67 SOSIP, R6, 664 I201C/A433C d7324 1539 A642 RHPA.7.sosip_ RHPA.7 SOSIP, R6, 664 I201C/A433C d7324 1540 A643 RW020.2.sosip_ RW020.2 SOSIP, R6, 664 I201C/A433C d7324 1541 A644 SC422.8.sosip_ dsC422.8 SOSIP, R6, 664 I201C/A433C d7324 1542 A645 SF162.LS.SOSip_ SF162.LS SOSIP, R6, 664 I201C/A433C d7324 1543 A646 SO18.18.sosip_ S018.18 SOSIP, R6, 664 I201C/A433C d7324 1544 A647 SS1196.01.sosip_ SS1196.01 SOSIP, R6, 664 I201C/A433C d7324 1545 A648 F2504.sosip_ F2504 SOSIP, R6, 664 I201C/A433C d7324 1546 A649 F25118.sosip_ 25118 SOSIP, R6, 664 I201C/A433C d7324 1547 A650 F25311.sosip_ F25311 SOSIP, R6, 664 I201C/A433C d7324 1548 A651 F25534.sosip_ F25534 SOSIP, R6, 664 I201C/A433C d7324 1549 A652 F25731.sosip_ F25731 SOSIP, R6, 664 I201C/A433C d7324 1550 A653 F26660.sosip_ F26660 SOSIP, R6, 664 I201C/A433C d7324 1551 A654 F27850.sosip_ F27850 SOSIP, R6, 664 I201C/A433C d7324 1552 A655 F2805.sosip_ F2805 SOSIP, R6, 664 I201C/A433C d7324 1553 A656 F337.sosip_ F337 SOSIP, R6, 664 I201C/A433C d7324 1554 A657 TH966.8.sosip_ TH966.8 SOSIP, R6, 664 I201C/A433C d7324 1555 A658 TH976.17.sosip_ TH976.17 SOSIP, R6, 664 I201C/A433C d7324 1556 A659 THRO.lS.SOSip_ THRO.18 SOSIP, R6, 664 I201C/A433C d7324 1557 A660 TRJO.SS.sosip_ TRJO.58 SOSIP, R6, 664 I201C/A433C d7324 1558 A661 TRO.11.sosip_ TRO.11 SOSIP, R6, 664 I201C/A433C d7324 1559 A662 rvi.29.sosip_ TV1.29 SOSIP, R6, 664 I201C/A433C d7324 1560 A663 FZA125.17.sosip_ TZA125.17 SOSIP, R6, 664 I201C/A433C d7324 1561 A664 rZBD.02.sosip_ TZBD.02 SOSIP, R6, 664 I201C/A433C d7324 1562 A665 UG021.16.sosip_ JGO21.16 SOSIP, R6, 664 I201C/A433C d7324 1563 A666 UG024.2.sosip_ UG024.2 SOSIP, R6, 664 I201C/A433C d7324 1564 A667 UG037.8.sosip_ UG037.8 SOSIP, R6, 664 I201C/A433C d7324 1565 A668 WITO.33.sosip_ WITO.33 SOSIP, R6, 664 I201C/A433C d7324 1566 A669 X2088.c9.sosip_ X2088.c9 SOSIP, R6, 664 I201C/A433C d7324 1567 A670 YU2.DG.sosip_ YU2.DG SOSIP, R6, 664 I201C/A433C d7324 1568 A671 ZA012.29.sosip_ ZA012.29 SOSIP, R6, 664 I201C/A433C d7324 1569 A672 ZM106.9.sosip_ ZM106.9 SOSIP, R6, 664 I201C/A433C d7324 1570 A673 ZM109.4.sosip_ ZM109.4 SOSIP, R6, 664 I201C/A433C d7324 1571 A674 ZM135.10a.sosip_ ZM135.10a SOSIP, R6, 664 I201C/A433C d7324 1572 A675 ZM176.66.sosip_ ZM176.66 SOSIP, R6, 664 I201C/A433C d7324 1573 A676 ZM197.7.sosip_ ZM197.7 SOSIP, R6, 664 I201C/A433C d7324 1574 A677 ZM214.15.sosip_ ZM214.15 SOSIP, R6, 664 I201C/A433C d7324 1575 A678 ZM215.8.sosip_ ZM215.8 SOSIP, R6, 664 I201C/A433C d7324 1576 A679 ZM233.6.sosip_ ZM233.6 SOSIP, R6, 664 I201C/A433C d7324 1577 A680 ZM249.1.sosip_ ZM249.1 SOSIP, R6, 664 I201C/A433C d7324 1578 A681 ZM53.12.sosip_ ZM53.12 SOSIP, R6, 664 I201C/A433C d7324 1579 A682 ZM55.28a.sosip_ ZM55.28a SOSIP, R6, 664 I201C/A433C d7324 1580 A683 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Stability E168K, BG505 gp41 chim, chimera Y191W I201C-A433C, Y191W 1581 A684 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, Y191W Stability E168K, Y191W chimera 1582 A685 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, VRC26 binding chimera R315Q E168K, BG505 gp41 chim, I201C-A433C, R315Q 1583 A686 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, VRC26 binding E168K, BG505 chimera residues 161-170 gp41 chim, From CAP256 SU strain I201C-A433C, 161-170SU 1584 A687 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, VRC26 binding E168K, BG505 chimera residues 161-170 gp41 chim, I201C-A433C, From CAP256 SU strain, 161-170SU, R313Q R313Q 1585 A688 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, R315Q VRC26 binding E168K, R315Q chimera 1586 A689 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, residues 161-170 VRC26 binding E168K, 161-170, SUstrand C chimera from CAP256 SU strain 1587 A690 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, residues 161-170 VRC26 binding E168K, 161-170SU, R313Q chimera from CAP256 SU strain, R313Q 1588 A691 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera T128C, D167C I201C-A433C, T128C, D167C 1589 A692 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera V127C, D167C I201C-A433C, V127C, D167C 1590 A693 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, T128C, D167C Interprotomer DS E168K, T128C, D167C chimera 1591 A694 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, V127C, D167C Interprotomer DS E168K, V127C, D167C chimera 1592 A695 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera I165C, C196S I201C-A433C, I165C, C196S 1593 A696 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera I165C, C196F I201C-A433C, I165C, C196F 1594 A697 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera I165C, C196L I201C-A433C, I165C, C196L 1595 A698 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I165C, C196S Interprotomer DS E168K, ll65C, C196S chimera 1596 A699 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I165C, C196F Interprotomer DS E168K, ll65C, C196F chimera 1597 A700 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I165C, C196L Interprotomer DS E168K, ll65C, C196L chimera 1598 A701 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, DDS E168K, BG505 gp41 chim, chimera R304C/R440C I201C-A433C, R304C/R440C 1599 A702 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, DDS E168K, BG505 gp41 chim, chimera A174C/T319C I201C-A433C, A174C/T319C 1600 A703 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, DDS E168K, BG505 gp41 chim, chimera S164C/H308C I201C-A433C, S164C/H308C 1601 A704 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera S110C/L556C I201C-A433C, S110C/L556C 1602 A705 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, S110C/L556C Interprotomer DS E168K, S110C/L556C chimera 1603 A706 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, I201C-A433C, Interprotomer DS E168K, BG505 gp41 chim, chimera A558C/D113C I201C-A433C, A558C/D113C 1604 A707 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, A558C/D113C Interprotomer DS E168K, A558C/D113C chimera 1605 A708 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561W Cav E168K, E561W chimera 1606 A709 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561F Cav E168K, E561F chimera 1607 A710 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561W/K121F Cav E168K, E561W/K121F chimera 1608 A711 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561F/K121F Cav E168K, E561F/K121F chimera 1609 A712 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561W/K121W Cav E168K, E561W/K121W chimera 1610 A713 JRFLgp140.6R.SOSIP.664. JRFLgp140/BG505 SOSIP, R6, 664 E168K, E561F/K121W Cav E168K, E561F/K121W chimera 1611 A714 BG505gp140.6R.SOSIP.664. BG505 SOSIP, R6, 664 T332N.D7325 Q315C T332N.D7325 Q315C 1612 A715 BG505gp140.6R.SOSIP.664. BG505 SOSIP, R6, 664 F332N.D7324 V120C T332N.D7324_V120C 1613 A716 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K Q315C E168K_Q315C 1614 A717 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168KV120C E168K_V120C 1615 A718 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K E168K 1616 A719 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K I201C/A433C DS E168K_I201C/A433C 1617 A720 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K A433P Stability E168K_A433P 1618 A721 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K_Q432P Stability E168K_Q432P 1619 A722 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K S174C/A319C E168K_S174C/A319C 1620 A723 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K N195C/A433C E168K_N195C/A433C 1621 A724 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K S199C/A433C E168K_S199C/A433C 1622 A725 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K R304C/Q440C E168K_R304C/Q440C 1623 A726 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K F223W Cav E168K_F223W 1624 A727 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K G473Y Cav E168K_G473Y 1625 A728 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K G431P Stability E168K_G431P 1626 A729 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K N425C A433C E168K_N425C_A433C 1627 A730 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K V120C Q315C E168K_V120C_Q315C 1628 A731 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K Q203C L122C E168K_Q203C_L122C 1629 A732 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K_I201C/A433C/ E168K_I201C/A433C/R304 R304C/Q440C C/Q440C 1630 A733 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K R304C/R440C E168K_R304C/R440C 1631 A734 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K Q203C/F317C E168K_Q203C/F317C 1632 A735 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K L122C/F317C E168K_L122C/F317C 1633 A736 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K P437C/Y318C E168K_P437C/Y318C 1634 A737 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K E172C/I307C E168K_E172C/I307C 1635 A738 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K P206C/Y318C E168K_P206C/Y318C 1636 A739 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K A174C/T319C E168K_A174C/T319C 1637 A740 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K S164C/H308C E168K_S164C/H308C 1638 A741 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K T320C/L175C E168K_T320C/L175C 1639 A742 JRFLgp140.6R.SOSIP.664. JRFL SOSIP, R6, 664 E168K T320C/P438C E168K_T320C/P438C 1640 A743 JRFLgp140.6R.SOS.664. JRFL 6R.SOS.664 E168K stability E168K 1641 A744 JRFLgp140.6R.IP.664. JRFL 6R.IP.664 E168K stability E168K 1642 A745 JRFLgp140.6R.664. JRFL 6R.664 E168K stability E168K 1643 B192 *703010505.TF-chim-sc_ 703010505.TF/BG505 SOSIP, sc15ln, 664 I201C/A433C d7324, R6, 664, chimera I201C/A433C AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVLKNVTENFNMWK NDMVDQMHEDVISLWDQSLKPCVKLTPLCVTLNCTNATASNSSIIEGM KNCSFNITTELRDKREKKNALFYKLDIVQLDGNSSQYRLINCNTSVITQACPKVSFDPIPIHYCAPA GYAILKCNNKTFTGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEGE IIIRSENITNNVKTIIVHLNESVKIECTRPNNKTRTSIRIGPGQAFYATGQVIGDIREAYCNINESK WNETLQRVSKKLKEYFPHKNITFQPSSGGDLEITTHSFNCGGEFFYCN TSSLFNRTYMANSTDMANSTETNSTRTITIHCRIKQIINMWQEVGRAMYAPPIAGNITCISNITGLL LTRDGGKNNTETFRPGGGNMKDNWRSELYKYKVVKEPLGVAPTRCKRR VVGggsggggsggggsggAVGIGAVFLGFLGAAGSTMGAASMTLTV0ARNLLSGIVQQQSNLLRAPE AQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNV PWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1644 B193 703010505.TF-chim- 703010505.TF/ SOSIP, I201C/A433C/ single chain 15 sc_d7324_tad, BG505 sc15ln 664 E47D/K49E/ amino acid linker, sc15ln, 664, chimera V65K/E106T/E trimer association I201C/A433C/E47D/ 429R/R4320/ domain mutations K49E/V65K/E106T/ E500R E429R/R432 Q/E500R 1645 B194 bg505.sosip_ BG505 SOSIP; 508(REKR)511 increase CD4- cl5ln.DS_gly3 664; replaced by binding site 201C, 433C linker of accessibility ength 15, 278A, oy removing 365A, 464A glycans around it 1646 B195 bg505.sosip_ BG505 SOSIP; 508(REKR)511 Same as Seq_1645 cl5ln.DS_gly4 664; replaced by 201C, 433C linker of ength 15, S199A, 278A, 365A, 464A 1647 B196 bg505.sosip_ BG505 SOSIP; 508(REKR)511 Same as Seq_1645 cl5ln.DS_gly5 664; replaced by 201C, 433C linker of ength 15, S199A, 278A, 365A, 388A, 464A 1648 B197 ZM55.28a-chim- ZM55/BG505 SOSIP; 5eq_0534 linker Same as Seq_1645 sc_DS_gly3 chimera 664; between 508-511, 201C, 433C BG505 Platform, BG505 Res. Set B, remainder = ZM55.28a, 278A, 463A, 467A 1649 B198 ZM55.28a-chim- ZM55/BG505 SOSIP; Seq_0534 linker Same as Seq_1645 sc_DS_gly4 chimera 664; between 508-511, 201C, 433C BG505 Platform, BG505 Res. Set B, remainder = ZM55.28a, S199A, 278A, 463A, 467A 1650 B199 ZM55.28a-chim- ZM55/BG505 SOSIP; Seq_0534 linker Same as Seq_1645 sc_DS_gly5 chimera 664; between 508-511, 201C, 433C BG505 Platform, BG505 Res. Set B, remainder = ZM55.28a, S199A, 278A, 388A, 463A, 467A 1651 D011 BG505sosip_ BG505 SOSIP, R6, 664, 278A, 365A, 464A Same as Seq_1645 ig_I201C/ 201C/433C A433C.STOP-gly3 1652 D012 BG505sosip_ BG505 SOSIP, R6, 664, S199A, 278A, Same as Seq_1645 ig_ 201C/433C 365A, 464A I201C/A433C.STOP-gly4 1653 D013 BG505sosip_ BG505 SOSIP, R6, 664, 5199A, 278A, 365A, Same as Seq_1645 ig_ 201C/433C 388A, 464A I201C/A433C.STOP-gly5 1654 D014 CH505SOSIP_ CH505 SOSIP, R6, 664, 278A, 463A Same as Seq_1645 DS_degly3 201C/433C 1655 D015 CH505SOSIP_ CH505 SOSIP, R6, 664, 199A, 278A, 463A Same as Seq_1645 DS_degly4 201C/433C 1656 D016 CH505SOSIP_ CH505 SOSIP, R6, 664, 199A, 278A, 388A, 463A Same as Seq_1645 DS_degly5 201C/433C 1657 D017 ZM55.28a-chim_ ZM55/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly3 chimera 201C/433C BG505 Res. Set B, remainder = ZM55.28a, 278A, 463A, 467A 1658 D018 ZM55.28a-chim_ ZM55/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly4 chimera 201C/433C BG505 Res. Set B, remainder = ZM55.28a, S199A, 278A, 463A, 467A 1659 D019 ZM55.28a-chim_ ZM55/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly5 chimera 201C/433C BG505 Res. Set B, remainder = ZM55.28a, S199A, 278A, 388A, 463A, 467A 1660 D020 ZM106.9.sosip_ Zml096.9 SOSIP, R6, 664, 278A, 466A Same as Seq_1645 DS_gly3 201C/433C 1661 D021 ZM106.9.sosip_ Zml096.9 SOSIP, R6, 664, S199A, 278A, 466A Same as Seq_1645 DS_gly4 201C/433C 1662 D022 ZM106.9.sosip_ Zml096.9 SOSIP, R6, 664, S199A, 278A, 388A, 466A Same as Seq_1645 DS_gly5 201C/433C 1663 D023 CH038.12-chim_ CH038/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly3 chimera 201C/433C BG505 Res. Set B, remainder = CH038, 278A, 464A, 467A 1664 D024 CH038.12-chim_ CH038/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly4 chimera 201C/433C BG505 Res. Set B, remainder = CH038, 199A, 278A, 464A, 467A 1665 D025 CH038.12-chim_ CH038/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly5 chimera 201C/433C BG505 Res. Set B, remainder = CH038, 199A, 278A, 388A, 464A, 467A 1666 D026 ZM106.9-chim_ ZM106/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly3 chimera 201C/433C BG505 Res. Set B, remainder = ZM106.9, 278A, 466A 1667 D027 ZM106.9-chim_ ZM106/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly4 chimera 201C/433C BG505 Res. Set B, remainder = ZM106.9, S199A, 278A, 466A 1668 D028 ZM106.9-chim_ ZM106/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly5 chimera 201C/433C BG505 Res. Set B, remainder = ZM106.9, S199A, 278A, 388A, 466A 1669 D029 16055-2.3-chim_ 10655/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly3 chimera 201C/433C BG505 Res. Set B, remainder = 10655, 278A, 465A 1670 D030 16055-2.3-chim_ 10655/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly4 chimera 201C/433C BG505 Res. Set B, remainder = 10655, S199A, 278A, 465A 1671 D031 16055-2.3-chim_ 10655/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 DS_gly5 chimera 201C/433C BG505 Res. Set B, remainder = 10655, S199A, 278A, 388A, 465A 1672 D032 45_01dG5_bg505- 45-01dG5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 NCgp120 + gp41. chimera 201C/433C BG505 Res. Set B, SOSIP_ remainder = 45 01dG5, DS_gly3 364A 1673 D033 45_01dG5_bg505- 45-01dG5/BG505 SOSIP, R6, 664, BG505 Platform, Same as Seq_1645 NCgp120 + gp41. chimera 201C/433C BG505 SOSIP_ Res. Set B, DS_gly4 remainder = 45 01dG5, S199A, 364A 1674 D034 426c_degly3DS 426c SOSIP, R6, 664, 278A, 462A Same as Seq_1645 201C/433C 1675 D035 426c_degly4DS 426c SOSIP, R6, 664, S199A, 278A, 462A Same as Seq_1645 201C/433C 1676 H385 *426c-v1v2- 426c/WITO- SOSIP, BG505 WITO-degly4- Vlv2/BG505 R6, 664, chimera, S199A/I201C/A433C/ chimera 5199A/I201C/ V1V2 chimera, N276D/N460D/ A433C/N276 glycan N463D/R504N/ D/N460D/N463D/ shielding at V506T/L661N/ R504N/ residues 504, 661 L663T V506T/L661N/ L663T AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISST NGSTANVTMREEMKNCSFNTTTVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTATCTQACP KVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTVQC THGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPGQT FYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNI SFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIK GNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRS ELYKYKVVKIEPLGVAPTRCKRnvtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLS GIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLR DQQLLGIWGCSGKLICaNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKN EQDLnAtD 1677 H386 *426c-v1v2- 426c/WITO- SOSIP, BG505 WITO-degly3- Vlv2/BG505 R6, 664, chimera, I201C/A433C/ chimera I201C/A433C/ V1V2 chimera, N276D/N460D/ N276D/N46 glycan N463D/R504N/ DD/N463D/ shielding at V506T/ R504N/V506T/ residues L661N/L663T L661N/L663T 504, 662 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISS TNGSTANVTMREEMKNCSFNTTTVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTsTCTQAC PKVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTV QCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPG QTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFP HKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYA PPIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMR DNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQA RNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLA VERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEES QNQQEKNEQDLnAtD 1678 H387 *426c-v1v2- 426c/ZM233- SOSIP, BG505 ZM233-degly4- Vlv2/BG505 R6, 664, chimera, S199A/I201C/ chimera S199A/I201C/ V1V2 chimera, A433C/N276D/ A433C/N276D/ glycan N460D/N463D N460D/N463D/ shielding at /R504N/ R504N/ residues V506T/L661N/ V506T/ 504, 663 L663T L661N/L663T AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKI CSFNMTTELRDKKRKVNVLFYKLDLVPLTNSSNTTNYRLISCNTATCTQACPKVTFDPIPIHYCAPA GYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEI VIRSKNLADNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWS EAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSG LFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITCKSDITGLLLLRDGGNTANNAEIFRP GGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRRRRRAVGIGA VFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVE RYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDK EISNYTQIIYGLLEESQNQQEKNEQDLnAtD 1679 H388 *426c-v1v2- 426c/ZM233- SOSIP, BG505 ZM233-degly3- Vlv2/BG505 R6, chimera, I201C/A433C/ chimera 664, V1V2 chimera, N276D/N460D/ I201C/ glycan N463D/R504N/ A433C/ shielding at V506T/ N276D/ residues L661N/L663T N46DD/ 504, 664 N463D/ R504N/ V506T/ L661N/ L663T AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKI CSFNMTTELRDKKRKVNVLFYKLDLVPLTNSSNTTNYRLISCNTATCTQACPKVTFDPIPIHYCAPA GYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEI VIRSKNLADNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWS EAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSG LFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITCKSDITGLLLLRDGGNTANNAEIFRP GGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRRRRRAVGIGAV FLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVER YLRDQQLLGIWGCSGKLICaNVPWNSSWSNRNLSEIWDNMTWLQWDKEI SNYTQIIYGLLEESQNQQEKNEQDLnAtD 1680 H389 *d45-01dG5chim- donor45- SOSIP, BG505 v1v2-WITO- 01dG5/ R6, 664, chimera, I201C/A433C/ WITO- I201C/ V1V2 chimera, R504N/V506T/ V1V2/BG505 A433C/ glycan L661N/L663T chimera R504N/ shielding at V506 residues 504, T/L661N/ 665 L663T AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISS TNGSTANVTMREEMKNCSFNTTTVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTsVCTQAC PKISFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTQ QCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRPNNNTRKSIPIGPG RAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHF KNETIAFNQsSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQI INMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNG TTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGS TMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLT VWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEIS NYTQIIYGLLEESQNQQEKNEQDLnAtD 1681 H390 *d45-01dG5chim- donor45- SOSIP, BG505 v1v2-WITO- 01dG5/WITO- R6, 664, chimera, 01dG5chim-degly3- V1V2/BG505 I201C/ V1V2 chimera, I201C/S364A/ chimera S364A/A433C/ glycan A433C/R504N/ R504 shielding at V506T/L661N/L663T N/V506T/ residues L661N/L663T 504, 666 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANV TMREEMKNCSFNTTTVIRDKIQKEYALFVKLDIVPIEGKNTNTGYRLINCNT5VCTQACPKISFEPI PIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLL NGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIRQA HCNISKAKWENTLKQIARKLREHFKNETIAFNQaSGGDPEIVMHSFNC GGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGKCMYAPP1KGQIRCSS NITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEA QQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVP WNSSWSNRNLSEIWDNMTWLQWDKEISNYTQHYGLLEESQNQQEKNEQDLnAtD 1682 H391 *d45-01dG5chim- donor45- SOSIP, BG505 v1v2-WITO- 01dG5/WITO- R6, chimera, 01dG5chim-degly4- V1V2/BG505 664, V1V2 chimera, S199A/I201C/ chimera 5199A/ glycan S364A/A433C/ I201C/ shielding at R504N/V506T/ S364A/ residues L661N/L A433C/ 504, 667 663T R504N/ V506T/ L661N/L6 S3T AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISS TNGSTANVTMREEMKNCSFNTTTVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTsVCTQAC PKISFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTV QCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRPNNNTRKSIPIGPG RAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFK NETIAFNQaSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQII NMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGT TETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGST MGAASMTLTVQARNLLSGIVaQQSNLLRAPEAQQHLLKLTV WGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISN YTQIIYGLLEESQNQQEKNEQDLnAtD 1683 H392 *d45-01dG5chim- donor45- SOSIP, BG505 v1v2-ZM233- 01dG5/ZM233- R6, 664, chimera, I201C/A433C/R504N/ V1v2/BG505 I201C/A433C/ V1V2 chimera, V506T/L661N/L663T chimera R504N/V506T glycan /L661N/L663T shielding at residues 504, 668 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNI SKEMKICSFNMTTELRDKKRKVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTQACPKISFEPIPI HYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQ LLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDI RQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQsSGGDPE IVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGKCMYAPPI KGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRS ELYKYKVVKIEPLGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLS GIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRD QQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKN EQDLnAtD 1684 H393 *d45-01dG5chim- donor45-01dG5/ZM233- SOSIP, BG505 v1v2-ZM233-degly3- V1v2/BG505 R6, chimera, I201C/S364A/A433C chimera 664, V1V2 chimera, /R504N/V506T/ I201C/ glycan L661N/L663T S364A/ shielding at A433C/ residues R504N/ 504, 669 V506T/ L661N/L663T AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTsVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQaS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 1685 H394 *d45-01dG5chim- donor45- SOSIP, R6, BG505 v1v2-ZM233-degly4- 01dG5/ZM233- 664, chimera, S199A/201C/S364A/ V1V2/BG505 S199A/201C/ V1V2 chimera, A433C/R504N/V506T/ chimera S364A/A433 glycan L661N/L663T C/R504N/ shielding at V506T/L661N/ residues L6S3T 504, 670 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTaVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQaS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQJRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 1686 H395 *426c-v1v2- 426c/WITO- SOSIP, R6, BG505 WITO-degly4- V1V2/BG505 664, chimera, S199A/I201C/A433C/ chimera S199A/I201C/ V1V2 chimera, N276D/N460D/N463D A433C/N276D/ glycan N460D/N463D shielding at residues 504, 661 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTTT VIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTATCTQACPKVTFDPIPIHYCAPAGYAIL KCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKS VEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNI SFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPP IKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKR WGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKL TVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDK EISVYTQIIYGLLEESQNQQEKNEQDLLALD 1687 H396 *426c-v1v2- 426c/WITO- SOSIP, BG505 WITO-degly3- V1V2/BG505 R6, chimera, I201C/A433C/ chimera 664, V1V2 chimera, N276D/N460D/N463D I201C/ glycan A433C/ shielding at N276D/ residues 504, N460D/ 662 N463D AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTsTCTQACPKVTFDPIPIHYCAPAGYAI LKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNK SVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKN ISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAP PIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCK RRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQH LLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWL QWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1688 H397 *426c-v1v2- 426c/ZM233- SOSIP=, BG505 ZM233-degly4- Vlv2/BG505 R6, chimera, S199A/I201C/A433C/ chimera 664, V1V2 chimera, N276D/N460D/N463D 5199A/I201C/ glycan A433C/N276 shielding at D/N460D/ residues 504, 663 N463D AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKRK VNVLFYKLDLVPLTNSSNTTNYRLISCNTATCTQACPKVTFDPIPIHYCAPAGYAILKCNNKTFN GKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTRP NNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSGG DLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITCK SDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGRRRR RRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIK QL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYT QIIYGLLEESQNQQEKNEQDLLALD 1689 H398 *426c-v1v2- 426c/ZM233- SOSIP, BG505 ZM233-degly3- Vlv2/BG505 R6, chimera, I201C/A433C/ chimera 664, V1V2 chimera, N276D/N460D/N463D I201C/A433C/ glycan N276D/N460D/ shielding at N463D residues 504, 664 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTsTCTQACPKVTFDPIPIHYCAPAGYAILKCNNKTF NGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTR PNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSG GDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITC KSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGRRR RRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGI KQL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNY TQIIYGLLEESQNQQEKNEQDLLALD 1690 H399 *d45-01dG5chim- donor45- SOSIP, BG505 v1v2-WITO-I201C/ 01dG5/ R6, chimera, A433C WITO- 664, V1V2 chimera, V1V2/BG505 I201C/A433C glycan chimera shielding at residues 504, 665 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTSVCTQACPKISFEPIPIHYCAPAGFAI LKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNE TVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIR0AHCNISKAKWENTLKQIARKLREHFKNE TIAFNQsSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQII NMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKV VKIEPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQ QSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSN RNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1691 H400 *d45-01dG5chim- donor45- SOSIP, R6, BG505 v1v2-WITO-degly3- 01dG5/WITO- 664, chimera, I201C/S364A/A433C V1V2/BG505 I201C/S364A/ V1V2 chimera, chimera A433C glycan shielding at residues 504, 666 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTSVCTQACPKISFEPIPIHYCAPAGFAI LKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNE TVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIR0AHCNISKAKWENTLKQIARKLREHFKNE TIAFNQaSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQII NMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKV VKIEPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQ QSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSN RNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1692 H401 *d45-01dG5chim- donor45- SOSIP, R6, BG505 v1v2-WITO-degly4- 01dG5/WITO- 664, chimera, S199A/I201C/S364A V1v2/BG505 S199A/I201C/ V1V2 chimera, glycan chimera S364A/A433C shielding at residues 504, 667 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTaVCTQACPKISFEPIPIHYCAPAGFAI LKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNE TVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNE TIAFNQaSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQII NMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVV KIEPLGVAPTRCKRRWGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQS NLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRN LSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1693 H402 *d45-01dG5chim-v1v2- donor45-01dG5/ SOSIP, R6, 664, BG505 ZM233-l201C/A433C ZM233- I201C/A433C chimera, V1V2/BG505 V1V2 chimera, chimera glycan shielding at residues 504, 668 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQsS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1694 H403 *d45-01dGSchim- donor45- SOSIP, R6, BG505 v1v2-ZM233-degly3- 01dG5/ZM233- 664, chimera, I201C/S364A/A433C V1V2/BG505 I201C/ V1V2 chimera, chimera S364A/A433C glycan shielding at residues 504, 669 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQaS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1695 H404 *d45-01dG5chim- donor45- SOSIP, R6, BG505 v1v2-ZM233-degly4- 01dG5/ZM233- 664, chimera, S199A/201C/ V1v2/BG505 S199A/201C/ V1V2 chimera, S364A/A433C chimera S364A/A4330 glycan shielding at residues 504, 670 AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTaVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQaS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1696 H405 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap KER2018.11, DS_THS_ chimera 664; gly504-661 v1v2-KER2018.11- R6; 201C/D368R/433C/R504T/ 201C, V506T/L661N/L663T D368R, 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCINANVTNSSMTNSSMMEGEIKNCSYNMTT ELRDKKRKVFSLFYKLDVVPMNENNSEYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAILKC NNKTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVE IECIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIRF AQHSGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIR GEIKCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKRn VtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLK LTVWGIKQL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWD KEISNYTQIIYGLLEESQNQQEKNEQDLNATD 1697 H406 *ZM106.9-chim_ ZM106.9/BG505 V1V2 V1V2 Swap CH070.1, DS_ chimera SOSIP; gly504-661 THS_v1v2-CH070.1- 664; 201C/D368R/433C/ R6; R504T/V506T/L661N/ 201C, L663T D368R, 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLKCKDVSINNGNVSSSNGSTSHNNSSIDNETL NEGMKEMKNCSFVATTVLRDKKQKVHALFYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAIL KCNNKTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKS VEIECIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTI RFAQHSGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPP IRGEIKCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCK RnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHL LKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQ WDKEISNYTQIIYGLLEESQNQQEKNEQDLNATD 1698 H407 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap ZM233.6, DS_THS_ chimera 664; gly504-661 v1v2-ZM233.6- R6; 201C/D368R/433C/R504T/ 201C, D368R, V506T/L661N/L663T 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAILKCNNKTF SGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVEIECIR PGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIRFAQHSG GRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIRGEIKC TSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKnvtGRRR RRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGI KQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNY TQIIYGLLEESQNQQEKNEQDLNATD 1699 H408 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap Q23, DS_THS_ chimera 664; gly504-661 v1v2-Q23- R6; 201C/D368R/433C/V506T/ 201C, R504T/L661N/L663T D368R, 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLHG'NVTSVNTTGDREGLKNCSFNMTTELRDK RQKVYSLFYRLDIYPINENQGSEYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAILKCNNKT FSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVEIECIR PGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIRFAQHSG GRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIRGEIKC TSNrTGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRR RRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQaHLLKLTVWG IKQLQARVLAVERYLRDQQLLGIWGCSGKLICaNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNY TQIIYGLLEESaNQQEKNEQDLNATD 1700 H409 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap A244, DS_ chimera 664; gly504-661 THS_ v1v2-A244- R6; 201C/D368R/433C/ 201C, R504T/V506T/L661N/ D368R, 433C, L663T glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNANLTKANLTNVNNRTNVSNIIGNITDE VRNCSFNMTTELRDKKQKVHALFYKLDIVPIEDNNDNSKYRLISCNTSTCTQACPKVSFDPIPIH YCAPAGYAILKCNNKTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNA KTIIVHLNKSVEIECIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSE KLKEYFNKTIRFAQHSGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQ GVGRCMYAPPIRGEIKCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIE PLGVAPTRCKRnvtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNL LRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLS EIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLNATD 1701 H410 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap WHO, gly504-661 DS_ chimera 664; THS_ v1v2-WITO- R6; 201C/D368R/433C/ 201C, R504T/V506T/L661N/ 368R, L663T 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAI LKCNNKTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKS VEIECIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTI RFAQHSGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPP IRGEIKCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCK RnvtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHL LKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCNVPWNSSWSNRNLSEIWDNMTWLQW DKEISNYTQIIYGLLEESQNQQEKNEQDLNATD 1702 H411 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap DS_THS_ chimera 664; CAP256-SU, v1v2-Cap256- R6; gly504-661 SU-201C/ 201C, D368R, 433C, D368R/433C/R504T/ glycan504, V506T/L661N/L663T glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCSDAKVNINATYNGTREEIKNCSFNATTEL RDKKKKEYALFYRLDIVPLNKEGNNNSEYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAILK CNNKTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSV EIECIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIR FAQHSGGRLEVTTHSFNCRGE FFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIRGEIKCTSNITGLLLTRDGGN NNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRRRRRAVGIGAVFLGF LGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYL RDOQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQ QEKNEQDLNATD 1703 H412 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap T250.4, DS_THS_ chimera 664; gly504-661 v1v2-T250.4- R6; 201C/D368R/433C/R504T/ 201C,D368R, V506T/L661N/L663T 433C, glycan504, glycan661 AENLWVTVYYGVPVWKEAKTTLFCASDAKSYEREVHNVWATHACVPTDPDPQELVMANVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLDCQAFNSSSHTNSSIAMQEMKNCSFNVTTEL RDKKKKEYSFFYKTDIEQINKNGRQYRLISCNTSTCTQACPKVSFDPIPIHYCAPAGYAILKCNN KTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVEIEC IRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIRFAQH SGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIRGEI KCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtG RRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTV WGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEI SNYTQIIYGLLEESQNQQEKNEQDLNATD 1704 H413 *ZM106.9-chim_ ZM106.9/BG505 V1V2SOSIP; V1V2 Swap BB201.B42, DS_THS_ chimera 664; gly504-661 v1v2-BB201.B42- R6; 201C, 201C/D368R/433C/R504T/ D368R, 433C, V506T/L661N/L663T glycan504, glycan661 KTFSGKGPCSNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENLTDNAKTIIVHLNKSVEIE CIRPGNNTRKSIRLGPGQTFYATGDVIGDIRKAYCKINGSEWNETLTKVSEKLKEYFNKTIRFAQ HSGGRLEVTTHSFNCRGEFFYCNTSELFNSNATESNITLPCRIKQIINMWQGVGRCMYAPPIRGE IKCTSNITGLLLTRDGGNNNNSTEEIFRPEGGNMRDNWRSELYKYKVVKIEPLGVAPTRCKRnVt GRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLT VWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKE ISNYT0IIYGLLEESQNQQEKNEQDLNATD 1705 H414 *cap256-su-chim_ cap256-su SOSIP, R6, 664, 201C/433C ds_THS-Avi AENLWVTVYYGVPVWREAKTTLFCASDAKSYEKEVHNVWATHACVPTDPNPQELVLKNVTENFNM WKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCSDAKVNINATYNGTREEIKNCSFNATTEL RDKKKKEYALFYRLDVPLNKEGNNNSEYRLINCNTSVCTQACPKVTFDPIPIHYCAPAGYAILKC NNKTFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTDNVKTIIVHLNESVE INCTRPNNNTRKSIRIGPGQTFYATGDIIGDIR0AHCNSEIKWEKTLQRVSEKLREHFNKTIIFN QsSGGDLEITTHSFNCGGEFFYCNTSDLFFNKTFDETYSTGSNSTNSTITLPCRIKQIINMWQEV GRCMYASPIAGEITCKSNITGLLLTRDGGGNNSTEETFRPGGGNMRDNWRSELYKYKVVKIEPLG VAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRA PEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIW DNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1706 H415 *cap256-su-chim + cap256-su SOSIP, R6, 664, Interacting residues int_ 201C/433C between the gp41 ds_THS-Avi and gp120 AENLWVTVYYGVPVWKDAETTLFCASDAKSYEKEVHNVWATHACVPTDPNPQEIHLENVTENFNM WKNNMVEQMHTDIISLWDQSLKPCVKLTPLCVTLNCSDAKVNINATYNGTREEIKNCSFNATTEL RDKKKKEYALFYRLDIVPLNKEGNNNSEYRLINCNTSVCTQACPKVTFDPIPIHYCAPAGFAILK CNNKTFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTDNVKTIIVHLNESV EINCTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHCNISEIKWEKTLQRVSEKLREHFNKTII FNQsSGGDLEITTHSFNCGGEFFYCNTSDLFFNKTFDETYSTGSNSTNSTITLPCRIKQIINMWQ EVGRCMYASPIAGEITCKSNITGLLLTRDGGGNNSTEETFRPGGGNMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1707 H416 *426c-native_bg505- 426c/BG505 SOSIP; NCgp120 + gp41. chimera 664; SOSIP R6 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCS FDITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTLTQACPKVTFDPIPIHYC APAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLSDNAKI IIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLK EHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEV GKAIYAPPIKGNITCKSDITGLLLLRDGGNTTNNTEIFRPGGGDMRDNWRSELYKYKVVKIEPLG VAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRA PEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIW 1708 H417 *426c-del276-460_bg505- 426c/BG505 SOSIP; removal of glycan 276 NCgp120 + gp41. chimera 664; SOSIP R6 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCS FDITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTLTQACPKVTFDPIPIHYC APAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKI IIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLK EHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEV GKAIYAPPIKGNITCKSDITGLLLLRDGGNTaNNTEIFRPGGGDMRDNWRSELYKYKVVVKIEPLG VAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRA PEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIW DNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1709 H418 *426c-del276 bg505- 426c/BG505 SOSIP; removal of glycan 276 NCgp120 + gp41. chimera 664 SOSIP AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCS FDITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTLTQACPKVTFDPIPIHYC APAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKI IIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLK EHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEV GKAIYAPPIKGNITCKSDITGLLLLRDGGNTTNNTEIFRPGGGDMRDNWRSELYKYKVVKIEPLG VAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRA PEAQQHLLKLTVWGIKQL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIW DNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1710 H419 *426c-del276-460 DS 426c/BG505 SOSIP, R6, 664, removal of glycan 276 bg505- chimera 201C/433C and glycan 460 NCgp120 + gp41. SOSIP AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCSF DITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTCTQACPKVTFDPIPIHYCA PAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKIII VQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEH FPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGK CIYAPPIKGNITCKSDITGLLLLRDGGNTaNNTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVA PTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPE AQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDN MTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1711 H420 *426c-de1276 DS bg505- 426c/BG505 SOSIP, R6, removal of glycan 276 NCgp120 + gp41. chimera 664, SOSIP 201C/433C AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCNVNVTSNSTNVNSSSTDNTTLGEIKNCSFD ITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTCTQACPKVTFDPIPIHYCAP AGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKIIIV QLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHF PHKNISFQSSSGGDLEmHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIY APPIKGNITCKSDITGLLLLRDGGNTTNNTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTR CKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQ HLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTW LQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1712 H421 *426c-native DS bg505- 426c/BG505 SOSIP, R6, 664, NCgp120 + gp41. chimera 201C/433C SOSIP AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCSF DITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTCTQACPKVTFDPIPIHYCA PAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLSDNAKIII VQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEH FPHKNISFQSSSGGDLEmHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCI YAPPIKGNITCKSDITGLLLLRDGGNTTNNTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPT RCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQ QHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMT WLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD H422 *426c-d3GLY-SUstrC bg505- 426c/BG505 SOSIP; Introduction of cap256 NCgp120 + gp41. chimera 664; su strand c SOSIP R6 1713 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCSF natte1rdkkkKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTLTQACPKVTFDPIPIHYCA PAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKIII VQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEH FPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGK AIYAPP1KGNITCKSDITGLLLLRDGGNTaNNaEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAP TRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEA QQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNM TWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD H423 *426c-d3GLY- 426c/BG505 SOSIP, R6, 664, Introduction of cap256 SUstrC_DS bg505- chimera 201C/433C su strand c NCgp120 + gp41. SOSIP 1714 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVNVTSNSTNVNSSSTDNTTLGEIKNCSF nattelrdkkkKEYALFYRLDIVPLDNSSNPNSSNTYRLINCNTSTCTQACPKVTFDPIPIHYCA PAGYAILKCNNKTFNGKGPCNNVSWQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLaDNAKIIIV QLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHF PHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKC IYAPPIKGNITCKSDITGLLLLRDGGNTaNNaEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAP TRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEA QQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNM TWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD H424 *703010505.TF-chim_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C d7324, R6, 664, chimera 1201C/A433C 1715 AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVLKNVTENFNM WKNDMVDQMHEDVISLWDQSLKPCVKLTPLCmNCTNATASNSSIIEGMKNCSFNITTELRDKREK KNALFYKLDIVQLDGNSSQYRLINCNTSVITQACPKVSFDPIPIHYCAPAGYAILKCNNKTFTGT GPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENITNNVKTIIVHLNESVKIECTRPNNK TRTSIRIGPGQAFYATGQVIGDIREAYCNINESKWNETLQRVSKKLKEYFPHKNITFQPSSGGDL EITTHSFNCGGEFFYCNTSSLFNRTYMANSTDMANSTETNSTRTITIHCRIKQIINMWQEVGRAM YAPPIAGNITCISNITGLLLTRDGGKNNTETFRPGGGNMKDNWRSELYKYKVVKIEPLGVAPTRC KRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQH LLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWL QWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1716 H425 703010505.TF-chim + int_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C interface mutations d7324, R6, 664, chimera I201C/A433C 1717 H426 703010505.TF_cl- 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C small-sel_d7324, chimera R6, 664, I201C/A433C 1718 H427 703010505.TF_cl1- 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C 2_d7324, R6, 664, chimera I201C/A433C 1719 H428 703010505.TF_cll_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C d7324, R6, 664, chimera I201C/A433C 1720 H429 703010505.TF-chim_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C trimer association d7324_tad, R6, 664, chimera domain mutations I201C/A433C/E47D/ K49E/V65K/E106T/ E429R/R432Q/ E500R 1721 H430 703010505.TF_cl- 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C trimer association small-sel_d7324_ chimera domain mutations tad, R6, 664, I201C/A433C/E47D/ K49E/V65K/E106T/ E429R/R432 Q/E500R 1722 H431 703010505.TF_cll-2_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C trimer association d7324_tad, R6, 664, chimera domain mutations I201C/A433C/E47D/K49E/ V65K/E106T/E429R/ R432Q/E500R 1723 H432 703010505.TF_cll_ 703010505.TF/ SOSIP, R6, 664 I201C/A433C trimer association d7324_tad, R6, 664, BG505 domain mutations chimera I201C/A433C/E47D/K49E/ V65K/E106T/E429R/R432 Q/E500R 1724 H433 703010505.TF-chim + int_ 703010505.TF/BG505 SOSIP, R6, 664 I201C/A433C interface mutations, d7324_tad, R6, 664, chimera trimer I201C/A433C/E47D/K49E/ association domain V65K/E106T/E429R/R432Q/ mutations E500R 1725 H434 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, DS E168K, BG505 gp41 chim, I201C, I201C, A433C, A433C, 1726 H435 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, E168K, BG505 gp41 chim, + interface +int I201C, A433C, residues, I201C, A433C, 1727 H436 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , V2 from BG505 E168K, BG505 gp41 chim, I201C, I201C, A433C, v2 A433C, _BG505 V2 (residues 154-205), 1728 H437 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , V1, 191-205 from BG505 E168K, BG505 gp41 chim, I201C, I201C, A433C, vl 191-205 A433C, _BG505 VI (residues 119-153), 191-205 1729 H438 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , V1 from BG505 E168K, BG505 gp41 chim, + interface +int I201C, A433C, v1 residues, I201C, A433C,_BG505 V1 (residues 119-153), 1730 H439 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , 166-173 from BG505 E168K, BG505 gp41 chim, I201C, I201C, A433C, strC A433C, _strC 1731 H440 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , 166-173 from BG505 E168K, BG505 gp41 chim, + interface +int I201C, A433C, strC residues, I201C, A433C, _strC 1732 H441 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, V2, V3 from BG505 E168K, BG505 gp41 chim, I201C, I201C, A433C,_v2_v3 A433C, _BG505 V2 (residues 154-205), _BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNMW KNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGELKNCSFNMTTE LRDKKQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKISFEPIPIHYCAPA GFAILKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIV QLKESVEINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQ FENKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQ IINMWQEVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYK VVKIEPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQ QQSNLLRAPEAQQHLLKLTVWGIKQL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWS NRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1733 H442 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, 191-205, 166-173 E168K, BG505 gp41 chim, _BG505 V1 from BG505 I201C, A433C, _v1_strC_191-205 (residues 119-153), _strC_191-205 1734 H443 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, , + interface V1, 166-173 from BG505 E168K, BG505 gp41 chim, residues, I201C, +int I201C, A433C, _v1_strC A433C, _BG505 V1 (residues 119-153), strC 1735 H444 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V3 from BG505 E168K, BG505 gp41 chim, _BG505 V3 I201C, A433C, v3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNMWK NNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNITTSIR DKVQKEYALFYKLDVVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKTF NGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTRPN NNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSGGDP EIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCMYAPPIR GQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRVVG RRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWG IKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNM TWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1736 H445 *JRFLgp140.6R. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface 166-173, SOSIP.664. residue set A, I201C, V3 from BG505 E168K, BG505 A433C, _strC_ gp41 chim, BG505 V3 (residues 296- +int I201C, 331), A433C, _strC_v3 AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNIT TSIRDKKQKVYALFYKLDVVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILK CNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESV EINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTI VFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQ EVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1737 H446 JRFLgp140.6R. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V2 from BG505 SOSIP.664. residues, I201C, E168K, BG505 A433C, BG505 gp41 chim, V2 (residues 154-205), +int I201C, A433C, v2 1738 H447 *JRFLgp140.6R. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface 191-205, SOSIP.664. residue set A, I201C, V3 from BG505 E168K, BG505 gp41 chim, A433C, _191-205_BG505 V3 +int I201C, (residues 296-331), A433C, _191-205_v3 AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNMW KNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNITTS IRDKVQKEYALFYKLDVVPIDNNNTSYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAILKCND KTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINC TRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHS SGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCM YAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTR CKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQH LLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNM TWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1739 H448 *JRFLgp140.6R. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, V3 from BG505 SOSIP.664. residue set A, I201C, E168K, BG505 A433C, _BG505 V1 gp41 chim, (residues 119-153), +int BG505 V3 I201C, A433C, _v1_v3 (residues 296-331), AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGEIKNCSFNITTSIRDK VQKEYALFYKLDVVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKTF NGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCM YAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPT RCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQ QHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMT WLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1740 H449 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, 166-173, V3 E168K, BG505 gp41 chim, _strC_BG505 V3 from BG505 I201C, A433C, _strC_v3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNM WKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNIT TSIRDKKQKVYALFYKLDVVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILK CNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESV EINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTI VFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQ EVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1741 H450 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V3 from BG505 E168K, BG505 gp41 chim, residue Hnt I201C, A433C, _v3 set A, I201C, A433C, _BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNIT TSIRDKVQKEYALFYKLDVVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILK CNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESV EINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTI VFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQ EVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1742 H451 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V2, V3 from BG505 E168K, BG505 gp41 chim, residue +int I201C, set A, I201C, A433C, _v2_v3 A433C, _BG505 V2 (residues 154-205), BG505 V3 (residues 296-331) AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGELKNCSFNMT TELRDKKQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKISFEPIPIHYCA PAGFAILKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTI IVQLKESVEINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLR EQFENKTIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRI KQIINMWQEVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYK YKVVKIEPLGVAPTRCKRRWGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIV QQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSW SNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1743 H452 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, v1, 166-173, 191-205, E168K, BG505 gp41 chim, _BG505 V1 V3 from I201C, A433C, _v1_ (residues 119-153), BG505 strC_191-205_v3 _strC_191- 205 BG505 V3 (residues 296-331), 1744 H453 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface v1, 166-173, V3 E168K, BG505 gp41 chim, residue set A, I201C, from BG505 +int I201C, A433C, _v1_strC_v3 A433C, _BG505 V1 (residues 119-153), strC BG505V3 (residues 296-331) AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGEIKNCSFNITTSIRDK KQKVYALFYKLDWPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKTFN GKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTRP NNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSG GDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCMY APPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTR CKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQ HLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTW LQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1745 H454 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, 191-205 from BG505 E168K, BG505 gp41 chim, _191-205 I201C, A433C, 191-205 1746 H455 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface 191-205 from BG505 E168K, BG505 gp41 chim, residues, I201C, +int I201C, A433C, 191-205 A433C, 191-205 1747 H456 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, V2 from BG505 E168K, BG505 gp41 chim, _BG505 V1 I201C, A433C, _v1_v2 (residues 119-153), _BG505 V2 (residues 154-205), 1748 H457 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1 from BG505 E168K, BG505 gp41 chim, _BG505 V1 I201C, A433C, vl (residues 119-153), 1749 H458 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, 191-205 from BG505 E168K, BG505 gp41 chim, residue set A, I201C, +int I201C, A433C, _ A433C, _BG505 V1 v1_191-205 (residues 119-153), 191-205 1750 H459 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, 166-173, 191-205 from BG505 E168K, BG505 gp41 chim, _strC_191-205 I201C, A433C, _strC_191-205 1751 H460 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface 166-173, 191-205 from BG505 E168K, BG505 gp41 chim. residue set A, I201C, +int I201C, A433C, A433C, strC 191-205 StrC 191-205 1752 H461 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168KJ201C, A433C, V1, V2, V3 from BG505 E168K, BG505 gp41 chim, _BG505 V1 (residues I201C, A433C, _v1_v2_v3 119-153), _BG505 V2 (residues 154-205), BG505 V3 (residues 296-331) AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNM WKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGELKNCSFNMTTELRDK KQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAI LKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKE SVEINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENK TIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINM WQEVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKI EPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSN LLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNL SEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1753 H462 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, 166-173 from BG505 E168K, BG505 gp41 chim, _BG505 V1 (residues I201C, A433C, vl strC 119-153), strC 1754 H463 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, 166-173, 191-205 from BG505 E168K, BG505 gp41 chim, residue set A, I201C, +int I201C, A433C, _BG505 V1 A433C, _v1_strC_191-205 (residues 119-153), strC 191-205 1755 H464 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168KJ201C, A433C, 166-173, 191-205, E168K, BG505 gp41 chim, _strC_191-205 BG505 V3 V3 from BG505 I201C, A433C, (residues 296-331), StrC 191-205 v3 1756 H465 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, 191-205, V3 from BG505 E168K, BG505 gp41 chim, _BG505 V1 (residues I201C, A433C, _v1_191-205_v3 119-153), _191-205_BG505 V3 (residues 296-331), 1757 H466 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, V2 from BG505 E168K, BG505 gp41 chim, residues, I201C, +int I201C, A433C, _v1_v2 A433C, _BG505 V1 (residues 119-153), BG505 V2 (residues 154-205), 1758 H467 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, V3 from BG505 E168K, BG505 gp41 chim, _BG505 V1 (residues I201C, A433C, _v1_v3 119-153), _BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNM WKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGEIKNCSFNITTSIRDK VQKEYALFYKLDWVPIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKTF NGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCM YAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPT RCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQ QHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMT WLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1759 H468 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, 191-205, V3 from BG505 E168K, BG505 gp41 chim, residues, I201C, +int I201C, A433C, A433C, _BG505 V1 _v1_191-205_v3 (residues 119-153), 191-205 BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGEIKNCSFNITTSIRDK VQKEYALFYKLDVVPIDNNNTSYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAILKCNDKTF NGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCM YAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPT RCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQ QHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMT WLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1760 H469 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168KJ201C, A433C, 191-205, V3 from BG505 E168K, BG505 gp41 chim, _191-205_BG505 V3 I201C, A433C, _191-205_v3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNM WKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNIT TSIRDKVQKEYALFYKLDVVPIDNNNTSYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAILK CNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESV EINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCVISRAKWNDTLKQIVIKLREQFENKTI VFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQ EVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1761 H470 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface 166-173, 191-205, V3 from BG505 E168K, BG505 gp41 chim, residues, I201C, +int I201C, A433C, _strC_191- A433C, _strC_191-205_v3 205_BG505 V3 +residues 296-331), AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLNCKDVNATNTTNDSEGTMERGEIKNCSFNIT TSIRDKKQKVYALFYKLDVVPIDNNNTSYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAILK CNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESV EINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCVISRAKWNDTLKQIVIKLREQFENKTI VFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQ EVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1762 4471 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + interface V1, V2, V3 E168K, BG505 gp41 chim, residues, I201C, from BG505 +int I201C, A433C, _BG505 V1 A433C, _v1_v2_v3 (residues 119-153), _BG505 V2 (residues 154-205), _BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKDAETTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEIHLENVTEHFNM WKNNMVEQMQTDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGELKNCSFNMTTELRDK KQKVYSLFYRLDVVQINENQGNRSNNSNKEYRLINCNTSAITQACPKISFEPIPIHYCAPAGFAI LKCNDKTFNGKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKE SVEINCTRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENK TIVFNHSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINM WQEVGKCMYAPPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKI EPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSN LLRAPEAQQHLLKLTVWGIKQL0ARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNL SEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1763 H472 *JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, I201C, A433C, V1, 166-173, V3 from BG505 E168K, BG505 gp41 chim, _BG505 V1 I201C, A433C, _v1_strC_v3 (residues 119-153), _strC_BG505 V3 (residues 296-331), AENLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTEHFNM WKNNMVEQMQEDIISLWDQSLKPCVKLTPLCVTLQCTNVTNNITDDMRGEIKNCSFNITTSIRDK KQKVYALFYKLDWVIDNNNTSYRLISCDTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKTFN GKGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFTNNAKTIIVQLKESVEINCTRP NNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISRAKWNDTLKQIVIKLREQFENKTIVFNHSSG GDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNNTEGSNNTEGNTITLPCRIKQIINMWQEVGKCMY APPIRGQIRCSSNITGLLLTRDGGINENGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTR CKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQ HLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTW LQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD 1764 H473 JRFLgp140.6R.SOSIP.664. JRFL/BG505 chim SOSIP, R6, 664 E168K, + v1, 166-173, E168K, BG505 gp41 chim, interface residues, 191-205, V3 from +int I201C, A433C, I201C, BG505 _v1_strC_191-205_v3 A433C, _BG505 V1 (residues 119-153), _strC_191-205_ BG505 V3 (residues 296-331), 1765 T030 TH966.8-chim_ TH966.8/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1766 T031 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1767 T032 R2184.c4-chim_ R2184.c4/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1768 T033 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1769 T034 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1770 T035 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1771 T036 R2184.c4-chim_ R2184.c4/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1772 T037 CNE55-chim_ CNE55/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1773 T038 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1774 T039 DU422.01-chim_ U422.01/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1775 T040 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1776 T041 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1777 T042 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1778 T043 rH966.8-chim_ rH966.8/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1779 T044 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1780 T045 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1781 T046 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1782 T047 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1783 T048 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1784 T049 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1785 T050 ZM106.9-chim_ ZM106.9/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1786 T051 AC10.29-chim_ AC10.29/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1787 T052 CH038.12-chim_ CH038.12/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1788 T053 FRO.11-chim_ FRO.11/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1789 T054 QH209.14M.A2-chim_ QH209.14M.A2/BG505 SOS-DS-10ln-HATM SOS -DS-10ln-HATM chimera 1790 T055 6545.V4.C1-chim_ 5545.V4.C1/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1791 T056 KER2018.11-chim_ KER2018.11/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1792 T057 MB201.A1-chim_ MB201.A1/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1793 T058 BI369.9A-chim_ BI369.9A/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1794 T059 CNE55-chim_ CNE55/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1795 T060 FH966.8-chim_ TH966.8/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1796 T061 R2184.c4-chim_ 32184.C4/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1797 T062 DU422.01-chim_ U422.01/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1798 T063 16055-2.3-chim_ 16055-2.3/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1799 T064 ZM55.28a-chim_ ZM55.28a/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1800 T065 CH117.4-chim_ CH117.4/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1801 T066 CNE58-chim_ CNE58/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1802 T067 ZM53.12-chim_ ZM53.12/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1803 T068 ZM197.7-chim_ ZM197.7/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1804 T069 25925-2.22-chim_ 25925-2.22/BG505 SOS-DS-10ln-HATM SOS chimera -DS-10ln-HATM 1805 T070 ZM106.9-chim_ ZM106.9/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1806 T071 AC10.29-chim_ AC10.29/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1807 T072 CH038.12-chim_ CH038.12/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1808 T073 TRO.11-chim_ TRO.11/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1809 T074 QH209.14M.A2-chim_ QH209.14M.A2/BG505 SOS-DS-MPER-TM SOS -DS-MPER-TM chimera 1810 T075 6545.V4.C1-chim_ 5545.V4.C1/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1811 T076 KER2018.11-chim_ KER2018.11/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1812 T077 MB201.A1-chim_ MB201.A1/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1813 T078 BI369.9A-chim_ BI369.9A/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1814 T079 CNE55-chim_ CNE55/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1815 T056 rH966.8-chim_ FH966.8/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1816 T081 R2184.c4-chim_ 32184.C4/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1817 T082 DU422.01-chim_ U422.01/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1818 T083 16055-2.3-chim_ 16055-2.3/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1819 T084 ZM55.28a-chim_ ZM55.28a/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1820 T085 CH117.4-chim_ CH117.4/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1821 T056 CNE58-chim_ CNE58/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1822 T087 ZM53.12-chim_ ZM53.12/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1823 T088 ZM197.7-chim_ ZM197.7/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1824 T089 25925-2.22-chim_ 25925-2.22/BG505 SOS-DS-MPER-TM SOS chimera -DS-MPER-TM 1825 T090 ZM106.9-chim_ ZM106.9/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1826 T091 AC10.29-chim_ AC10.29/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1827 T092 CH038.12-chim_ CH038.12/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1828 T093 FRO.11-chim_ FRO.11/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1829 T094 QH209.14M.A2-chim_ QH209.14M.A2/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1830 T095 6545.V4.C1-chim_ 5545.V4.C1/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1831 T096 KER2018.11-chim_ KER2018.11/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1832 T097 MB201.A1-chim_ MB201.A1/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1833 T098 BI369.9A-chim_ BI369.9A/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1834 T099 CNE55-chim_ CNE55/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1835 T100 FH966.8-chim_ FH966.8/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1836 T101 R2184.c4-chim_ 32184.C4/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1837 T102 DU422.01-chim_ U422.01/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1838 T103 16055-2.3-chim_ 16055-2.3/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1839 T104 ZM55.28a-chim_ ZM55.28a/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1840 T105 CH117.4-chim_ CH117.4/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1841 T106 CNE58-chim_ CNE58/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1842 T107 ZM53.12-chim_ ZM53.12/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1843 T108 ZM197.7-chim_ ZM197.7/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1844 T109 25925-2.22-chim_ 25925-2.22/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 1845 T110 AC10.29-chim_ AC10.29/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1846 T111 CH038.12-chim_ CH038.12/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1847 T112 FRO.11-chim_ FRO.11/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1848 T113 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc10ln-IP-10ln-HATM sc10ln-IP -10ln-HATM chimera 1849 T114 KER2018.11-chim_ KER2018.11/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1850 T115 MB201.A1-chim_ MB201.A1/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1851 Tu6 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1852 T117 CH117.4-chim_ CH117.4/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1853 T115 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM sc10ln-IP chimera -10ln-HATM 1854 T119 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1855 T120 AC10.29-chim_ AC10.29/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1856 T121 CH038.12-chim_ CH038.12/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1857 T122 FRO.11-chim_ FRO.11/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1858 T123 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1859 T124 KER2018.11-chim_ KER2018.11/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1860 T125 MB201.A1-chim_ MB201.A1/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1861 T126 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1862 T127 CNE55-chim_ CNE55/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1863 T128 DU422.01-chim_ U422.01/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1864 T129 CH117.4-chim_ CH117.4/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1865 T130 CNE58-chim_ CNE58/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1866 T131 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-MPER-TM sc10ln-IP chimera -MPER-TM 1867 T132 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1868 T133 AC10.29-chim_ AC10.29/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1869 T134 CH038.12-chim_ CH038.12/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1870 T135 FRO.11-chim_ FRO.11/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1871 T136 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP -MPER-TM-cyto chimera 1872 T137 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1873 T138 KER2018.11-chim_ KER2018.11/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1874 T139 MB201.A1-chim_ MB201.A1/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1875 T140 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1876 T141 CNE55-chim_ CNE55/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1877 T142 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1878 T143 R2184.c4-chim_ 32184.C4/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1879 T144 DU422.01-chim_ U422.01/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1880 T145 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1881 T146 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1882 T147 CH117.4-chim_ CH117.4/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1883 T148 CNE58-chim_ CNE58/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1884 T149 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1885 T150 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1886 T151 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-MPER-TM-cyto sc10ln-IP chimera -MPER-TM-cyto 1887 T152 ZM106.9-chim_ ZM106.9/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1888 T153 AC10.29-chim_ AC10.29/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1889 T154 CH038.12-chim_ CH038.12/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1890 T155 FRO.11-chim_ FRO.11/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1891 T156 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1892 T157 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1893 T158 KER2018.11-chim_ KER2018.11/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1894 T159 MB201.A1-chim_ MB201.A1/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1895 T160 BI369.9A-chim_ BI369.9A/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1896 T161 CNE55-chim_ CNE55/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1897 T162 TH966.8-chim_ FH966.8/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1898 T163 R2184.c4-chim_ 32184.C4/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1899 T164 DU422.01-chim_ U422.01/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1900 T165 16055-2.3-chim_ 16055-2.3/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1901 T166 CH117.4-chim_ CH117.4/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1902 T167 CNE58-chim_ CNE58/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1903 T168 ZM53.12-chim_ ZM53.12/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1904 T169 ZM197.7-chim_ ZM197.7/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1905 T170 25925-2.22-chim_ 25925-2.22/BG505 sc15ln-SOS-DS-10ln-HATM sc15ln-SOS chimera -DS-10ln-HATM 1906 T171 ZM106.9-chim_ ZM106.9/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1907 T172 AC10.29-chim_ AC10.29/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1908 T173 CH038.12-chim_ CH038.12/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1909 T174 TRO.11-chim_ FRO.11/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1910 T175 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1911 T176 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1912 T177 KER2018.11-chim_ KER2018.11/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1913 T178 MB201.A1-chim_ MB201.A1/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1914 T179 BI369.9A-chim_ BI369.9A/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1915 T180 CNE55-chim_ CNE55/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1916 T181 FH966.8-chim_ FH966.8/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1917 T182 sd5ln-SOS 12184.C4/BG505 sc15ln-SOS-DS-MPER-TM -DS-MPER-TM chimera 1918 T183 DU422.01-chim_ U422.01/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1919 T184 16055-2.3-chim_ 16055-2.3/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1920 T185 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1921 T186 CH117.4-chim_ CH117.4/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1922 T187 CNE58-chim_ CNE58/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1923 T188 ZM53.12-chim_ ZM53.12/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1924 T189 ZM197.7-chim_ ZM197.7/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1925 T190 25925-2.22-chim_ 25925-2.22/BG505 sc15ln-SOS-DS-MPER-TM sc15ln-SOS chimera -DS-MPER-TM 1926 T191 ZM106.9-chim_ ZM106.9/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1927 T192 AC10.29-chim_ AC10.29/8G505 chimera sc15ln-SOS-DS-MPER-TM- sc15ln-SOS cyto -DS-MPER-TM-cyto 1928 T193 CH038.12-chim_ CH038.12/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1929 T194 TRO.11-chim_ TRO.11/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1930 T195 QH209.14M.A2-chim_ QH209.14M.A2/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1931 T196 6545.V4.C1-chim_ 6545.V4.C1/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1932 T197 KER2018.11-chim_ KER2018.11/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1933 T198 MB201.A1-chim_ MB201.A1/8G505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1934 T199 BI369.9A-chim_ BI369.9A/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1935 T200 CNE55-chim_ CNE55/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1936 T201 FH966.8-chim_ FH966.8/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1937 T202 R2184.c4-chim_ 32184.C4/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1938 T203 DU422.01-chim_ U422.01/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1939 T204 16055-2.3-chim_ 16055-2.3/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1940 T205 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1941 T206 CH117.4-chim_ CH117.4/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1942 T207 CNE58-chim_ CNE58/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1943 T208 ZM53.12-chim_ ZM53.12/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1944 T209 ZM197.7-chim_ ZM197.7/BG505 sc15ln-SOS-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1945 T210 25925-2.22-chim_ 25925-2.22/BG505 sc15ln-S0S-DS-MPER-TM- sc15ln-SOS chimera cyto -DS-MPER-TM-cyto 1946 T211 ZM106.9-chim_ ZM106.9/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1947 T212 AC10.29-chim_ AC10.29/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1948 T213 CH038.12-chim_ CH038.12/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1949 T214 FRO.11-chim_ FRO.11/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1950 T215 QH209.14M.A2-chim_ QH209.14M.A2/BG505 IP-DS-10ln-HATM IP -DS-10ln-HATM chimera 1951 T216 6545.V4.C1-chim_ 5545.V4.C1/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1952 T217 KER2018.11-chim_ KER2018.11/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1953 T218 MB201.A1-chim_ MB201.A1/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1954 T219 BI369.9A-chim_ BI369.9A/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1955 T220 CNE55-chim_ CNE55/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1956 T221 FH966.8-chim_ TH966.8/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1957 T222 R2184.c4-chim_ 32184.c4/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1958 T223 DU422.01-chim_ U422.01/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1959 T224 16055-2.3-chim_ 16055-2.3/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1960 T225 ZM55.28a-chim_ ZM55.28a/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1961 T226 CH117.4-chim_ CH117.4/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1962 T227 CNE58-chim_ CNE58/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1963 T228 ZM53.12-chim_ ZM53.12/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1964 T229 ZM197.7-chim_ ZM197.7/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1965 T230 25925-2.22-chim_ 25925-2.22/BG505 IP-DS-10ln-HATM IP chimera -DS-10ln-HATM 1966 T231 ZM106.9-chim_ ZM106.9/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1967 T232 AC10.29-chim_ AC10.29/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1968 T233 CH038.12-chim_ CH038.12/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1969 T234 TRO.11-chim_ FRO.11/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1970 T235 QH209.14M.A2-chim_ QH209.14M.A2/BG505 IP-DS-MPER-TM IP -DS-MPER-TM chimera 1971 T236 6545.V4.C1-chim_ 5545.V4.C1/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1972 T237 KER2018.11-chim_ KER2018.11/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1973 T238 MB201.A1-chim_ MB201.A1/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1974 T239 BI369.9A-chim_ BI369.9A/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1975 T240 CNE55-chim_ CNE55/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1976 T241 FH966.8-chim_ rH966.8/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1977 T242 R2184.c4-chim_ 32184.c4/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1978 T243 DU422.01-chim_ U422.01/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1979 T244 16055-2.3-chim_ 16055-2.3/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1980 T245 ZM55.28a-chim_ ZM55.28a/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1981 T246 CH117.4-chim_ CH117.4/BG505 IP-DS-MPER-TM IP chimera -DS-MPER-TM 1982 T247 CNE58-chim_ CNE58/BG505 P-DS-MPER-TM IP chimera -DS-MPER-TM 1983 T248 ZM53.12-chim_ ZM53.12/BG505 P-DS-MPER-TM IP chimera -DS-MPER-TM 1984 T249 ZM197.7-chim_ ZM197.7/BG505 P-DS-MPER-TM IP chimera -DS-MPER-TM 1985 T250 25925-2.22-chim_ 25925-2.22/BG505 P-DS-MPER-TM IP chimera -DS-MPER-TM 1986 T251 ZM106.9-chim_ ZM106.9/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1987 T252 AC10.29-chim_ AC10.29/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1988 T253 CH038.12-chim_ CH038.12/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1989 T254 FRO.11-chim_ FRO.11/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1990 T255 QH209.14M.A2-chim_ QH209.14M.A2/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1991 T256 6545.V4.C1-chim_ 5545.V4.C1/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1992 T257 KER2018.11-chim_ KER2018.11/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1993 T258 MB201.A1-chim_ MB201.A1/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1994 T259 BI369.9A-chim_ BI369.9A/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1995 T260 CNE55-chim_ CNE55/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1996 T261 rH966.8-chim_ TH966.8/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1997 T262 R2184.c4-chim_ 32184.c4/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1998 T263 DU422.01-chim_ U422.01/BG505 P-DS-MPER-TM-cyto IP chimera -DS-MPER-TM-cyto 1999 T264 16055-2.3-chim_ 16055-2.3/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2000 T265 ZM55.28a-chim_ ZM55.28a/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2001 T266 CH117.4-chim_ CH117.4/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2002 T267 CNE58-chim_ CNE58/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2003 T268 ZM53.12-chim_ ZM53.12/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2004 T269 ZM197.7-chim_ ZM197.7/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2005 T270 25925-2.22-chim_ 25925-2.22/BG505 SOS-DS-MPER-TM-cyto SOS chimera -DS-MPER-TM-cyto 2006 T271 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic domain cleavage site domain and I559P mutation 2007 T272 6545.V4.C1-chim_ 6545.V4.C1/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full- cytoplasmic domain cleavage site cytoplasmic domain and I559P mutation 2008 T273 R2184.c4-chim_ R2184.C4/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2009 T274 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2010 T275 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2011 T276 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2012 T277 CNE55-chim_ CNE55/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2013 T278 DU422.01-chim_ DU422.01/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full- cytoplasmic cleavage site cytoplasmic domain domain and I559P mutation 2014 T279 25925-2.22-chim_ 25925-2.22/BG505 $c10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full- cytoplasmic cleavage site cytoplasmic domain domain and I559P mutation 2015 T280 CNE58-chim_ CNE58/BG505 sc10ln-IP-MPER- single-chain amino sc1Oln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2016 T281 16055-2.3-chim_ 16055-2.3/BG505 SC10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full- cytoplasmic cleavage site cytoplasmic domain domain and I559P mutation 2017 T282 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full- cytoplasmic cleavage site cytoplasmic domain domain and I559P mutation 2018 T283 BI369.9A-chim_ BI369.9A/BG505 SC10ln-IP-MPER- single-chain amino sc10ln-IP chimera TM-full- acid replace -MPER-TM-full-cytoplasmic cytoplasmic cleavage site domain domain and I559P mutation 2019 T284 TH966.8-chim_ rH966.8/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2020 T285 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2021 T286 R2184.c4-chim_ 32184.c4/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2022 T287 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2023 T288 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2024 T289 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2025 T290 R2184.c4-chim_ 32184.C4/BG505 sc10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2026 T291 CNE55-chim_ CNE55/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2027 T292 6545.V4.C1-chim_ 5545.V4.C1/BG505 SC10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2028 T293 DU422.01-chim_ U422.01/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2029 T294 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2030 T295 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2031 T296 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p-IP chimera -10ln-HATM 2032 T297 rH966.8-chim_ TH966.8/BG505 SC10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2033 T298 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2034 T299 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2035 T300 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-10ln-HATM a433p sc10ln-a433p--IP chimera -10ln-HATM 2036 T301 ZM197.7-chim_ ZM197.7/BG505 SC10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2037 T302 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM a433p sc10ln-a433p-IP chimera -MPER-TM 2038 T303 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-10ln-HATM a433p sc15ln-SOS-a433p-10ln-HATM chimera 2039 T304 rH966.8-chim_ rH966.8/BG505 sc10ln-IP-10ln-HATM 173-177 mutated increase the sc10ln-IP chimera to YSLFE negative charge -10ln-HATM-173-yslfe-177 in the V2 region to stabilize V2 to V3 interactions 2040 T305 6545.V4.C1-chim_ 6545.V4.C1/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe- 177 2041 T306 R2184.c4-chim_ 32184.c4/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2042 T307 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2043 T308 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2044 T309 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2045 T310 R2184.c4-chim_ 32184.C4/BG505 SC10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2046 T311 CNE55-chim_ CNE55/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2047 T312 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2048 T313 DU422.01-chim_ U422.01/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2049 T314 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe- 177 2050 T315 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2051 T316 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2052 T317 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2053 T318 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2054 T319 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2055 T320 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-yslfe-177 2056 T321 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2057 T322 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM 173-177 mutated to YSLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-yslfe-177 2058 T323 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS-10ln-HATM 173-177 mutated to YSLFE Same as Seq_2039 sc15ln-SOS chimera -DS-10ln-HATM-173- yslfe-177 2059 T324 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2060 T325 6545.V4.C1-chim_ 6545.V4.C1/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe- 177 2061 T326 R2184.c4-chim_ 32184.C4/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2062 T327 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2063 T328 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2064 T329 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2065 T330 R2184.c4-chim_ 32184.C4/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2066 T331 CNE55-chim_ CNE55/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2067 T332 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2068 T333 DU422.01-chim_ U422.01/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2069 T334 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe- 177 2070 T335 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2071 T336 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2072 T337 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2073 T338 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2074 T339 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2075 T340 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfe-177 2076 T341 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2077 T342 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFE Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfe-177 2078 T343 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS- 173-177 mutated to ESLFE Same as Seq_2039 sc15ln-SOS chimera 10ln-HATM -DS-10ln-HATM-173- eslfe-177 2079 T344 FH966.8-chim_ TH966.8/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2080 T345 6545.V4.C1-chim_ 6545.V4.C1/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy- 177 2081 T346 R2184.c4-chim_ 32184.C4/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2082 T347 ZM197.7-chim_ ZM197.7/BG505 $c10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2083 T348 ZM106.9-chim_ ZM106.9/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2084 T349 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2085 T350 R2184.c4-chim_ 32184.c4/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2086 T351 CNE55-chim_ CNE55/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2087 T352 6545.V4.C1-chim_ 5545.V4.C1/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2088 T353 DU422.01-chim_ U422.01/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2089 T354 25925-2.22-chim_ 25925-2.22/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy- 177 2090 T355 CNE58-chim_ CNE58/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2091 T356 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2092 T357 FH966.8-chim_ FH966.8/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2093 T358 ZM55.28a-chim_ ZM55.28a/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2094 T359 ZM53.12-chim_ ZM53.12/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2095 T360 BI369.9A-chim_ BI369.9A/BG505 sc10ln-IP-10ln-HATM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -10ln-HATM-173-eslfy-177 2096 T361 ZM197.7-chim_ ZM197.7/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2097 T362 16055-2.3-chim_ 16055-2.3/BG505 sc10ln-IP-MPER-TM 173-177 mutated to ESLFY Same as Seq_2039 sc10ln-IP chimera -MPER-TM-173-eslfy-177 2098 T363 ZM55.28a-chim_ ZM55.28a/BG505 sc15ln-SOS-DS- 173-177 mutated to ESLFY Same as Seq_2039 sc15ln-SOS chimera 10ln-HATM -DS-10ln-HATM-173- eslfy-177 2099 z 35O22 VH 2100 z 35O22 VL 2101 z coat protein subunit 2102 z coat protein subunit 2103 z coat protein subunit 2104 z coat protein subunit 2105 z coat protein subunit 2106 z coat protein subunit 2107 z coat protein subunit 2108 z coat protein subunit 2109 z coat protein subunit 2110 z coat protein subunit 2111 z coat protein subunit 2112 z coat protein subunit 2113 z coat protein subunit 2114 0 F250-4 F250-4 2115 0 JRFL JRFL 2116 H474 F2504.SOSIP.6R.201C433C F2504.SOSIP.6R. 201C433C 2117 bg505.sosip cl5ln. 3g505.sosip_ 201C-433C cl5ln.201C- 433C 2118 soluble CD4(sCD4 soluble CD4(sCD4 2119 BG505.SOSIP.R6.664. BG505 DNA T332NJ201C/A433C (VRC4571) 2120 BG505 WT DNA 2121 H475 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap CAP256-SU SOSIP, T332N.D368R.V1V2.CAP256_ chimera 664; V1V2 swap, SU R6; 201-422 disulfide 201C, stabilization, D368R, 433C, cd4 binding site KO, T332N 2122 H476 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap BB201.B42 SOSIP, T332N.D368R.V1V2.BB201.B42 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, D368R, 433C, cd4 binding site KO, T332N 2123 H477 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap KER2018.11 SOSIP, T332N.D368R.V1V2. chimera 664; V1V2 swap, KER2018. R6; 201-422 disulfide 11 201C, stabilization, D368R, cd4 binding site KO, 433C, T332N 2124 H478 *BG505.SOSIP. BG505 V1V2SOSIP; V1V2 Swap CH070.1 SOSIP, R6.664. chimera 664; V1V2 swap, T332N.D368R. R6; 201-422 disulfide V1V2.CH070.1 201C, stabilization, D368R, 433C, cd4 binding site KO, T332N 2125 H479 *BG505.SOSIP. BG505 V1V2SOSIP; V1V2 Swap ZM233.6 SOSIP, R6.664. chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, T332N.D368R. D368R, 433C, cd4 binding site KO, V1V2.ZM233.6 T332N 2126 H480 *BG505.SOSIP. BG505 V1V2SOSIP; V1V2 Swap 023 SOSIP, R6.664. chimera 664; V1V2 swap, T332N.D368R.V1V2.Q23 R6; 201-422 disulfide 201C, stabilization, D368R, 433C, cd4 binding site KO, T332N 2127 H481 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap A244 SOSIP, T332N.D368R.V1V2.A244 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N cd4 binding site KO, 2128 H482 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap WHO SOSIP, T332N.D368R.V1V2.WITO chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N cd4 binding site KO, 2129 H483 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap T250.4 SOSIP, T332N.D368R.V1V2.T250.4 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N cd4 binding site KO, 2130 H484 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap CAP256-SU. SOSIP, T332N.D368R.V1V2.CAP256_ chimera 664; Week34.c1one77 V1V2 swap, SU.W34.77 R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N cd4 binding site KO, 2131 H485 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap CAP256-SU. SOSIP, T332N.D368R.V1V2.CAP256_ chimera 664; Week34.c1one80 V1V2 swap, SU.W34.80 R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N cd4 binding site KO, 2132 H486 *BG505.SOSIP.R6.664. BG505 V1V2SOSIP; V1V2 Swap CAP256-SU. SOSIP, T332N.D368R.V1V2.CAP256_ chimera 664; Week34.c1one81 V1V2 swap, SU.W34.781 R6; 201-422 disulfide 201C, stabilization, D368R, 433C, T332N on chimeric backbone 2133 H487 *CNE58.SOSIP.R6. CNE58/BG505 VIV2SOSIP; IV2 Swap CAP256-SU SOSIP, V1V2.CAP256_SU chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2134 H488 *CNE58.SOSIP.R6. CNE58/BG505 VIV2SOSIP; IV2 Swap BB201.B42 SOSIP, V1V2.BB201.B42 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2135 H489 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; VIV2 Swap KER2018.11 SOSIP, V1V2.KER2018.11 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2136 H490 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; VIV2 Swap CH070.1 SOSIP, V1V2.CH070.1 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2137 H491 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; VIV2 Swap ZM233.6 SOSIP, V1V2.ZM233.6 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2138 H492 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; VIV2 Swap 023 SOSIP, V1V2.Q23 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, 433C stabilization, on chimeric backbone 2139 H493 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; VIV2 Swap A244 SOSIP, V1V2.A244 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2140 H494 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; V1V2 Swap WHO SOSIP, V1V2.WITO chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2141 H495 *CNE58.SOSIP.R6. CNE58/BG505 V1V2SOSIP; V1V2 Swap T250.4 SOSIP, V1V2.T250.4 chimera 664; V1V2 swap, R6; 201-422 disulfide 201C, stabilization, 433C on chimeric backbone 2142 D 426c GenBank: KC769518.1, incorporated by reference herein as present in GenBank on Sep. 3, 2015 MDAMKRGLCCVLLLCGAVFVSPSASVGNLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWA THACVPTDPNPQEVVLENVTENFNMWKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVN VTSNSTNVNSSSTDNTTLGEIKNCSFDITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYR LINCNTSTLTQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVST QLLLNGSLAEEEIVIRSKNLSDNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDII GDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSG LFNDTISNATIMLPCRIKQIINMWQEVGKAIYAPPIKGNITCKSDITGLLLLRDGGNTTNNTEI FRPGGGDMRDNWRSELYKYKVVEIKPLGVAPTDAKSSVVESNKSAVGIGAVFLGFLGAAGSTMGA ASITLTVOARQLLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLKDQQLLGLWG CSGKLICTTAVPWNISWSNKSKEEIWENMTWMQWDREINNYTNTIYRLLEESQNQQENNEKDLL ALDSWNNLWNWFNITNWLWYIK 2143 0 426c DNA 2144 D 426c.N276D.N460D.N463D GenBank: KC769519.1, incorporated by reference herein as present in GenBank on Sep. 3, 2015 MDAMKRGLCCVLLLCGAVFVSPSASVGNLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWA THACVPTDPNPQEVVLENVTENFNMWKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLNCTNVN VTSNSTNVNSSSTDNTTLGEIKNCSFDITTEIRDKTRKEYALFYRLDIVPLDNSSNPNSSNTYRL INCNTSTLTQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQ LLLNGSLAEEEIVIRKDLSDNAKIIIVQLNKSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDI RQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFN DTISNATIMLPCRIKQIINMWQEVGKAIYAPPIKGNITCKSDITGLLLLRDGGDTTDNTEIFRPG GGDMRDNWRSELYKYKVVEIKPLGVAPTDAISSVVESNKSAVGIGAVFLGFLGAAGSTMGAASIT LTVOARQLLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLKDQQLLGLWGCSGK LICTTAVPWNISWSNKSKEEIWENMTWMQWDREINNYTNTIYRLLEESQNQQENNEKDLLALDSW NNLWNWFNITNWLWYIK 2145 D 45_01dG5 GenBank: JQ609687.1, incorporated by reference herein as present in GenBank on Sep. 3, 2015 MRVMGIRKNCQRLWRGGTLFLGILMIFSAAENLWVTVYYGVPVWKEATATLFCASDAKAYETEVH NVWATHACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNC TDYLGNATNTTSSSGGAMEGGEIKNCSFNITTSMRDKMQKEYALFYKLDVVSIDNDNASTNYRLI SCNTSVITQACPKISFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQL LLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGD IRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQsSGGDPEIVMHSFNCGGEFFYCNSTQLF NSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGKAMYAPPIKGQIRCSSNITGLLLTRDG GSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGLAPTRAKRRVVQREKRAVGIGAVFLGF LGAAGSTMGAASMTLTVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYL KDQQLLGWGCSGKLICTTAVPWNASWSNKSLDKIWNNMTWMEWEREINNYTGLIYNLIEESQNQQ EKNEQELLELDKWASLWNWFDITKWLWYIKIFIMIVGGLVGLRIIFTVLSIVNRVRQGYSPLSFQ THLPAPRGPDRPEGIGEEGGEQRDRSDRLVTGFLAIFWVDLRSLCLFSYHRLRDLLLIVTRIVEL LGRRGWEILKYWWNLLQYWNQELKNSAVSLLNATAIVVAEGTDRVIEVLQRAFRAVLNIPTRIRQ GLERALL 2146 H496 *426c-v1v2-WITO- BG505 platform; degly4-DS-gly504- heterologous V1V2; gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTATCTQACPKVTFDPIPIHYCAPAGYAI LKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNK SVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKN ISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAP PIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCK RnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHL LKLTVWGIKQLOARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQ WDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2147 H497 *426c-v1v2-WITO- BG505 platform; degly3-DS- heterologous V1V2; gly504-gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTSTCTQACPKVTFDPIPIHYCAPAGYAI LKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNK SVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKN ISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAP PIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCK RnvtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHL LKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQ WDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2148 H498 *426c-v1v2-ZM233- BG505 platform; degly4-DS-gly504- heterologous V1V2; gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTATCTQACPKVTFDPIPIHYCAPAGYAILKCNNKTF NGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTR PNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSG GDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITC KSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRR RRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGI KQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNY TQIIYGLLEESQNQQEKNEQDLnAtD 2149 H499 *426c-v1v2-ZM233- BG505 platform; degly3-DS-gly504- heterologous V1V2; gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTsTCTQACPKVTFDPIPIHYCAPAGYAILKCNNKTF NGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNKSVEIVCTR PNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKNISFQSSSG GDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAPPIKGNITC KSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRnvtGRRR RRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGI KQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNY TQIIYGLLEESQNQQEKNEQDLnAtD 2150 H500 *d45-v1v2-WITO- BG505 platform; 01dG5chim-DS- heterologous V1V2; gly504-gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTTTV IRDKIQKEYALFYKLDIVPIEGKNTNTGYRUNCNTsVCTQACPKISFEPIPIHYCAPAGFAILKCN DKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEIN CTRPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQ sSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVG KCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKWKIEPLGVA PTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEA QQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIW DNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2151 H501 *d45-v1v2-WITO- BG505 platform; 01dG5chim-degly3- heterologous V1V2; DS-gly504-gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTsVCTQACPKISFEPIPIHYCAPAGFAI LKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNE TVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNE TIAFNQaSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQII NMWQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKW KIEPLGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQ SNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKUCCTNVPWNSSWSNRN LSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2152 H502 *d45-v1v2-WITO- BG505 platform; 01dG5chim-degly4- Heterologous DS-gly504- V1V2; gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTaVCTQACPKISFEPIPIHYCAPAGFAI LKCNDKKFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNE TVEINCTRPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNE TIAFNQaSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEWNNTEKNINITLPCRIKQIINM WQEVGKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKI EPLGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNL LRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2153 H503 *d45-v1v2-ZM233- BG505 platform; 01dG5chim-DS- heterologous V1V2; gly504-gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQSS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2154 H504 *d45-v1v2-ZM233- BG505 platform; 01dG5chim-degly3- heterologous V1V2; DS-gly504-gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTOACPKISFEPIPIHYCAPAGFAILKCNDKKF NGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTR PNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQaS GGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGK CMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGV APTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAP EAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWD NMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2155 H505 *d45-v1v2-ZM233- BG505 platform; 01dG5chim-degly4- heterologous V1V2; DS-gly504-gly661 remainder 45_01dG5, 201C/433C; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTaVCTOACPKISFEPIPIHYCAPAGFAILKCNDKK FNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCT RPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQ aSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEV GKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRnVtGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLL RAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSE IWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2156 H506 *Scl5ln 426c- BG505 platform; v1v2-WITO-degly4- heterologous V1V2; DS-gly504-gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C, single chain format with 15 AA linker; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTATCTQACPKVTFDPIPIHYCAPAGYA ILKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLN KSVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPH KNISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIY APPIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPT RCKRnVtGGGSGGGGSGGGGSGGAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQS NLLRAPEAQQHLLKLTVWGIKQLOARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRN LSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2157 H507 *Sc10ln 426c-v1v2- BG505 platform; WITO-degly4- heterologous V1V2; DS-gly504-gly661 remainder 426c with N276, N460 and N463 glycan mutations; 201C/433C, single chain format with 10 AA linker; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNDMVDQMQEDVISIWDQSLKPCVKLTPLCVTLHCTNVTISSTNGSTANVTMREEMKNCSFNTT TVIRDKIQKEYALFYKLDIVPIEGKNTNTGYRLINCNTATCTQACPKVTFDPIPIHYCAPAGYAI LKCNNKTFNGKGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIVIRSKNLADNAKIIIVQLNK SVEIVCTRPNNNTRRSIRIGPGQTFYATDIIGDIRQAYCNISGRNWSEAVNQVKKKLKEHFPHKN ISFQSSSGGDLEITTHSFNCGGEFFYCNTSGLFNDTISNATIMLPCRIKQIINMWQEVGKCIYAP PIKGNITCKSDITGLLLLRDGGNTANNAEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCK RnvtGGGSGGGGSGGAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEA QQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNM TWLQWDKEISNYTQIYGLLEESQNQQEKNEQDLnAtD 2158 H508 *Scl5ln d45- BG505 platform; v1v2-ZM233- Heterologous 01dG5chim- V1V2; DS-gly504- Remainder gly661 45_01dG5; 201C/433C, single chain format with 15 AA linker; add 504/661 sequons for glycosylation of membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNMW KNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKRK VNVLFYKLDLVPLTNSSNTTNYRLISCNTsVCTQACPKISFEPIPIHYCAPAGFAILKCNDKKFN GTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCTRP NNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQSSG GDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEVGKC MYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVA PTRCKRnVtGGGSGGGGSGGGGSGGAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQ QSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSN RNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD 2159 H509 *Sc10ln d45-v1v2- BG505 platform; ZM233-01dG5chim- Heterologous DS-gly504- V1V2; gly661 remainder 45_01dG5; 201C/433C, single chain format with AA linker; add 504/661 sequons for glycosylation of Membrane proximal region AENLWVTVYYGVPVWKEATATLFCASDAKAYETEVHNVWATHACVPTDPNPQEVVLENVTENFNM WKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLDCSTYNNTHNISKEMKICSFNMTTELRDKKR KVNVLFYKLDLVPLTNSSNTTNYRLISCNTSVCTQACPKISFEPIPIHYCAPAGFAILKCNDKK FNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENIKDNAKIIIVQLNETVEINCT RPNNNTRKSIPIGPGRAFYTTGAIIGDIRQAHCNISKAKWENTLKQIARKLREHFKNETIAFNQ SSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWTWNDTEVVNNTEKNINITLPCRIKQIINMWQEV GKCMYAPPIKGQIRCSSNITGLLLTRDGGSSTNGTTETFRPGGGDMRDNWRSELYKYKVVKIEP LGVAPTRCKRnVtGGGSGGGGSGGAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQ SNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNR NLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLnAtD
[0689] It will be apparent that the precise details of the methods or compositions described may be varied or modified without departing from the spirit of the described embodiments. We claim all such modifications and variations that fall within the scope and spirit of the claims below. Unless indicated otherwise, HIV-1 Env amino acid positions listed in the following claims correspond to the HXB2 numbering system using the HXB2 reference sequence set forth as SEQ ID NO: 1