ANTIBODIES TO CORONAVIRUS SARS-COV-2
20240025971 · 2024-01-25
Inventors
- Katherine L. Williams (San Carlos, CA, US)
- Daniel Eric Emerling (San Carlos, CA, US)
- Shaun M. Lippow (San Carlos, CA, US)
- Ngan Nguyen ATKINS (San Carlos, CA, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/14
CHEMISTRY; METALLURGY
C07K16/1003
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
International classification
C12N15/63
CHEMISTRY; METALLURGY
Abstract
Described herein are antibodies or variants thereof that specifically bind to coronavirus antigens, such as SARS-CoV-2 antigens. The antibodies can be neutralizing antibodies. Also provided are methods of using the antibodies, including methods of treating a subject infected with SARS-CoV-2, and methods of diagnosing a subject infected with SARS-CoV-2.
Claims
1. An isolated antibody that inhibits binding of a coronavirus to a cell or reduces infection of a cell by a coronavirus.
2. The antibody of claim 1, wherein the coronavirus is a member of the betacoronavirus genus.
3. The antibody of claim 1 or 2, wherein the coronavirus is a Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
4. The antibody of claim 3, wherein the coronavirus is a variant of SARS-CoV-2 selected from the group consisting of the Alpha, Beta, Gamma, Delta, and Epsilon variants.
5. The antibody of claim 4, wherein the antibody inhibits binding of Alpha, Beta, Gamma, Delta and Epsilon variants of SARS-CoV-2 to a cell or reduces infection of a cell by Alpha, Beta, Gamma, Delta and Epsilon variants of SARS-CoV-2.
6. The antibody of any one of claims 1-5, wherein the antibody comprises a heavy chain variable region sequence listed in Table 3, or a variant thereof.
7. The antibody of any one of claims 1-6, wherein the antibody comprises a HCDR1, HCDR2, and/or HCDR3 amino acid sequence listed in Table 4, or variants of the HCDR1, HCDR2, and/or HCDR3 in which 1 or more amino acids are substituted.
8. The antibody of any one of claims 1-7, wherein the antibody comprises a light chain variable region sequence listed in Table 3 or a variant thereof.
9. The antibody of any one of claims 1-8, wherein the antibody comprises a LCDR1, LCDR2, and/or LCDR3 amino acid sequence listed in Table 4, or variants of the LCDR1, LCDR2, and/or LCDR3 in which 1 or more amino acids are substituted.
10. The antibody of any one of claims 1-9, wherein the antibody comprises a HCDR1 amino acid sequence of SEQ ID NO:83, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:84, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:85, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:86, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:87, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:88, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence.
11. The antibody of any one of claims 1-10, wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:1, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:2.
12. The antibody of claim 11, wherein the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:1 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:2.
13. The antibody of any one of claims 1-9, wherein the antibody comprises a HCDR1 amino acid sequence of SEQ ID NO:89, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:90, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:91, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:92, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:93, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:94, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence.
14. The antibody of any one of claims 1-9, wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:3, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:4.
15. The antibody of claim 14, wherein the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:3 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:4.
16. A neutralizing antibody that binds to SARS-CoV-2, selected from AB-010020, AB-010021, AB-009271, AB-009610 and AB-009613 in Table 3
17. The neutralizing antibody of claim 16, wherein the antibody comprises: (i) a HCDR1 amino acid sequence of SEQ ID NO:83, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:84, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:85, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:86, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:87, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:88, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence; (ii) a HCDR1 amino acid sequence of SEQ ID NO:89, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:90, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:91, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:92, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:93, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:94, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence; (iii) a HCDR1 amino acid sequence of SEQ ID NO:131, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:132, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:133, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:134, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:135, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:136, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence; (iv)) a HCDR1 amino acid sequence of SEQ ID NO:137, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:138, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:139, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:140, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:141, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:142, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence; or (v) a HCDR1 amino acid sequence of SEQ ID NO:143, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:144, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:145, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:146, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:147, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:148, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence.
18. The neutralizing antibody of claim 16 or 17, wherein the antibody comprises: (i) a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:1, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:2; (ii) a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:3, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:4; (iii) a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:17, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:18; (iv) a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:19, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:20; or (v). a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:21, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:22.
19. The neutralizing antibody of any one of claims 16-18, wherein the antibody has neutralizing activity against a SARS-CoV-2 variant selected from Wuhan, Alpha, Beta, Gamma, Delta, and Epsilon, or combinations thereof.
20. The antibody of any one of claims 1-19, wherein the antibody binds to a spike glycoprotein (S-protein) encoded by the coronavirus.
21. The antibody of any one of claims 1-19, wherein the antibody binds to a membrane (M) protein, an envelope (E) protein, or a nucleocapsid (N) protein encoded by the coronavirus.
22. The antibody of any one of claims 1-21, wherein the antibody binds to the S trimer encoded by the coronavirus.
23. The antibody of any one of claims 1-22, wherein the antibody binds to RBD, S1 monomer and S trimer encoded by the coronavirus.
24. The antibody of any one of claims 1-23, wherein the antibody does not bind to the S2 protein encoded by the coronavirus.
25. The antibody of any one of claims 1-24, wherein the antibody inhibits binding of the coronavirus to a receptor on the surface of the cell.
26. The antibody of claim 25, wherein the cell surface receptor is ACE2.
27. The antibody of any one of claims 1-26, wherein the antibody is a chimeric antibody, a multispecific antibody, a bispecific antibody, an scFv, or a Fab.
28. A pharmaceutical composition comprising the antibody of any one of claims 1-27.
29. An expression vector comprising a polynucleotide encoding a heavy chain variable region listed in Table 3.
30. An expression vector comprising a polynucleotide encoding a light chain variable region listed in Table 3.
31. An expression vector comprising a polynucleotide encoding a cognate pair of heavy and light chain variable regions listed in Table 3.
32. A host cell that comprises an expression vector of any one of claims 29-31.
33. A method of producing an antibody that inhibits binding of a coronavirus to a cell, the method comprising culturing the host cell of claim 32 under conditions in which the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are expressed.
34. A method of producing an antibody that inhibits binding of a coronavirus to a cell, the method comprising synthesizing the amino acid sequence of the heavy and/or light chains of the antibody of claims 1-27.
35. A method of inducing an immune response, the method comprising administering an antibody of any one of claims 1-27 to a subject.
36. The method of claim 35, wherein the immune response comprises antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and/or complement-dependent cytotoxicity (CDC).
37. The method of claim 35 or 36, wherein the antibody is administered intravenously.
38. A method of treating a patient infected with a coronavirus, the method comprising administering a therapeutically effective amount of the antibody of claims 1-27, or the pharmaceutical composition of claim 28, to the patient.
39. The method of claim 38, wherein the antibody or pharmaceutical composition is administered intravenously.
40. The method of claim 38 or 39, further comprising administering one or more additional therapeutic agents to the patient, wherein the one or more additional therapeutic agents are selected from an anti-viral agent or an anti-inflammatory agent.
41. The method of claim 40, wherein the one or more additional therapeutic agents comprise an antibody that binds to SARS-CoV-2.
42. The method of claim 41, wherein the antibody that binds to SARS-CoV-2 is selected from casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), ADG20 (Adagio Therapeutics), LY-Cov1404 (AbCellera; Eli Lilly and Company), or combinations thereof.
43. The method of claim 40, wherein the one or more additional therapeutic agents are selected from molnupiravir (MK-4482/EIDD-2801), remdesivir (GS-5734), baricitinib, bemcentinib, bevacizumab, chloroquine phosphate, colchicine, EIDD-2801, favipiravir, fingolimod, hydroxychloroquine and azithromycin, hydroxychloroquine sulfate, ivermectin, leronlimab, lopinavir and ritonavir, methylprednisolone, sarilumab, tocilizumab, or umifenovir, or combinations thereof.
44. A method of identifying a patient that is infected with a coronavirus, the method comprising detecting binding of the antibody of claims 1-27 to a sample obtained from the patient, wherein binding greater than a negative control value indicates the patient is infected with the coronavirus.
45. The method of claim 44, further comprising contacting a sample obtained from the patient with the antibody of claims 1-27.
46. The method of claim 44 or 45, wherein the sample is a blood or serum sample.
47. The method of any one of claims 44-46, further comprising treating the patient with the antibody of claims 1-27, or the pharmaceutical composition of claim 28.
48. A method of identifying an antibody having anti-viral activity, the method comprising mutagenizing a polynucleotide encoding a heavy chain variable region or a light chain variable region of an antibody of any one of claims 1-27, expressing an antibody comprising the mutagenized heavy chain or light chain variable region; and selecting an antibody that inhibits binding of the virus to a cell.
49. An in vitro method for detecting a neutralizing antibody to a coronavirus, the method comprising determining the level of virus infection of a cell culture in the presence of an antibody of claims 1-27 or a combination thereof, wherein a decrease in the level of virus infection compared to a control or untreated culture indicates the antibody is a a neutralizing antibody.
50. Use of an antibody of any one of claims 1 to 27 in a method of inducing an immune response in vivo.
51. Use of an antibody of any one of claims 1 to 27 in a method of treating a coronavirus infection.
52. A method of preventing infection of a subject with a coronavirus, the method comprising administering the antibody of claims 1-27, or the pharmaceutical composition of claim 28, to the subject, wherein the antibody or pharmaceutical composition is administered at a dose sufficient to prevent or reduce infection of one or more host cells in the subject by coronavirus.
53. The method of claim 52, wherein the coronavirus is SARS-CoV-2.
54. A method of diagnosing a subject that is infected with a coronavirus, the method comprising detecting binding of the antibody of claims 1-27 to a sample obtained from the subject, wherein binding greater than a negative control value indicates the subject is infected with the coronavirus.
55. The method of claim 54, wherein the coronavirus is SARS-CoV-2.
56. A method of treating a patient infected with a coronavirus, the method comprising administering a therapeutically effective amount of an antibody comprising a HCDR1 amino acid sequence of SEQ ID NO:83, or a variant HCDR1 in which 1 or more amino acids are substituted relative to the sequence; a HCDR2 amino acid sequence of SEQ ID NO:84, or a variant HCDR2 in which 1 or more amino acids are substituted relative to the sequence; a HCDR3 amino acid sequence of SEQ ID NO:85, or a variant HCDR3 in which 1 or more amino acids are substituted relative to the sequence; a LCDR1 amino acid sequence of SEQ ID NO:86, or a variant LCDR1 in which 1 or more amino acids are substituted relative to the sequence; a LCDR2 amino acid sequence of SEQ ID NO:87, or a variant LCDR2 in which 1 or more amino acids are substituted relative to the sequence; and/or a LCDR3 amino acid sequence of SEQ ID NO:88, or a variant LCDR3 in which 1 or more amino acids are substituted relative to the sequence.
57. The method of claim 56, wherein the antibody comprises a heavy chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:1, and a light chain variable region comprising an amino acid sequence having at least 70% sequence identity to SEQ ID NO:2.
58. The method of claim 56 or 57, wherein the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:1 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 2.
59. The method of any one of claims 56-58, further comprising administering an antibody that binds to SARS-CoV-2 to the patient, wherein the antibody that binds to SARS-CoV-2 is selected from casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), ADG20 (Adagio Therapeutics), LY-Cov1404 (AbCellera; Eli Lilly and Company), or combinations thereof.
60. An antibody that binds SARS-CoV-2, or a variant of SARS-CoV-2, comprising the CDRS of an antibody in Table 4.
61. The antibody of claim 60, comprising a framework region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to a framework region present in a VH and/or VL amino acid sequence of the same antibody in a row of Table 3.
62. The antibody of claim 60 or 61, wherein a framework 1 (FW1), framework 2 (FW2), framework 3 (FW3), and/or framework 4 (FW4) region has at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to a FW1, FW2, FW3 and/or FW4 region present in a VH and/or VL amino acid sequence in the same antibody in a row of Table 3.
63. The antibody of any one of claims 60-62, wherein the antibody comprises the CDRS of SEQ ID NOs 83-88, and the framework region has at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to the framework region present in the VH of SEQ ID NO:1 and/or the VL of SEQ ID NO:2.
64. The antibody of any one of claims 60-62, wherein the antibody comprises the CDRS of SEQ ID NOs 89-94, and the framework region has at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to the framework region present in the VH of SEQ ID NO:3 and/or the VL of SEQ ID NO:4.
65. An antibody that binds SARS-CoV-2, or a variant of SARS-CoV-2, the antibody comprising a VH region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to a VH amino acid sequence in Table 4, wherein the sequence variations relative to the VH amino acid sequence in Table 4 are in the framework region only; and a VL region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to a VL amino acid sequence in Table 4, wherein the sequence variations relative to the VL amino acid sequence in Table 4 are in the framework region only.
66. The antibody of claim 65, wherein the VH and VL sequences are in the same row of Table 4.
67. The antibody of claim 65, wherein the antibody comprises a VH region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to SEQ ID NO:1, wherein the sequence variations relative to SEQ ID NO:1 are in the framework region only; and a VL region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to SEQ ID NO:2, wherein the sequence variations relative to SEQ ID NO:2 are in the framework region only.
68. The antibody of claim 65, wherein the antibody comprises a VH region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to SEQ ID NO:3, wherein the sequence variations relative to SEQ ID NO:3 are in the framework region only; and a VL region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to SEQ ID NO:4, wherein the sequence variations relative to SEQ ID NO:4 are in the framework region only.
69. An antibody that binds SARS-CoV-2, or a variant of SARS-CoV-2, comprising a heavy chain variable sequence (VH) and a light chain variable sequence (VL) in a row of Table 4.
70. The antibody of claim 69, comprising a VH having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:1, and a VL having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:2.
71. The antibody of claim 69, comprising a VH amino acid sequence of SEQ ID NO:1 and a VL amino acid sequence of SEQ ID NO:2
72. The antibody of claim 69, comprising a VH having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:3, and a VL having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:4.
73. The antibody of claim 69, comprising a VH amino acid sequence of SEQ ID NO:3 and a VL amino acid sequence of SEQ ID NO:4.
74. An antibody that competes with an antibody in Table 3 for binding to SARS-CoV-2, or a variant of SARS-CoV-2.
75. The antibody of claim 74, wherein the antibody competes with an antibody comprising a VH amino acid sequence of SEQ ID NO:1 and a VL amino acid sequence of SEQ ID NO:2.
76. The antibody of claim 74, wherein the antibody competes with an antibody comprising a VH amino acid sequence of SEQ ID NO:3 and a VL amino acid sequence of SEQ ID NO:4.
77. The antibody of any one of claims 74-76, wherein the antibody competes for binding to a spike glycoprotein (S-protein) or for binding to the S trimer encoded by SARS-CoV-2, or a variant of SARS-CoV-2.
78. The antibody of any one of claims 60-76, wherein the SARS-CoV-2 variant is selected from the group consisting of Alpha, Beta, Gamma, Delta, and Epsilon.
79. The antibody of any one of claims 60-78, wherein the antibody is an isolated or recombinant antibody.
80. A pharmaceutical composition comprising an antibody of any one of claims 60-79 and one or more excipients.
81. A recombinant nucleic acid encoding an antibody of any one of claims 60-79.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
DETAILED DESCRIPTION
[0084] As used in herein, the singular forms a, an and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to an antibody optionally includes a combination of two or more such molecules, and the like.
[0085] The term about as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field, for example 20%, 10%, or 5%, are within the intended meaning of the recited value.
[0086] As used herein, the term antibody means an isolated or recombinant binding agent that comprises the necessary variable region sequences to specifically bind an antigenic epitope. Therefore, an antibody as used herein is any form of antibody or fragment thereof that exhibits the desired biological activity, e.g., binding the specific target antigen. Thus, it is used in the broadest sense and specifically covers a monoclonal antibody (including full-length monoclonal antibodies), human antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments including but not limited to scFv, Fab, and the like so long as they exhibit the desired biological activity.
[0087] Antibody fragments comprise a portion of an intact antibody, for example, the antigen-binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab, F(ab).sub.2, and Fv fragments; diabodies; linear antibodies (e.g., Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.
[0088] An antibody that binds to the same epitope as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
[0089] As used herein, V-region refers to an antibody variable region domain comprising the segments of Framework 1, CDR1, Framework 2, CDR2, Framework 3, CDR3, and Framework 4. The heavy chain V-region, VH, is a consequence of rearrangement of a V-gene (HV), a D-gene (HD), and a J-gene (HJ), in what is known as V(D)J recombination during B-cell differentiation. The light chain V-region, VL, is a consequence of rearrangement of a V-gene (LV) and a J-gene (LJ).
[0090] As used herein, complementarity-determining region (CDR) refers to the three hypervariable regions (HVRs) in each chain that interrupt the four framework regions established by the light and heavy chain variable regions. The CDRs are the primary contributors to binding to an epitope of an antigen. The CDRs of each chain are referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also identified by the chain in which the particular CDR is located. Thus, a VH CDR3 (HCDR3) is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a VL CDR3 (LCDR3) is the CDR3 from the variable domain of the light chain of the antibody in which it is found. The term CDR is used interchangeably with HVR when referring to CDR sequences.
[0091] The amino acid sequences of the CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, international ImMunoGeneTics database (IMGT), and AbM (see, e.g., Chothia & Lesk, 1987, Canonical structures for the hypervariable regions of immunoglobulins. J. Mol. Biol. 196, 901-917; Chothia C. et al., 1989, Conformations of immunoglobulin hypervariable regions. Nature 342, 877-883; Chothia C. et al., 1992, structural repertoire of the human VH segments J. Mol. Biol. 227, 799-817; Al-Lazikani et al., J. Mol. Biol 1997, 273(4)). Definitions of antigen combining sites are also described in the following: Ruiz et al., IMGT, the international ImMunoGeneTics database. Nucleic Acids Res., 28, 219-221 (2000); and Lefranc, M.-P. IMGT, the international ImMunoGeneTics database. Nucleic Acids Res. January 1; 29(1):207-9 (2001); MacCallum et al, Antibody-antigen interactions: Contact analysis and binding site topography, J. Mol. Biol., 262 (5), 732-745 (1996); and Martin et al., Proc. Natl Acad. Sci. USA, 86, 9268-9272 (1989); Martin, et al., Methods Enzymol., 203, 121-153, (1991); Pedersen et al., Immunomethods, 1, 126, (1992); and Rees et al., In Sternberg M. J. E. (ed.), Protein Structure Prediction. Oxford University Press, Oxford, 141-172 1996). Reference to CDRs as determined by Kabat numbering are based, for example, on Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institute of Health, Bethesda, MD (1991)). Chothia CDRs are determined as defined by Chothia (see, e.g., Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
[0092] CDRs as shown in Table 4 are defined by IMGT and Kabat. The V.sub.H CDRs as listed in Table 4 are defined as follows: HCDR1 is defined by combining Kabat and IMGT; HCDR2 is defined by Kabat; and the HCDR3 is defined by IMGT. The V.sub.L CDRs as listed in Table 4 are defined by Kabat.
[0093] An Fc region refers to the constant region of an antibody excluding the first constant region immunoglobulin domain. Thus, Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains. For IgA and IgM Fc may include the J chain. For IgG, Fc comprises immunoglobulin domains Cy2 (Cgamma2) and Cy3 (Cgamma3) and the hinge between Cy1 (Cgamma1) and Cy2 (Cgamma2). It is understood in the art that the boundaries of the Fc region may vary, however, the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, using the numbering according to the EU index as in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, VA). The term Fc region may refer to this region in isolation or this region in the context of an antibody or antibody fragment. Fc region includes naturally occurring allelic variants of the Fc region as well as modifications that modulate effector function. Fc regions also include variants that do not result in alterations to biological function. For example, one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function. Such variants can be selected according to general rules known in the art so as to have minimal effect on activity (see, e.g., Bowie, et al., Science 247:306-1310, 1990). For example, for IgG4 antibodies, a single amino acid substitution (S228P according to Kabat numbering; designated IgG4Pro) may be introduced to abolish the heterogeneity observed in recombinant IgG4 antibody (see, e.g., Angal, et al., Mol Immunol 30:105-108, 1993). In certain embodiments, the Fc region includes substitutions that improve pharmacokinetics properties of an antibody, e.g., increased serum half-life. Non-limiting examples of substitutions of the Fc region can be found in U.S. Pat. No. 8,088,376, the content of which is incorporated by reference in its entirety.
[0094] An EC.sub.50 as used herein in the context of an Fc receptor engagement assay, refers to the half maximal effective concentration, which is the concentration of an antibody that induces a response (signal generated in engagement assay) halfway between the baseline and maximum after a specified exposure time. In some embodiments, the fold over EC50 is determined by dividing the EC50 of a reference antibody by the EC.sub.50 of the test antibody.
[0095] The 50% inhibitory concentration (IC50) is the concentration of antibody at which either pseudovirus or full-length virus infectivity is reduced by at least 50% as compared to viral infection in the absence of anti-SARS-CoV-2 antibody, or in the presence of a negative control antibody not expected neutralize SARS-CoV-2. The IC50 may also reference the reciprocal dilution of plasma or serum at which 50% inhibition of viral infection is calculated. In some embodiments, neutralizing activity can also be measured as a function of the area under the positive portion of the neutralization curve.
[0096] The term endpoint titer refers to the lowest concentration of antibody or the highest dilution of plasma or serum where binding to an antigen is significantly higher than the negative control.
[0097] The term equilibrium dissociation constant abbreviated (K.sub.D), refers to the dissociation rate constant (k.sub.d, time.sup.1) divided by the association rate constant (k.sub.a, time.sup.1 M.sup.1). Equilibrium dissociation constants can be measured using any method. Thus, in some embodiments antibodies of the present disclosure have a K.sub.D of less than about 50 nM, typically less than about 25 nM, or less than 10 nM, e.g., less than about 5 nM or than about 1 nM and often less than about 10 nM as determined by bio-layer interferometry analysis using a biosensor system such as an Octet system performed at 25 C. In some embodiments, an antibody of the present disclosure has a K.sub.D of less than 510.sup.5 M, less than 10.sup.5 M, less than 510.sup.6 M, less than 10.sup.6 M, less than 510.sup.7 M, less than 10.sup.7 M, less than 510.sup.8 M, less than 10.sup.8 M, less than 510.sup.9 M, less than 10.sup.9 M, less than 510.sup.10 M, less than 10.sup.10 M, less than 510.sup.11 M, less than 10.sup.11 M, less than 510.sup.12 M, less than 10.sup.12 M, less than 510.sup.13 M, less than 10.sup.13 M, less than 510.sup.14 M, less than 10.sup.14 M, less than 510.sup.15 M, or less than 10.sup.15 M or lower as measured as a bivalent antibody. In the context of the present invention, an improved K.sub.D refers to a lower K.sub.D. In some embodiments, an antibody of the present disclosure has a K.sub.D of less than 510.sup.5 M, less than 10.sup.5 M, less than 510.sup.6 M, less than 10.sup.6 M, less than 510.sup.7 M, less than 10.sup.7 M, less than 510.sup.8 M, less than 10.sup.8 M, less than 510.sup.9 M, less than 10.sup.9 M, less than 510.sup.10 M, less than 10.sup.10 M, less than 510.sup.11 M, less than 10.sup.11 M, less than 510.sup.12 M, less than 10.sup.12 M, less than 510.sup.13 M, less than 10.sup.13 M, less than 510.sup.14 M, less than 10.sup.14 M, less than 510.sup.15 M, or less than 10.sup.15 M or lower as measured as a monovalent antibody, such as a monovalent Fab. In some embodiments, an anti-SARS-CoV-2 antibody of the present disclosure has K.sub.D less than 100 M, e.g., or less than 75 M, e.g., in the range of 1 to 100 M, when measured by biolayer interferometry using a biosensor system such as an Octet system performed at 25 C. In some embodiments, an anti-SARS-CoV-2 antibody of the present disclosure has K.sub.D of greater than 100 M, e.g., in the range of 100-1000 M or 500-1000 M when measured by biolayer interferometry using a biosensor system such as a Octet system performed at 25 C.
[0098] The term monovalent molecule as used herein refers to a molecule that has one antigen-binding site, e.g., a Fab or scFv.
[0099] The term bivalent molecule as used herein refers to a molecule that has two antigen-binding sites. In some embodiments, a bivalent molecule of the present invention is a bivalent antibody or a bivalent fragment thereof. In some embodiments, a bivalent molecule of the present invention is a bivalent antibody. In some embodiments, a bivalent molecule of the present invention is an IgG. In general monoclonal antibodies have a bivalent basic structure. IgG and IgE have only one bivalent unit, while IgA and IgM consist of multiple bivalent units (2 and 5, respectively) and thus have higher valencies. This bivalency increases the avidity of antibodies for antigens.
[0100] The terms monovalent binding or monovalently binds to as used herein refer to the binding of one antigen-binding site to its antigen.
[0101] The terms bivalent binding or bivalently binds to as used herein refer to the binding of both antigen-binding sites of a bivalent molecule to its antigen. Preferably both antigen-binding sites of a bivalent molecule share the same antigen specificity.
[0102] The term valency as used herein refers to the number of different binding sites of an antibody for an antigen. A monovalent antibody comprises one binding site for an antigen. A bivalent antibody (e.g., a bivalent IgG antibody) comprises two binding sites for the same antigen.
[0103] The term avidity as used herein in the context of antibody binding to an antigen refers to the combined binding strength of multiple binding sites of the antibody. Thus, bivalent avidity refers to the combined strength of two binding sites.
[0104] The term affinity as used herein refers to either the single or combined strength of one or both arms of an antibody (e.g., an IgG antibody) binding to either a simple or complex antigen expressing one or more epitopes. As defined here, the term affinity does not imply a specific number of valencies between the two binding partners.
[0105] The phrase specifically (or selectively) binds to an antigen or target or specifically (or selectively) immunoreactive with, when referring to a protein or peptide, refers to a binding reaction whereby the antibody binds to the antigen or target of interest. In the context of this invention, the antibody selectively binds to a SARS-CoV-2 antigen.
[0106] The terms identical or percent identity, in the context of two or more polynucleotide or polypeptide sequences, refer to two or more sequences or subsequences that are the same (e.g., 100% percent identity) or have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 70%, at least 75%, at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least 99%, or higher sequence identity; or 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) identity over a specified region, e.g., the length of the two sequences, when compared and aligned for maximum correspondence over a comparison window or designated region. Alignment for purposes of determining percent amino acid sequence identity can be performed in various methods, including those using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include the BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J. Mol. Biol. 215:403-410 (1990). Thus, for purposes of this disclosure, BLAST 2.0 can be used with the default parameters to determine percent sequence identity.
[0107] The terms corresponding to, determined with reference to, or numbered with reference to when used in the context of the identification of a given amino acid residue in a polypeptide sequence, refers to the position of the residue of a specified reference sequence when the given amino acid sequence is maximally aligned and compared to the reference sequence. Thus, for example, an amino acid residue in a V.sub.H region polypeptide corresponds to an amino acid in the V.sub.H region of SEQ ID NO:1 when the residue aligns with the amino acid in SEQ ID NO:1 when optimally aligned to SEQ ID NO:1. The polypeptide that is aligned to the reference sequence need not be the same length as the reference sequence.
[0108] A conservative substitution as used herein refers to a substitution of an amino acid such that charge, polarity, hydropathy (hydrophobic, neutral, or hydrophilic), and/or size of the side group chain is maintained. Illustrative sets of amino acids that may be substituted for one another include (i) positively-charged amino acids Lys and Arg; and His at pH of about 6; (ii) negatively charged amino acids Glu and Asp; (iii) aromatic amino acids Phe, Tyr and Trp; (iv) nitrogen ring amino acids His and Trp; (v) aliphatic hydrophobic amino acids Ala, Val, Leu and Ile; (vi) hydrophobic sulfur-containing amino acids Met and Cys, which are not as hydrophobic as Val, Leu, and Ile; (vii) small polar uncharged amino acids Ser, Thr, Asp, and Asn (viii) small hydrophobic or neutral amino acids Gly, Ala, and Pro; (ix) amide-comprising amino acids Asn and Gln; and (xi) beta-branched amino acids Thr, Val, and Ile. Reference to the charge of an amino acid in this paragraph refers to the charge at pH 6-7.
[0109] The terms nucleic acid and polynucleotide are used interchangeably and as used herein refer to both sense and anti-sense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. In particular embodiments, a nucleotide refers to a ribonucleotide, deoxynucleotide or a modified form of either type of nucleotide, and combinations thereof. The terms also include, but is not limited to, single- and double-stranded forms of DNA. In addition, a polynucleotide, e.g., a cDNA or mRNA, may include either or both naturally occurring and modified nucleotides linked together by naturally occurring and/or non-naturally occurring nucleotide linkages. The nucleic acid molecules may be modified chemically or biochemically or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analogue, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, and the like), charged linkages (e.g., phosphorothioates, phosphorodithioates, and the like), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, and the like), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, and the like). The above term is also intended to include any topological conformation, including single-stranded, double-stranded, partially duplexed, triplex, hairpinned, circular and padlocked conformations. A reference to a nucleic acid sequence encompasses its complement unless otherwise specified. Thus, a reference to a nucleic acid molecule having a particular sequence should be understood to encompass its complementary strand, with its complementary sequence. The term also includes codon-optimized nucleic acids that encode the same polypeptide sequence.
[0110] The term vector, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. A vector as used here refers to a recombinant construct in which a nucleic acid sequence of interest is inserted into the vector. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as expression vectors.
[0111] A substitution, as used herein, denotes the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively.
[0112] An isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0113] Isolated nucleic acid encoding an antibody or fragment thereof refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
[0114] The terms host cell, host cell line, and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Thus, a host cell is a recombinant host cells and includes the primary transformed cell and progeny derived therefrom without regard to the number of passages.
[0115] A polypeptide variant, as the term is used herein, is a polypeptide that typically differs from a polypeptide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. As used herein, a variant refers to an engineered sequence, rather than a naturally occurring sequence.
[0116] The term comparable, in the context of describing the strength of binding of two antibodies to the same target, refers to two dissociation constant (K.sub.D) values calculated from two binding reactions that are within three (3) fold from each other. In other words, the ratio between the first K.sub.D (the K.sub.D of the binding reaction between the first antibody and the target) and the second K.sub.D (the K.sub.D of the binding reaction between the second antibody and the target) is within the range of 1:3 or 3:1, endpoints exclusive. A lower K.sub.D value denotes stronger binding. For example, an antibody variant that has stronger binding as compared to a reference antibody binds to the target with a K.sub.D that is at least of the K.sub.D measured against the same target for the reference antibody.
[0117] As used herein, therapeutic agent refers to an agent that when administered to a patient suffering from a disease, in a therapeutically effective dose, will cure, or at least partially arrest the symptoms of the disease and complications associated with the disease.
[0118] As used herein, a neutralizing antibody is an antibody that acts by preventing a virus or other infectious pathogen from infecting a host target cell.
[0119] As used herein a B cell refers to any cell that has at least one rearranged immunoglobulin gene locus.
[0120] As used herein, variable region refers to a variable nucleotide sequence that arises from a recombination event, for example, it can include a V, J, and/or D region of an immunoglobulin or T cell receptor sequence isolated from a T cell or B cell of interest, such as an activated T cell or an activated B cell.
[0121] As used herein B cell variable immunoglobulin region refers to a variable immunoglobulin nucleotide sequence isolated from a B cell. For example, a variable immunoglobulin sequence can include a V, J, and/or D region of an immunoglobulin sequence isolated from a B cell of interest such as a memory B cell, an activated B cell, or plasmablast.
[0122] As used herein immunoglobulin region refers to a contiguous portion of nucleotide sequence from one or both chains (heavy and light) of an antibody.
[0123] As used herein identification region refers to a nucleotide sequence label (e.g., a unique barcode sequence) that can be coupled to at least one nucleotide sequence for, e.g., later identification of the at least one nucleotide sequence.
[0124] As used herein, barcode or barcode sequence refers to any unique sequence label that can be coupled to at least one nucleotide sequence for, e.g., later identification of the at least one nucleotide sequence.
[0125] The tern paired heavy and light chains, or paired heavy and light chain variable regions, or cognate pair refers to native pairs of immunoglobulin heavy and light variable regions that are expressed by a single B cell.
Compositions
[0126] Described herein are antibodies or variants thereof that inhibit binding of SARS-CoV-2 to a cell or reduce or prevent infection of a cell by SARS-CoV-2. In some embodiments, the antigen binding protein is an antibody or antigen binding fragment thereof.
Antibodies that bind to SARS-CoV-2 Antigens
[0127] Described herein are antibodies or variants thereof that specifically bind to coronavirus antigens. In some embodiments, the antibodies are neutralizing antibodies. In some embodiments, the antibodies specifically bind to SARS-CoV-2 antigens. In some embodiments, the antibodies specifically bind to a protein antigen that is translated from a viral RNA, such as a SARS-CoV-2 viral RNA. In some embodiments, the antibodies specifically bind to a viral spike protein. In some embodiments, the antibodies specifically bind to the SARS-CoV-2 spike protein. In some embodiments, the antibodies specifically bind to either the S1 or S2 subunits of the SARS-CoV-2 spike protein. In some embodiments, the antibodies specifically bind to a SARS-CoV-2 S1 or S2 glycoprotein. In some embodiments, the antibodies specifically bind to the ectodomain of S1 and S2. In some embodiments, the antibodies specifically bind to the receptor-binding domain (RBD) of the S1 subunit. In some embodiments, the antibodies specifically bind to the S2 subunit. In some embodiments, the antibodies specifically bind to a SARS-CoV-2 membrane (M) protein. In some embodiments, the antibodies specifically bind to a SARS-CoV-2 envelope (E) protein. In some embodiments, the antibodies specifically bind to a SARS-CoV-2 nucleocapsid (N) protein.
[0128] It is thought that the SARS-CoV-2 virus utilizes components of the renin angiotensin system (RAS) (ACE2 and TMPRSS2) to enter cells. Current research indicates that SARS-CoV-2 binds to the cell surface receptor Angiotensin-converting enzyme 2 (ACE2). See, e.g., Walls et al., 2020, Cell 180, 1-12, Mar. 19, 2020: doi.org/10.1016/j.cell.2020.02.058. Thus, in some embodiments, the antibodies specifically bind to the ACE2 protein (www.uniprot.org/uniprot/Q9BYF1), or an antigenic fragment thereof. In some embodiments, the antibodies specifically bind to TMPRSS2 (serine protease, uniprot O15393), or an antigenic fragment thereof.
[0129] In some embodiments, the antibodies inhibit binding of the coronavirus to a cell more efficiently as compared to a control, non-specific antibody. In some embodiments, the antibodies reduce infection of a cell by a coronavirus. The term reduce infection refers to the experimental antibody decreasing the number of viruses that enter a cell as compared to a control antibody.
[0130] In some embodiments, the antibodies inhibit binding of the coronavirus to the ACE2 receptors on the surface of human cells. In some embodiments, the antibodies are neutralizing antibodies.
[0131] The antibodies described herein can be IgG, IgM or IgA antibodies.
[0132] In some embodiments, the antibodies described herein are selected from the antibodies listed in Table 3. In some embodiments, the antibodies are selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190. In some embodiments, the antibodies described herein comprise one, two, three, four, five, or all six CDRs from an antibody listed in Table 3. In some embodiments, the antibodies described herein comprise one, two, three, four, five, or all six CDRs from an antibody selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190. In some embodiments, the antibodies described herein comprise all six CDRs from an antibody selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190.
[0133] In some embodiments, the antibodies described herein comprise the heavy chain variable region from an antibody selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190.
[0134] In some embodiments, the antibodies described herein comprise the light chain variable region from an antibody selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190.
[0135] In some embodiments, the antibodies described herein comprise the heavy chain variable region and the light chain variable region from an antibody selected from AB-010020, AB-010021, AB-009662, AB-009665, AB-009666, AB-009679, AB-009627, AB-443921978, AB-009271, AB-009610, AB-009613, AB-009231, AB-009214, AB-009112, and AB-009190.
[0136] In some embodiments, the antibodies described herein comprise a heavy chain variable region sequence listed in Table 3, or a non-naturally occurring variant thereof. In some embodiments, the antibodies described herein comprise a heavy chain variable region sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to an amino acid sequence listed in Table 3. In some embodiments, the antibodies described herein comprise a light chain variable region sequence listed in Table 3, or a non-naturally occurring variant thereof. In some embodiments, the antibodies described herein comprise a light chain variable region sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to an amino acid sequence listed in Table 3. In some embodiments, the antibodies described herein comprise a heavy chain variable region sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to an amino acid sequence listed in Table 3 and a light chain variable region sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to an amino acid sequence listed in Table 3. In some embodiments, the antibodies described herein comprise a heavy chain variable region sequence and a light chain variable region sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to an amino acid sequence in the same row of Table 3.
[0137] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:1 and/or a V.sub.L amino acid sequence of SEQ ID NO:2, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:1 and SEQ ID NO:2.
[0138] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:3 and/or a V.sub.L amino acid sequence of SEQ ID NO:4, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:3 and/or SEQ ID NO:4.
[0139] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:5 and/or a V.sub.L amino acid sequence of SEQ ID NO:6, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:5 and/or SEQ ID NO:6.
[0140] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:7 and/or a V.sub.L amino acid sequence of SEQ ID NO:8, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:7 and/or SEQ ID NO:8.
[0141] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:9 and/or a V.sub.L amino acid sequence of SEQ ID NO:10, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:9 and/or SEQ ID NO:10.
[0142] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:11 and/or a V.sub.L amino acid sequence of SEQ ID NO:12, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:11 and/or SEQ ID NO:12.
[0143] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:13 and/or a V.sub.L amino acid sequence of SEQ ID NO:14, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:13 and/or SEQ ID NO:14.
[0144] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:15 and/or a V.sub.L amino acid sequence of SEQ ID NO:16, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:15 and/or SEQ ID NO:16.
[0145] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:17 and/or a V.sub.L amino acid sequence of SEQ ID NO:18, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:17 and/or SEQ ID NO:18.
[0146] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:19 and/or a V.sub.L amino acid sequence of SEQ ID NO:20, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:19 and/or SEQ ID NO:20.
[0147] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:21 and/or a V.sub.L amino acid sequence of SEQ ID NO:22, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:21 and/or SEQ ID NO:22.
[0148] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:23 and/or a V.sub.L amino acid sequence of SEQ ID NO:24, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:23 and/or SEQ ID NO:24.
[0149] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:25 and/or a V.sub.L amino acid sequence of SEQ ID NO:26, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:25 and/or SEQ ID NO:26.
[0150] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:27 and/or a V.sub.L amino acid sequence of SEQ ID NO:28, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:27 and/or SEQ ID NO:28.
[0151] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:29 and/or a V.sub.L amino acid sequence of SEQ ID NO:28, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:27 and/or SEQ ID NO:30.
[0152] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:31 and a V.sub.L amino acid sequence of SEQ ID NO:28, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:27 and/or SEQ ID NO:32.
[0153] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:33 and/or a V.sub.L amino acid sequence of SEQ ID NO:34, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:33 and/or SEQ ID NO:34.
[0154] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:35 and/or a V.sub.L amino acid sequence of SEQ ID NO:36, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:35 and/or SEQ ID NO:36.
[0155] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:37 and/or a V.sub.L amino acid sequence of SEQ ID NO:38, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:37 and/or SEQ ID NO:38.
[0156] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:39 and/or a V.sub.L amino acid sequence of SEQ ID NO:40, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:39 and/or SEQ ID NO:40.
[0157] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:41 and/or a V.sub.L amino acid sequence of SEQ ID NO:42, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:41 and/or SEQ ID NO:42.
[0158] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:43 and/or a V.sub.L amino acid sequence of SEQ ID NO:44, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:43 and/or SEQ ID NO:44.
[0159] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:45 and/or a V.sub.L amino acid sequence of SEQ ID NO:46, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:45 and/or SEQ ID NO:46.
[0160] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:47 and/or a V.sub.L amino acid sequence of SEQ ID NO:48, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:47 and/or SEQ ID NO:48.
[0161] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:49 and/or a V.sub.L amino acid sequence of SEQ ID NO:50, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:49 and/or SEQ ID NO:50.
[0162] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:51 and/or a V.sub.L amino acid sequence of SEQ ID NO:52, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:51 and/or SEQ ID NO:52.
[0163] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:53 and/or a V.sub.L amino acid sequence of SEQ ID NO:54, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:53 and/or SEQ ID NO:54.
[0164] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:55 and/or a V.sub.L amino acid sequence of SEQ ID NO:56, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:55 and/or SEQ ID NO:56.
[0165] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:57 and/or a V.sub.L amino acid sequence of SEQ ID NO:58, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:57 and/or SEQ ID NO:58.
[0166] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:59 and/or a V.sub.L amino acid sequence of SEQ ID NO:60, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:59 and/or SEQ ID NO:60.
[0167] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:61 and/or a V.sub.L amino acid sequence of SEQ ID NO:62, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:61 and/or SEQ ID NO:62.
[0168] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:63 and/or a V.sub.L amino acid sequence of SEQ ID NO:64, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:63 and/or SEQ ID NO:64.
[0169] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:65 and/or a V.sub.L amino acid sequence of SEQ ID NO:66, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:65 and/or SEQ ID NO:66.
[0170] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:67 and/or a V.sub.L amino acid sequence of SEQ ID NO:68, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:67 and/or SEQ ID NO:68.
[0171] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:69 and/or a V.sub.L amino acid sequence of SEQ ID NO:70, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:69 and/or SEQ ID NO:70.
[0172] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:71 and/or a V.sub.L amino acid sequence of SEQ ID NO:72, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:71 and/or SEQ ID NO:72.
[0173] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:73 and/or a V.sub.L amino acid sequence of SEQ ID NO:74, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:73 and/or SEQ ID NO:74.
[0174] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:75 and/or a V.sub.L amino acid sequence of SEQ ID NO:76, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:75 and/or SEQ ID NO:76.
[0175] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:77 and/or a V.sub.L amino acid sequence of SEQ ID NO:78, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:77 and/or SEQ ID NO:78.
[0176] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:79 and/or a V.sub.L amino acid sequence of SEQ ID NO:80, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:79 and/or SEQ ID NO:80.
[0177] In some embodiments, the antibodies described herein comprise a V.sub.H amino acid sequence of SEQ ID NO:81 and/or a V.sub.L amino acid sequence of SEQ ID NO:82, or an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to SEQ ID NO:81 and/or SEQ ID NO:82.
[0178] In some embodiments, the antibodies described herein comprise a heavy chain CDR (HCDR) and a light chain CDR (LCDR) listed in Table 4, or a non-naturally occurring variant thereof. In some embodiments, the heavy chain CDR and/or light chain CDR can comprise one or more, e.g., 1, 2, 3, 4 or more, amino acid substitutions in the sequence shown in Table 4. In some embodiments, the one or more, e.g., 1, 2, 3, 4 or more, amino acid substitutions in the HCDR and/or LCDR sequence shown in Table 4 result in increased binding affinity of the antibody to SARS-Cov-2 antigens (e.g., the SARS-CoV-2 spike protein).
[0179] In some embodiments, the antibodies described herein comprise a heavy chain CDR1 (HCDR1), a heavy chain CDR2 (HCDR2), a heavy chain CDR3 (HCDR3), a light chain CDR1 (LCDR1), a light chain CDR2 (LCDR2), and/or a light chain CDR3 (LCDR3) amino acid sequence listed in a row (e.g., the same row) of Table 4. In some embodiments, the antibodies described herein comprise all six CDRS listed in a row (e.g., the same row) of Table 4 (e.g., all six of HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3).
[0180] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:83, a HCDR2 amino acid sequence of SEQ ID NO:84, a HCDR3 amino acid sequence of SEQ ID NO:85, a LCDR1 amino acid sequence of SEQ ID NO:86, a LCDR2 amino acid sequence of SEQ ID NO:87, and/or a LCDR3 amino acid sequence of SEQ ID NO:88, or a non-naturally occurring variant thereof.
[0181] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:89, a HCDR2 amino acid sequence of SEQ ID NO:90, a HCDR3 amino acid sequence of SEQ ID NO:91, a LCDR1 amino acid sequence of SEQ ID NO:92, a LCDR2 amino acid sequence of SEQ ID NO:93, and/or a LCDR3 amino acid sequence of SEQ ID NO:94, or a non-naturally occurring variant thereof.
[0182] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:95, a HCDR2 amino acid sequence of SEQ ID NO:96, a HCDR3 amino acid sequence of SEQ ID NO:97, a LCDR1 amino acid sequence of SEQ ID NO:98, a LCDR2 amino acid sequence of SEQ ID NO:99, and/or a LCDR3 amino acid sequence of SEQ ID NO:100, or a non-naturally occurring variant thereof.
[0183] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:101, a HCDR2 amino acid sequence of SEQ ID NO:102, a HCDR3 amino acid sequence of SEQ ID NO:103, a LCDR1 amino acid sequence of SEQ ID NO:104, a LCDR2 amino acid sequence of SEQ ID NO:105, and/or a LCDR3 amino acid sequence of SEQ ID NO:106, or a non-naturally occurring variant thereof.
[0184] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:107, a HCDR2 amino acid sequence of SEQ ID NO:108, a HCDR3 amino acid sequence of SEQ ID NO:109, a LCDR1 amino acid sequence of SEQ ID NO:110, a LCDR2 amino acid sequence of SEQ ID NO:111, and/or a LCDR3 amino acid sequence of SEQ ID NO:112, or a non-naturally occurring variant thereof.
[0185] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:113, a HCDR2 amino acid sequence of SEQ ID NO:114, a HCDR3 amino acid sequence of SEQ ID NO:115, a LCDR1 amino acid sequence of SEQ ID NO:116, a LCDR2 amino acid sequence of SEQ ID NO:117, and/or a LCDR3 amino acid sequence of SEQ ID NO:118, or a non-naturally occurring variant thereof.
[0186] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:119, a HCDR2 amino acid sequence of SEQ ID NO:120, a HCDR3 amino acid sequence of SEQ ID NO:121, a LCDR1 amino acid sequence of SEQ ID NO:122, a LCDR2 amino acid sequence of SEQ ID NO:123, and/or a LCDR3 amino acid sequence of SEQ ID NO:124, or a non-naturally occurring variant thereof.
[0187] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:125, a HCDR2 amino acid sequence of SEQ ID NO:126, a HCDR3 amino acid sequence of SEQ ID NO:127, a LCDR1 amino acid sequence of SEQ ID NO:128, a LCDR2 amino acid sequence of SEQ ID NO:129, and/or a LCDR3 amino acid sequence of SEQ ID NO:130, or a non-naturally occurring variant thereof.
[0188] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:131, a HCDR2 amino acid sequence of SEQ ID NO:132, a HCDR3 amino acid sequence of SEQ ID NO:133, a LCDR1 amino acid sequence of SEQ ID NO:134, a LCDR2 amino acid sequence of SEQ ID NO:135, and/or a LCDR3 amino acid sequence of SEQ ID NO:136, or a non-naturally occurring variant thereof.
[0189] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:137, a HCDR2 amino acid sequence of SEQ ID NO:138, a HCDR3 amino acid sequence of SEQ ID NO:139, a LCDR1 amino acid sequence of SEQ ID NO:140, a LCDR2 amino acid sequence of SEQ ID NO:141, and/or a LCDR3 amino acid sequence of SEQ ID NO:142, or a non-naturally occurring variant thereof.
[0190] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:143, a HCDR2 amino acid sequence of SEQ ID NO:144, a HCDR3 amino acid sequence of SEQ ID NO:145, a LCDR1 amino acid sequence of SEQ ID NO:146, a LCDR2 amino acid sequence of SEQ ID NO:147, and/or a LCDR3 amino acid sequence of SEQ ID NO:148, or a non-naturally occurring variant thereof.
[0191] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:149, a HCDR2 amino acid sequence of SEQ ID NO:150, a HCDR3 amino acid sequence of SEQ ID NO:151, a LCDR1 amino acid sequence of SEQ ID NO:152, a LCDR2 amino acid sequence of SEQ ID NO:153, and/or a LCDR3 amino acid sequence of SEQ ID NO:154, or a non-naturally occurring variant thereof.
[0192] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:155, a HCDR2 amino acid sequence of SEQ ID NO:156, a HCDR3 amino acid sequence of SEQ ID NO:157, a LCDR1 amino acid sequence of SEQ ID NO:158, a LCDR2 amino acid sequence of SEQ ID NO:159, and/or a LCDR3 amino acid sequence of SEQ ID NO:160, or a non-naturally occurring variant thereof.
[0193] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:161, a HCDR2 amino acid sequence of SEQ ID NO:162, a HCDR3 amino acid sequence of SEQ ID NO:163, a LCDR1 amino acid sequence of SEQ ID NO:164, a LCDR2 amino acid sequence of SEQ ID NO:165, and/or a LCDR3 amino acid sequence of SEQ ID NO:166, or a non-naturally occurring variant thereof.
[0194] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:167, a HCDR2 amino acid sequence of SEQ ID NO:168, a HCDR3 amino acid sequence of SEQ ID NO:169, a LCDR1 amino acid sequence of SEQ ID NO:170, a LCDR2 amino acid sequence of SEQ ID NO:171, and/or a LCDR3 amino acid sequence of SEQ ID NO:172, or a non-naturally occurring variant thereof.
[0195] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:173, a HCDR2 amino acid sequence of SEQ ID NO:174, a HCDR3 amino acid sequence of SEQ ID NO:175, a LCDR1 amino acid sequence of SEQ ID NO:176, a LCDR2 amino acid sequence of SEQ ID NO:177, and/or a LCDR3 amino acid sequence of SEQ ID NO:178, or a non-naturally occurring variant thereof.
[0196] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:179, a HCDR2 amino acid sequence of SEQ ID NO:180, a HCDR3 amino acid sequence of SEQ ID NO:181, a LCDR1 amino acid sequence of SEQ ID NO:182, a LCDR2 amino acid sequence of SEQ ID NO:183, and/or a LCDR3 amino acid sequence of SEQ ID NO:184, or a non-naturally occurring variant thereof.
[0197] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:185, a HCDR2 amino acid sequence of SEQ ID NO:186, a HCDR3 amino acid sequence of SEQ ID NO:187, a LCDR1 amino acid sequence of SEQ ID NO:188, a LCDR2 amino acid sequence of SEQ ID NO:189, and/or a LCDR3 amino acid sequence of SEQ ID NO:190, or a non-naturally occurring variant thereof.
[0198] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:191, a HCDR2 amino acid sequence of SEQ ID NO:192, a HCDR3 amino acid sequence of SEQ ID NO:193, a LCDR1 amino acid sequence of SEQ ID NO:194, a LCDR2 amino acid sequence of SEQ ID NO:195, and/or a LCDR3 amino acid sequence of SEQ ID NO:196, or a non-naturally occurring variant thereof.
[0199] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:197, a HCDR2 amino acid sequence of SEQ ID NO:198, a HCDR3 amino acid sequence of SEQ ID NO:199, a LCDR1 amino acid sequence of SEQ ID NO:200, a LCDR2 amino acid sequence of SEQ ID NO:201, and/or a LCDR3 amino acid sequence of SEQ ID NO:202, or a non-naturally occurring variant thereof.
[0200] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:203, a HCDR2 amino acid sequence of SEQ ID NO:204, a HCDR3 amino acid sequence of SEQ ID NO:205, a LCDR1 amino acid sequence of SEQ ID NO:206, a LCDR2 amino acid sequence of SEQ ID NO:207, and/or a LCDR3 amino acid sequence of SEQ ID NO:208, or a non-naturally occurring variant thereof.
[0201] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:209, a HCDR2 amino acid sequence of SEQ ID NO:210, a HCDR3 amino acid sequence of SEQ ID NO:211, a LCDR1 amino acid sequence of SEQ ID NO:212, a LCDR2 amino acid sequence of SEQ ID NO:213, and/or a LCDR3 amino acid sequence of SEQ ID NO:214, or a non-naturally occurring variant thereof.
[0202] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:215, a HCDR2 amino acid sequence of SEQ ID NO:216, a HCDR3 amino acid sequence of SEQ ID NO:217, a LCDR1 amino acid sequence of SEQ ID NO:218, a LCDR2 amino acid sequence of SEQ ID NO:219, and/or a LCDR3 amino acid sequence of SEQ ID NO:220, or a non-naturally occurring variant thereof.
[0203] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:221, a HCDR2 amino acid sequence of SEQ ID NO:222, a HCDR3 amino acid sequence of SEQ ID NO:223, a LCDR1 amino acid sequence of SEQ ID NO:224, a LCDR2 amino acid sequence of SEQ ID NO:225, and/or a LCDR3 amino acid sequence of SEQ ID NO:226, or a non-naturally occurring variant thereof.
[0204] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:227, a HCDR2 amino acid sequence of SEQ ID NO:228, a HCDR3 amino acid sequence of SEQ ID NO:229, a LCDR1 amino acid sequence of SEQ ID NO:230, a LCDR2 amino acid sequence of SEQ ID NO:231, and/or a LCDR3 amino acid sequence of SEQ ID NO:232, or a non-naturally occurring variant thereof.
[0205] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:233, a HCDR2 amino acid sequence of SEQ ID NO:234, a HCDR3 amino acid sequence of SEQ ID NO:235, a LCDR1 amino acid sequence of SEQ ID NO:236, a LCDR2 amino acid sequence of SEQ ID NO:237, and/or a LCDR3 amino acid sequence of SEQ ID NO:238, or a non-naturally occurring variant thereof.
[0206] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:239, a HCDR2 amino acid sequence of SEQ ID NO:240, a HCDR3 amino acid sequence of SEQ ID NO:241, a LCDR1 amino acid sequence of SEQ ID NO:242, a LCDR2 amino acid sequence of SEQ ID NO:243, and/or a LCDR3 amino acid sequence of SEQ ID NO:244, or a non-naturally occurring variant thereof.
[0207] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:245, a HCDR2 amino acid sequence of SEQ ID NO:246, a HCDR3 amino acid sequence of SEQ ID NO:247, a LCDR1 amino acid sequence of SEQ ID NO:248, a LCDR2 amino acid sequence of SEQ ID NO:249, and/or a LCDR3 amino acid sequence of SEQ ID NO:250, or a non-naturally occurring variant thereof.
[0208] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:251, a HCDR2 amino acid sequence of SEQ ID NO:252, a HCDR3 amino acid sequence of SEQ ID NO:253, a LCDR1 amino acid sequence of SEQ ID NO:254, a LCDR2 amino acid sequence of SEQ ID NO:255, and/or a LCDR3 amino acid sequence of SEQ ID NO:256, or a non-naturally occurring variant thereof.
[0209] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:257, a HCDR2 amino acid sequence of SEQ ID NO:258, a HCDR3 amino acid sequence of SEQ ID NO:259, a LCDR1 amino acid sequence of SEQ ID NO:260, a LCDR2 amino acid sequence of SEQ ID NO:261, and/or a LCDR3 amino acid sequence of SEQ ID NO:262, or a non-naturally occurring variant thereof.
[0210] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:263, a HCDR2 amino acid sequence of SEQ ID NO:264, a HCDR3 amino acid sequence of SEQ ID NO:265, a LCDR1 amino acid sequence of SEQ ID NO:266, a LCDR2 amino acid sequence of SEQ ID NO:267, and/or a LCDR3 amino acid sequence of SEQ ID NO:268, or a non-naturally occurring variant thereof.
[0211] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:269, a HCDR2 amino acid sequence of SEQ ID NO:270, a HCDR3 amino acid sequence of SEQ ID NO:271, a LCDR1 amino acid sequence of SEQ ID NO:272, a LCDR2 amino acid sequence of SEQ ID NO:273, and/or a LCDR3 amino acid sequence of SEQ ID NO:274, or a non-naturally occurring variant thereof.
[0212] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:275, a HCDR2 amino acid sequence of SEQ ID NO:276, a HCDR3 amino acid sequence of SEQ ID NO:277, a LCDR1 amino acid sequence of SEQ ID NO:278, a LCDR2 amino acid sequence of SEQ ID NO:279, and/or a LCDR3 amino acid sequence of SEQ ID NO:280, or a non-naturally occurring variant thereof.
[0213] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:281, a HCDR2 amino acid sequence of SEQ ID NO:282, a HCDR3 amino acid sequence of SEQ ID NO:283, a LCDR1 amino acid sequence of SEQ ID NO:284, a LCDR2 amino acid sequence of SEQ ID NO:285, and/or a LCDR3 amino acid sequence of SEQ ID NO:286, or a non-naturally occurring variant thereof.
[0214] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:287, a HCDR2 amino acid sequence of SEQ ID NO:288, a HCDR3 amino acid sequence of SEQ ID NO:289, a LCDR1 amino acid sequence of SEQ ID NO:290, a LCDR2 amino acid sequence of SEQ ID NO:291, and/or a LCDR3 amino acid sequence of SEQ ID NO:292, or a non-naturally occurring variant thereof.
[0215] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:293, a HCDR2 amino acid sequence of SEQ ID NO:294, a HCDR3 amino acid sequence of SEQ ID NO:295, a LCDR1 amino acid sequence of SEQ ID NO:296, a LCDR2 amino acid sequence of SEQ ID NO:297, and/or a LCDR3 amino acid sequence of SEQ ID NO:298, or a non-naturally occurring variant thereof.
[0216] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:299, a HCDR2 amino acid sequence of SEQ ID NO:300, a HCDR3 amino acid sequence of SEQ ID NO:301, a LCDR1 amino acid sequence of SEQ ID NO:302, a LCDR2 amino acid sequence of SEQ ID NO:303, and/or a LCDR3 amino acid sequence of SEQ ID NO:304, or a non-naturally occurring variant thereof.
[0217] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:305, a HCDR2 amino acid sequence of SEQ ID NO:306, a HCDR3 amino acid sequence of SEQ ID NO:307, a LCDR1 amino acid sequence of SEQ ID NO:308, a LCDR2 amino acid sequence of SEQ ID NO:309, and/or a LCDR3 amino acid sequence of SEQ ID NO:310, or a non-naturally occurring variant thereof.
[0218] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:311, a HCDR2 amino acid sequence of SEQ ID NO:312, a HCDR3 amino acid sequence of SEQ ID NO:313, a LCDR1 amino acid sequence of SEQ ID NO:314, a LCDR2 amino acid sequence of SEQ ID NO:315, and/or a LCDR3 amino acid sequence of SEQ ID NO:316, or a non-naturally occurring variant thereof.
[0219] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:317, a HCDR2 amino acid sequence of SEQ ID NO:318, a HCDR3 amino acid sequence of SEQ ID NO:319, a LCDR1 amino acid sequence of SEQ ID NO:320, a LCDR2 amino acid sequence of SEQ ID NO:321, and/or a LCDR3 amino acid sequence of SEQ ID NO:322, or a non-naturally occurring variant thereof.
[0220] In some embodiments, the antibodies described herein comprise a HCDR1 amino acid sequence of SEQ ID NO:323, a HCDR2 amino acid sequence of SEQ ID NO:324, a HCDR3 amino acid sequence of SEQ ID NO:325, a LCDR1 amino acid sequence of SEQ ID NO:326, a LCDR2 amino acid sequence of SEQ ID NO:327, and/or a LCDR3 amino acid sequence of SEQ ID NO:328, or a non-naturally occurring variant thereof.
[0221] The antibodies described herein can be monoclonal antibodies. In some embodiments, the antibody is an antibody fragment, e.g., a Fv, Fab, Fab, scFv, diabody, or F(ab).sub.2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an IgG antibody or other antibody class or isotype as defined herein. For a review of certain antibody fragments, see Hudson et al. Nat. Med. 9: 129-134 (2003). Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
[0222] In some embodiments an antibody described herein is in a monovalent format. In some embodiments, the antibody is in a fragment format, e.g., a Fv, Fab, Fab, scFv, diabody, or F(ab).sub.2 fragment.
[0223] In some embodiments, an antibody of the present disclosure is employed in a bispecific or multi-specific format. For example, in some embodiments, the antibody may be incorporated into a bispecific or multi-specific antibody that comprises a further binding domain that binds to the same or a different antigen.
[0224] In some embodiments, an antibody of the present disclosure comprises an Fc region that has effector function, e.g., exhibits antibody-dependent cellular cytotoxicity ADCC. In some embodiments, the Fc region may be an Fc region engineered to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or ADCC. Furthermore, an antibody of the disclosure may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) to alter its glycosylation, or to alter other functional properties of the antibody. Additional modifications may also be introduced. For example, the antibody can be linked to one of a variety of polymers, for example, polyethylene glycol.
Variants
[0225] Also provided are non-naturally occurring variants of the antibodies described herein. For example, the antibodies of the disclosure can be modified to include one or more amino acid substitutions in a heavy and/or light chain variable region CDR sequence in Table 4. In some embodiments, the heavy and/or light chain variable region CDR sequences can be modified to include 1, 2, 3, 4, or 5 amino acid substitutions relative to the sequence in Table 4.
[0226] The heavy and/or light chain variable regions can also include variants in the framework region. In some embodiments, one or more of the four framework regions (Framework 1, Framework 2, Framework 3 and/or Framework 4) can be modified to include one or more amino acid substitutions (e.g., 1, 2, 3, 4, 5, or more amino acid substitutions) relative to the natural or wild-type frameword sequence. In some embodiments, the modifications to the framework regions do not decrease binding affinity of the antibody to target SARS-CoV-2 antigens or epitopes. In some embodiments, the heavy and/or light chain variable regions can be modified to include variants in one or more of the framework regions only. In some embodiments, the heavy and/or light chain variable regions can be modified to include variants in one or more of the framework regions and not variants in the CDR sequences. Thus, in some embodiments, the antibody can comprise a modified VH region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to a VH amino acid sequence in Table 4, wherein the sequence variations relative to the VH amino acid sequence in Table 4 are in the framework region only. In some embodiments, the antibody can comprise a modified VL region having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity) to a VH amino acid sequence in Table 4, wherein the sequence variations relative to the VL amino acid sequence in Table 4 are in the framework region only.
Pharmaceutical Compositions
[0227] In a further aspect, provided herein are pharmaceutical compositions for administration of an anti-SARS-CoV-2 antibody described herein to a mammalian subject, such as a human or companion animal, who is either at risk of infection with SARS-CoV-2, who has been exposed to a known SARS-CoV-2 case or who is infected with SARS-CoV-2 or has symptoms of coronavirus disease 2019 (COVID-19). The pharmaceutical composition can be administered in an amount and according to a schedule sufficient to prevent infection by SARS-CoV-2, to prevent development of disease following exposure to SARS-CoV-2, to prevent development of severe disease following exposure to SARS-CoV-2, or to reduce a symptom of COVID-19 disease. Such compositions may comprise an antibody described herein, or a polynucleotide encoding the antibody, and a pharmaceutically acceptable diluent or carrier. In some embodiments, a polynucleotide encoding the antibody may be contained in a plasmid vector for delivery, or a viral vector. In some embodiments, the pharmaceutical composition comprises a therapeutically effective amount of the antibody. As used herein, a therapeutically effective dose or a therapeutically effective amount refers to an amount sufficient to prevent, cure, or treat one or more symptoms of COVID-19 disease. A therapeutically effective dose can be determined by monitoring a patient's response to therapy. Typical benchmarks indicative of a prophylactically effective dose include prevention of SARS-CoV-2 infection, or if infected, reduced severity of COVID-19 disease symptoms. Typical benchmarks indicative of a therapeutically effective dose include amelioration or prevention of symptoms of COVID-19 disease in the patient, including, for example, reduction in lung inflammation. Amounts effective for either prophylactic or therapeutic use will depend upon the severity of the disease and the general state of the patient's health, including other factors such as age, weight, gender, administration route, and the like. Single or multiple administrations of the antibody will be dependent on the dosage and frequency as required and tolerated by the patient.
[0228] As used herein, a prophylactically effective dose or a prophylactically effective amount refers to an amount sufficient to prevent infection by SARS-CoV-2 or onset of one or more symptoms of COVID-19 disease.
[0229] Various pharmaceutically acceptable diluents, carriers, and excipients, and techniques for the preparation and use of pharmaceutical compositions will be known to those of skill in the art in light of the present disclosure. Illustrative pharmaceutical compositions and pharmaceutically acceptable diluents, carriers, and excipients are also described in Remington: The Science and Practice of Pharmacy 20th Ed. (Lippincott, Williams & Wilkins 2012). In particular embodiments, each carrier, diluent or excipient is acceptable in the sense of being compatible with the other ingredients of the pharmaceutical composition and not injurious to the subject. Often, the pharmaceutically acceptable carrier is an aqueous pH-buffered solution. Some examples of materials which can serve as pharmaceutically-acceptable carriers, diluents or excipients include: water; buffers, e.g., phosphate-buffered saline; sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
[0230] The pharmaceutical composition can be formulated for any suitable route of administration, including for example, systemic, parenteral, intrapulmonary, intranasal, or local administration. Parenteral administration can include intramuscular, intravenous (e.g., as a bolus or by continuous infusion over a period of time), intraarterial, intraperitoneal, intracerobrospinal, intrasynovial, inhalation, oral or subcutaneous administration. In certain embodiments, the pharmaceutical composition is formulated for intravenous administration and has a concentration of antibody of 10.sup.100 mg/mL, 10.sup.50 mg/mL, 20 to 40 mg/mL, or about 30 mg/mL. In certain embodiments, the pharmaceutical composition is formulated for subcutaneous injection and has a concentration of antibody of 50-500 mg/mL, 50-250 mg/mL, or 100 to 150 mg/mL, and a viscosity less than 50 cP, less than 30 cP, less than 20 cP, or about 10 cP. In some embodiments, the pharmaceutical compositions are liquids or solids. In particular embodiments, the pharmaceutical compositions are formulated for parenteral, e.g., intravenous, subcutaneous, intraperiotoneal, or intramuscular administration. A subject may be administered an antibody or pharmaceutical composition comprising an antibody of the present disclosure one or more times; and may be administered before, after, or concurrently with another therapeutic agent as further described below.
[0231] Formulations include those in which the antibody is encapsulated in micelles, liposomes or drug-release capsules (active agents incorporated within a biocompatible coating designed for slow-release); ingestible formulations; formulations for topical use, such as creams, ointments and gels; and other formulations such as inhalants, aerosols and sprays.
[0232] In some embodiments, e.g., for parenteral administration, the antibodies or antigen-binding fragments thereof are formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle. Examples of such vehicles are water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Nonaqueous vehicles such as fixed oils and ethyl oleate may also be used.
[0233] The dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the viral infection, the characteristics of the subject, and the subject's history. In particular embodiments, the amount of antibody or antigen-binding fragment thereof administered or provided to the subject is in the range of about 0.1 mg/kg to about 50 mg/kg of the subject's body weight. Depending on the type and severity of the infection, in certain embodiments, about 0.1 mg/kg to about 50 mg/kg body weight (e.g., about 0.1-50 mg/kg/dose) of antibody or antigen-binding fragment thereof may be provided as an initial candidate dosage to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The progress of the therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art.
Vectors
[0234] In some aspects, a composition described herein includes a vector. In some embodiments, the vector comprises one or more polynucleotide sequences that encode an antibody described herein, or encode a heavy and light chain described herein. In some embodiments, the vector comprises one or more polynucleotide sequences that encode a cognate pair of heavy and light chains described herein. In some embodiments, the vector comprises one or more polynucleotide sequences that encode an antibody described in Table 3, or a non-naturally occurring variant thereof. In some embodiments, the vector comprises one or more polynucleotide sequences that encode a VH or VL amino acid sequence in Table 3, or a non-naturally occurring variant thereof. In some embodiments, the vector comprises one or more polynucleotide sequences that encode a VH and VL amino acid sequence in Table 3, or a non-naturally occurring variant thereof. In some embodiments, the vector comprises one or more polynucleotide sequences that encode a VH and VL amino acid sequence in a row (e.g., the same row) of Table 3, or a non-naturally occurring variant thereof. In some embodiments, the vector comprises one or more polynucleotide sequences that encode an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to a VH and/or VL amino acid sequence in Table 3. In some embodiments, the vector comprises one or more polynucleotide sequences that encode an amino acid sequence having at least 70% sequence identity (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to a VH and/or VL amino acid sequence in a row (e.g., the same row) of Table 3.
[0235] In some embodiments, the vector comprises one or more polynucleotide sequences that encode a CDR (e.g., one or more CDRs) in Table 4, for example an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and/or LCDR3 in Table 4, or non-naturally occurring variants thereof. In some embodiments, the vector comprises one or more polynucleotide sequences that encode a CDR (e.g., one or more CDRs) in Table 4, for example an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and/or LCDR3 in a row (e.g., the same row) of Table 4, or non-naturally occurring variants thereof.
[0236] Vectors can be used in the transformation of a host cell with a nucleic acid sequence. In some aspects, a vector can include one or more polynucleotides encoding an antibody described herein. In one embodiment, a library of nucleic acid sequences encoding an antibody described herein may be introduced into a population of cells, thereby allowing screening of a library. The term vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. A nucleic acid sequence can be exogenous or heterologous which means that it is foreign to the cell into which the vector is being introduced, or that the sequence is homologous to a sequence in the cell but is operably linked to sequences in the vector that are different than the endogenous genomic regulatory sequences. Vectors include plasmids, cosmids, and viruses (e.g., bacteriophage). One of skill in the art may construct a vector through standard recombinant techniques, which are described in Maniatis et al., 1988 and Ausubel et al., 1994, both of which references are incorporated herein by reference. In some aspects, a vector can be a vector with the constant regions of an antibody pre-engineered in. In this way, one of skill can clone just the VDJ regions of an antibody of interest and clone those regions into the pre-engineered vector.
[0237] The term expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. Expression vectors can contain a variety of control sequences, which refer to nucleic acid sequences for the transcription and possibly translation of an operably linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.
[0238] In some aspects, a vector can include a promoter. In some aspects, a vector can include an enhancer. A promoter is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors. The phrases operatively positioned, operatively linked, under control, and under transcriptional control mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence. A promoter may or may not be used in conjunction with an enhancer, which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
[0239] A promoter may be one naturally associated with a gene or sequence, as may be obtained by isolating the 5 non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as endogenous. Similarly, an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other prokaryotic cell, and promoters or enhancers not naturally occurring, i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR, in connection with the compositions disclosed herein (see U.S. Pat. Nos. 4,683,202, 5,928,906, each incorporated herein by reference).
[0240] In some aspects, a promoter and/or enhancer that effectively directs the expression of the DNA segment in the cell type chosen for expression. One example of such promoter that may be used is the E. coli arabinose or T7 promoter. Those of skill in the art of molecular biology generally are familiar with the use of promoters, enhancers, and cell type combinations for protein expression, for example, see Sambrook et al. (1989), incorporated herein by reference. The promoters employed may be constitutive, tissue-specific, inducible, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides. The promoter may be heterologous or endogenous.
[0241] In some aspects, vectors can include initiation signals and/or internal ribosome binding sites. A specific initiation signal also may be included for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals. It is well known that the initiation codon must be in-frame with the reading frame of the desired coding sequence to ensure translation of the entire insert. The exogenous translational control signals and initiation codons can be either natural or synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements.
[0242] In some aspects, a vector can include sequences that increase or optimize the expression level of the DNA segment encoding the gene of interest. An example of such sequences includes addition of introns in the expressed mRNA (Brinster, R. L. et al. (1988) Introns increase transcriptional efficiency in transgenic mice. Proc. Natl. Acad. Sci. USA 85, 836-40; Choi, T. et al. (1991) A generic intron increases gene expression in transgenic mice. Mol. Cell. Biol. 11, 3070-4). Another example of a method for optimizing expression of the DNA segment is codon optimization. Codon optimization involves insertion of silent mutations in the DNA segment to reduce the use of rare codons to optimize protein translation (Codon engineering for improved antibody expression in mammalian cells. Carton J M, Sauerwald T, Hawley-Nelson P, Morse B, Peffer N, Beck H, Lu J, Cotty A, Amegadzie B, Sweet R. Protein Expr Purif 2007 October; 55(2):279-86. Epub 2007 Jun. 16).
[0243] In some aspects, a vector can include multiple cloning sites. Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector (see Carbonelli et al., 1999, Levenson et al., 1998, and Cocea, 1997, incorporated herein by reference.) Restriction enzyme digestion refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is understood by those of skill in the art. Frequently, a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector. Ligation refers to the process of forming phosphodiester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.
[0244] In some aspects, a vector can include a termination signal. The vectors or constructs will generally comprise at least one termination signal. A termination signal or terminator is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase. Thus, in certain embodiments, a termination signal that ends the production of an RNA transcript is contemplated. A terminator may be necessary in vivo to achieve desirable message levels.
[0245] Terminators contemplated for use include any known terminator of transcription described herein or known to one of ordinary skill in the art, including but not limited to, for example, rho dependent or rho independent terminators. In certain embodiments, the termination signal may be a lack of transcribable or translatable sequence, such as due to a sequence truncation.
[0246] In some aspects, a vector can include an origin of replication.
[0247] In order to propagate a vector in a host cell, it may contain one or more origins of replication sites (often termed ori), which is a specific nucleic acid sequence at which replication is initiated.
[0248] In some aspects, a vector can include one or more selectable and/or screenable markers. In certain embodiments, cells containing a nucleic acid construct may be identified in vitro or in vivo by including a marker in the expression vector. Such markers would confer an identifiable change to the cell permitting easy identification of cells containing the expression vector. Generally, a selectable marker is one that confers a property that allows for selection. A positive selectable marker is one in which the presence of the marker allows for its selection, while a negative selectable marker is one in which its presence prevents its selection. An example of a positive selectable marker is a drug resistance marker.
[0249] Usually the inclusion of a drug selection marker aids in the cloning and identification of transformants, for example, genes that confer resistance to neomycin, puromycin, hygromycin, DHFR, GPT, zeocin and histidinol are useful selectable markers. In addition to markers conferring a phenotype that allows for the discrimination of transformants based on the implementation of conditions, other types of markers including screenable markers such as GFP, whose basis is colorimetric analysis, are also contemplated. Alternatively, screenable enzymes such as chloramphenicol acetyltransferase (CAT) may be utilized. One of skill in the art would also know how to employ immunologic markers, possibly in conjunction with FACS analysis. The marker used is not believed to be important, so long as it is capable of being expressed simultaneously with the nucleic acid encoding a gene product. Further examples of selectable and screenable markers are well known to one of skill in the art.
[0250] In one aspect, the vector can express DNA segments encoding multiple polypeptides of interest. For example, DNA segments encoding both the immunoglobulin heavy chain and light chain can be encoded and expressed by a single vector. In one aspect, both DNA segments can be included on the same expressed RNA and internal ribosome binding site (IRES) sequences used to enable expression of the DNA segments as separate polypeptides (Pinkstaff J K, Chappell S A, Mauro V P, Edelman G M, Krushel L A., Internal initiation of translation of five dendritically localized neuronal mRNAs., Proc Natl Acad Sci USA. 2001 Feb. 27; 98(5):2770-5. Epub 2001 Feb. 20). In another aspect, each DNA segment has its own promoter region resulting in expression of separate mRNAs (Andersen C R, Nielsen L S, Baer A, Tolstrup A B, Weilguny D. Efficient Expression from One CMV Enhancer Controlling Two Core Promoters. Mol Biotechnol. 2010 Nov. 27. [Epub ahead of print]).
Host Cells and Expression Systems
[0251] In some aspects, a composition can include a host cell. In some aspects, a host cell can include a polynucleotide or vector described herein. In some aspects, a host cell can include a eukaryotic cell (e.g., insect, yeast, or mammalian) or a prokaryotic cell (e.g., bacteria). In the context of expressing a heterologous nucleic acid sequence, host cell can refer to a prokaryotic cell, and it includes any transformable organism that is capable of replicating a vector and/or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors. A host cell may be transfected or transformed, which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny.
[0252] In particular embodiments, a host cell is a Gram negative bacterial cell. These bacteria are suited for use in that they possess a periplasmic space between the inner and outer membrane and, particularly, the aforementioned inner membrane between the periplasm and cytoplasm, which is also known as the cytoplasmic membrane. As such, any other cell with such a periplasmic space could be used. Examples of Gram negative bacteria include, but are not limited to, E. coli, Pseudomonas aeruginosa, Vibrio cholera, Salmonella typhimurium, Shigella flexneri, Haemophilus influenza, Bordotella pertussi, Erwinia amylovora, Rhizobium sp. The Gram negative bacterial cell may be still further defined as bacterial cell which has been transformed with the coding sequence of a fusion polypeptide comprising a candidate binding polypeptide capable of binding a selected ligand. The polypeptide is anchored to the outer face of the cytoplasmic membrane, facing the periplasmic space, and may comprise an antibody coding sequence or another sequence. One means for expression of the polypeptide is by attaching a leader sequence to the polypeptide capable of causing such directing.
[0253] Numerous prokaryotic cell lines and cultures are available for use as a host cell, and they can be obtained through the American Type Culture Collection (ATCC), which is an organization that serves as an archive for living cultures and genetic materials. An appropriate host can be determined by one of skill in the art based on the vector backbone and the desired result. A plasmid or cosmid, for example, can be introduced into a prokaryote host cell for replication of many vectors. Bacterial cells used as host cells for vector replication and/or expression include DH5-alpha, JM109, and KC8, as well as a number of commercially available bacterial hosts such as SURE Competent Cells and SOLOPACK Gold Cells (STRATAGENE, La Jolla). In some aspects, other bacterial cells such as E. coli LE392 are contemplated for use as host cells.
[0254] Many host cells from various cell types and organisms are available and would be known to one of skill in the art. Similarly, a viral vector may be used in conjunction with a prokaryotic host cell, particularly one that is permissive for replication or expression of the vector. Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
[0255] In some aspects, a host cell is mammalian. Examples include CHO cells, CHO-Kl cells, or CHO-S cells. Other mammalian host cells include NS0 cells and CHO cells that are dhfr-, e.g., CHO-dhfr-, DUKX-B11 CHO cells, and DG44 CHO cells.
[0256] Numerous expression systems exist can that comprise at least a part or all of the compositions disclosed herein. Expression systems can include eukaryotic expression systems and prokaryotic expression systems. Such systems could be used, for example, for the production of a polypeptide product identified as capable of binding a particular ligand. Prokaryote-based systems can be employed to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides. Many such systems are commercially and widely available. Other examples of expression systems comprise of vectors containing a strong prokaryotic promoter such as T7, Tac, Trc, BAD, lambda pL, Tetracycline or Lac promoters, the pET Expression System and an E. coli expression system.
[0257] In some embodiments, vertebrate host cells are used for producing the antibodies of the present disclosure. For example, mammalian cell lines such as a monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J Gen Virol. 36:59, 1977; baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251, 1980 monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68, 1982; MRC 5 cells; and FS4 cells may be used to express anti-coronavirus antibodies. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216, 1980); and myeloma cell lines such as Y0, NS0 and Sp2/0. Host cells of the present disclosure also include, without limitation, isolated cells, in vitro cultured cells, and ex vivo cultured cells. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268, 2003. In some embodiments, the cell is a hybridoma that expresses an antibody of the present disclosure.
[0258] A host cell transfected with an expression vector encoding an anti-SARS-CoV-2 antibody of the present disclosure, or fragment thereof, can be cultured under appropriate conditions to allow expression of the polypeptide to occur. The polypeptides may be secreted and isolated from a mixture of cells and medium containing the polypeptides. Alternatively, the polypeptide may be retained in the cytoplasm or in a membrane fraction and the cells harvested, lysed, and the polypeptide isolated using a desired method.
Methods
[0259] The methods described herein can include, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Green & Sambrook, et al., Molecular Cloning: A Laboratory Manual (4th Edition, 2012); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pennsylvania: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3rd Ed. (Plenum Press) Vols A and B(1992); Current Protocols in Molecular Biology (2002-; Wiley; Online ISBN: 9780471142720; DOI: 10.1002/04711142727); Current Protocols in Immunology (2001-; Wiley; Online ISBN: 9780471142737; DOI: 10.1002/0471142735).
Methods of Generating Variants
[0260] Methods for producing variants include identifying the heavy and light chain sequences (nucleic acid or amino acid) of naturally occurring antibodies, and introducing mutations therein that result in increased binding to SARS-CoV-2 antigens, enhanced neutralizing activity, improved developability, and/or reduced risk of clinical immunogenicity, as described below.
Binding Activity
[0261] The activity of antibodies or variants thereof as described herein can be assessed for binding to SARS-CoV-2 antigens, such as the S protein or receptor binding domain (RBD). Binding can be determined using any assay that measures binding to SARS-CoV-2 antigens, e.g., surface plasmon resonance (SPR) analysis using a biosensor system or bio-layer interferometry (BLI) or enzyme linked immunosorbent assay (ELISA). Systems suitable for use in SPR are commercially available, for example, LSA (Carterra, Dublin, CA), Biacore (General Electric, Boston, MA), and OpenSPR (Nicoya, East Kitchener, ON, Canada). Systems suitable for use in BLI include, but are not limited to, Octet (ForteBio, Fremont, CA) and Gator (Probelife, Palo Alto, CA). In an exemplary SPR assay, each antibody or variant thereof can be either directly immobilized to a Carterra CMD200M Chip or captured to the CMD200M Carterra Chip with a goat anti-human IgG Fc antibody. The uncoupled antibodies can be washed off and various concentration gradients of the targets can be flowed over the antibodies. In some cases the highest concentration of each target can be in the range 0.5-8 g/mL. For better accuracy, each antibody can be immobilized in different locations (e.g., at least 2) on the chip and the affinity for each antibody-target combination can be determined using multiple (e.g., 4-5) target concentrations according to standard methods. In some cases, if variation between the two duplicates is >3-fold, the antibody-target measurement is repeated. For BLI, each of the antigens can be immobilized on sensors according to the manufacturer's instructions. In one illustrative example, the antigen can be biotinylated and immobilized to streptavidin sensors. For better accuracy, each antibody can be evaluated in replicates at a suitable concentration (e.g., 5 g/mL). In some cases, if variation between the two duplicates is >3-fold, the antibody-target measurement is repeated. The assays are typically performed under conditions according to the manufacturer's instructions. In some cases, the assays are performed under a temperature in the range of 20 C. to 37 C., for example 20 C.-25 C. In one embodiment, the assay is performed at 25 C. In one embodiment, the assay is performed at 37 C.
[0262] In some embodiments, binding to SARS-CoV-2 antigens is assessed in a competitive assay format with a reference antibody or a reference antibody having the same variable regions. In some embodiments, an antibody or variant thereof may block binding of the reference antibody in a competition assay by about 50% or more.
Functional Assays
[0263] Antibodies of the present disclosure may also be evaluated in various assays for their ability to mediate FcR-dependent activity. In some embodiments, either plasma or serum obtained from patients potentially infected, or with known infections, of SARS-CoV-2, or an antibody of the present disclosure has enhanced antibody dependent cellular cytotoxicity (ADCC), antibody dependent cellular phagocytosis (ADCP), or complement-dependent cytoxicity (CDC), or neutralization activity as and/or serum stability compared to a control or reference antibody when the antibodies are assayed in a human IgG1 isotype format.
[0264] Examples of neutralization assays that employ fully infections SARS-CoV-2 virus include focus-forming assays and plaque-reduction assays. Alternatively, neutralization assays may employ a pseudotyped virus system where a chimeric virus particle is generated by combining plasmids encoding the genetic material for a backbone viral system, such as Vesicular stomatitis virus, with a second plasmid encoding the spike protein that sits on the surface of the virus. Such a pseudotyped virus can infect the same cells susceptible to fully infectious SARS-CoV-2 virus, but cannot form viral progeny. Breadth and potency are two typical measures that may be employed to characterize an antibody's neutralizing activity. Breadth is the proportion of tested viruses with IC50 scores that fall below an IC50 cutoff value for neutralizing activity. Potency can be calculated using the geometric mean IC50 (see, e.g., Hraber et al., J Virol. 88:12623-43, 2014).
[0265] In some embodiments, activity of an antibody or variant thereof is evaluated in vivo in an animal model, e.g., as described in the Examples section. In one embodiment, the assay comprises passive transfer/challenge experiments in a Syrian hamster animal model.
[0266] A variant as described herein has at least 50%, or at least 60%, or 70%, or greater, of neutralizing activity of a reference antibody (e.g., an unmodified antibody or a modified parent antibody) when evaluated under the same assay conditions. In some embodiments, an antibody exhibits increased activity, i.e., greater than 100%, activity compared to a reference antibody. In some embodiments, the antibody or variants disclosed herein have similar activity against SARS-CoV-2 infection as compared to a reference antibody. The term similar activity, when used to compare in vivo activity of antibodies, refers to two measurements of the activity which are no more than 30%, no more than 25%, no more than 20%, no more than 15% different, no more than 10%, no more than 8%, or no more than 5% different from each other.
[0267] In some embodiments, the antibody or variant thereof is modified to have improved developability (i.e., reduced development liabilities), including but not limited to, decreased heterogeneity, increased yield, increased stability, improved net charges to improve pharmacokinetics, and or/reduced immunogenicity. In some embodiments, antibodies having improved developability can be obtained by introducing mutations to reduce or eliminate potential development liabilities, as described in Table 7 or Table 8. In some embodiments, antibodies having improved developability possess modifications as compared to a reference or control antibody in their amino acid sequence.
[0268] In some embodiments, the antibodies or variants thereof disclosed herein have improved developability while maintaining comparable or improved binding affinity to the target antigen as compared to a reference or control (unmodified) antibody. In some embodiments, the antibodies or variants thereof disclosed herein have improved developability while maintaining activities that are similar to a reference or control (unmodified) antibody.
[0269] In some embodiments, the antibodies or variants thereof have improved developability, e.g., as identified through various in vitro assays, such as aggregation assessment by HPLC or UPLC, hydrophobic interaction chromatography (HIC), polyspecificity assays (e.g., baculovirus particle binding), self-interaction nanoparticle spectroscopy (SINS), or mass spec analysis after incubation in an accelerated degradation condition such as high temperature, low pH, high pH, or oxidative H.sub.2O.sub.2. Mutations are successful if activity is maintained (or enhanced) while removing or reducing the severity of the liability.
[0270] Improved properties of antibodies or variants thereof as described herein include: (1) fits a standard platform (expression, purification, formulation); (2) high yield; (3) low heterogeneity (glycosylation, chemical modification, and the like); (4) consistent manufacturability (batch-to-batch, and small-to-large scale); (5) high stability (years in liquid formulation), e.g., minimal chemical degradation, fragmentation, and aggregation; and (6) long PK (in vivo half-life), e.g., no off-target binding, no impairment of FcRn recycling, and stable. Antibody liabilities are further described in Table 7.
TABLE-US-00001 TABLE 7 Description of development liabilities sequence comprises an Yield, heterogeneity, odd number of Free cysteine.sup.6 stability, activity cysteines High N-linked glycosylation Yield, heterogeneity, activity N(~P)(S, T).sup.1 High Abnormal net charge Platform fit, PK Sharma 2014.sup.2 High Patches of Stability, PK Sharma 2014 High hydrophobicity Patches of same charge Stability, PK N/A (based on Medium structure) Proteolysis Stability, PK (K, R)(K, R).sup.3 Medium Proteolysis Stability, PK DP Medium Asparagine deamidation Heterogeneity, stability, NG; Medium; activity N(A, N, S, T).sup.4 Low Aspartate isomerization Heterogeneity, stability, DG; Medium; activity D(A, D, S, T).sup.5 Low Lysine glycation Heterogeneity, stability, K Low activity Methionine oxidation Heterogeneity, stability, M Low activity Tryptophan oxidation Heterogeneity, stability, W Low activity Note: .sup.1The N-linked glycosylation site is N-X-S/T, where X is any residue other than proline. .sup.2Sharma et al., Proc. Natl. Acad. Sci. USA 111: 18601-18606, 2014 .sup.3This motif consists of a K or R, followed by a K or R. Stated differently, the motif can be KK, KR, RK, or RR. .sup.4The dipeptide NG poses a medium risk of development liability. The dipeptides NA, NN, NS, and NT pose a low risk of development liability. N may also exhibit low risk of liability for other successor residues, e.g., D, H, or P. Stated differently, dipeptide ND, NH, or NP poses a low risk of development liability. .sup.5Similary to the above, the dipeptide DG poses a medium risk of development liability. The dipeptides DA, DD, DS, and DT pose a low risk of development liability. D may also exhibit low risk of development liability for other successor residues, e.g., N, H, or P. .sup.6Free cysteine refers to a cysteine that does not form a disulfide bond with another cysteine and thus is left free as thiols. The presence of free cysteines in the antibody can be a 5 potential development liability. Typically, an odd net number of cysteines in the protein shows a likelihood there is a free cysteine.
[0271] Another goal for engineering variants is to reduce the risk of clinical immunogenicity: the generation of anti-drug antibodies against the therapeutic antibody. To reduce risk, the antibody sequences are evaluated to identify residues that can be engineered to increase similarity to the intended population's native immunoglobulin variable region sequences.
[0272] The factors that drive clinical immunogenicity can be classified into two groups. First are factors that are intrinsic to the drug, such as: sequence; post-translational modifications; aggregates; degradation products; and contaminants. Second are factors related to how the drug is used, such as: dose level; dose frequency; route of administration; patient immune status; and patient HLA type.
[0273] One approach to engineering a variant to be as much like self as possible is to identify a close germline sequence and mutate as many mismatched positions (also known as germline deviations) to the germline residue type as possible. This approach applies for germline genes IGHV, IGHJ, IGKV, IGKJ, IGLV, and IGLJ, and accounts for all of the variable heavy (VH) and variable light (VL) regions except for part of H-CDR3. Germline gene IGHD codes for part of the H-CDR3 region but typically exhibits too much variation in how it is recombined with IGHV and IGHJ (e.g., forward or reverse orientation, any of three translation frames, and 5 and 3 modifications and non-templated additions) to present a self sequence template from a population perspective.
[0274] Each germline gene can present as different alleles in the population. The least immunogenic drug candidate, in terms of minimizing the percent of patients with an immunogenic response, would likely be one which matches an allele commonly found in the patient population. Single nucleotide polymorphism (SNP) data from the human genome can be used to approximate the frequency of alleles in the population.
[0275] Another approach to engineering a lead for reduced immunogenicity risk is to use in silico predictions of immunogenicity, such as the prediction of T cell epitopes, or use in vitro assays of immunogenicity, such as ex vivo human T cell activation. For example, services such as those offered by Lonza, United Kingdom, are available that employ platforms for prediction of HLA binding and in vitro assessment to further identify potential epitopes.
[0276] Antibody variants can be designed to enhance the efficacy of the antibody. In some embodiments, design parameters can focus on CDRs, e.g., CDR3. Positions to be mutated can be identified based on structural analysis of antibody-antigen co-crystals (Oyen et al., Proc. Natl. Acad Sci. USA 114:E10438-E10445, 2017; Epub Nov. 14 2017) and based on sequence information of other antibodies from the same lineage.
Approaches to Mutation Design
[0277] Development liabilities can be removed or reduced by one or more mutations. Mutations are designed to preserve antibody structure and function while removing or reducing development liabilities and to improve function. In some embodiments, mutations to chemically similar residues can be identified that maintain size, shape, charge, and/or polarity. Illustrative mutations are described in Table 8.
TABLE-US-00002 TABLE 8 preferred mutations to remove development liabilities .fwdarw. Free cysteine Odd # C High C.fwdarw.(A, S) N-linked glycosylation N(~P)(S, T) High N.fwdarw.(Q, D, S, A); (S, T).fwdarw.(A, N) Proteolytic cleavage (K, R)(K, R) Medium K, R.fwdarw.(Q, S, A) Proteolytic cleavage DP Medium D.fwdarw.(E, S, A) Asparagine deamidation NG; Medium; Low N.fwdarw.(Q, S, A); G.fwdarw.(A, S) N(A, N, S, T)* Aspartate isomerization DG; Medium; Low D.fwdarw.(E, S, A); G.fwdarw.(A, S) D(A, D, S, T)* Lysine glycation K Low K.fwdarw.(R, Q, S, A) Methionine oxidation M Low M.fwdarw.(Q, L, S, A) Tryptophan oxidation W Low W.fwdarw.(Y, F) Note: the last column of Table 8 shows preferred mutations. For example, C.fwdarw.(A, S) refers to that C can be mutated to either A or S in order to remove development liabilities.
In Vitro Assays
Neutralizing Assays
[0278] In some embodiments, in vitro assays can be used to determine if the antibodies described herein produce a neutralizing response to SARS-CoV-2. In some embodiments, an assay using live, or replication-competent virus can be used. In some embodiments, a pseudovirus (PSV) neutralization assay can be used. In some embodiments, the target cells used in the neutralization assays are HeLa cells that express the cell surface receptor ACE2. In some embodiments, the target cells used in the neutralization assays are cells of the Vero E6 cell line.
[0279] In some embodiments, a neutralization assay can be used to determine inhibition of virus infectivity in cell culture in the presence of a single antibody or a combination of antibodies as described herein. In some embodiments, a neutralization assay can also be used to determine inhibition of virus infectivity in cell culture in the presence of serum or plasma from a potentially infected, or confirmed infected animal or human.
Binding Affinity Assays
[0280] In some embodiments, the assay is a Bio-layer interferometry (BLI) assay. An exemplary BLI assay is described in the Examples. In some embodiments, the assay is a Surface Plasmon Resonance (SPR) assay. An exemplary SPR assay is described in the Examples.
Other In Vitro Assays
[0281] In some embodiments, the assay is an enzyme-linked immunosorbent assay (ELISA) that detects binding of the antibody to a coronavirus antigen, such as a SARS-CoV-2 antigen. One example of a serological ELISA is described in Amanat, F. et al., A serological assay to detect SARS-CoV-2 seroconversion in humans (doi.org/10.1101/2020.03.17.20037713). Another example is described in Krammer, F. and Simon, V., Serology assays to manage COVID-19, Science, Published Online 15 May 2020 (DOI: 10.1126/science.abc1227).
[0282] In some embodiments, a lateral flow assay can be used to detect antibodies described herein in bodily fluids derived from a subject, such as blood serum or plasma. In some embodiments, the assay is a Western-blot assay.
[0283] In some embodiments, the assay is a transcytosis assay to determine IgG trafficking in vitro. Examples of suitable transcytosis assays are described in Claudia A. Castro Jaramillo, et al. (2017) Toward in vitro-to-in vivo translation of monoclonal antibody pharmacokinetics: Application of a neonatal Fc receptor-mediated transcytosis assay to understand the interplaying clearance mechanisms, mAbs, 9:5, 781-791, DOI: 10.1080/19420862.2017.1320008; and Chung S, Nguyen V, Lin Y L, et al. An in vitro FcRn-dependent transcytosis assay as a screening tool for predictive assessment of nonspecific clearance of antibody therapeutics in humans. MAbs. 2019; 11(5):942-955. doi:10.1080/19420862.2019.1605270.
T Cell Assays
[0284] Other assays include determining T cell responses to infection by SARS-CoV-2. Such assays include determining CD4+ and CD8+ T cell responses. One assay for determining CD4+ T cell responses is a T cell receptor- (TCR) dependent Activation Induced Marker (AIM) assay, which allow for the quantification of SARS-CoV-2-specific CD4+ T cells in subjects who were exposed to SARS-CoV-2 or who recovered from COVID-19. Markers for CD4+ T cells include OX40 and CD137. Assays for determining CD8+ T cell responses include AIM assays and intracellular cytokine staining (ICS). Markers for CD8+ T cells include CD69 and CD137. The expression of cytokines such as IFN, granzynme B, and TNF can be used for ICS.
In Vivo Assays
[0285] In some embodiments, in vivo assays can be used to determine if the antibodies described herein produce a neutralizing response to SARS-CoV-2. In one embodiment, the in vivo assay comprises passive transfer/challenge experiments in a Syrian hamster animal model, as described in the Examples. In other embodiments, transgenic mice expressing the human ACE2 receptor, or non-human primates, can be used. Assays describing all three models are described in the Examples.
Methods of Producing or Generating Antibodies that Bind SARS-CoV-2
[0286] The antibodies described herein can be produced using multiple different technologies, such as 1) isolation of antibodies of interest from B cells of a subject that mounted an immune response to the virus; and 2) isolation of antibodies derived from expression libraries of immunoglobulin molecules, or derivatives thereof, expressed heterologously and screened using one or more display technologies (reviewed in Hoogenboom H R, Trends Biotechnol., 1997, 15:62-70; Hammond P W, MAbs, 2010, 2:157-64; Nissim A, Chernajovsky Y, Handb Exp Pharmacol., 2008, (181):3-18; Steinitz M, Hum Antibodies, 2009; 18:1-10; Bradbury A R, Sidhu S, Dbel S, and McCafferty, Nat Biotechnol., 2011, 29:245-54; Antibody Engineering (Kontermann R E and Dbel S eds., Springer, 2nd edition)).
[0287] In some embodiments, peripheral blood mononuclear cells (PBMC) can be isolated from human subjects that are acutely infected with SARS-CoV-2 or have symptoms consistent with COVID-19, or are asymptomatic, but have had known contact with a SARS-CoV-2 infected individual. An appropriate test, such as a PCR test using a sample from a nasopharyngeal swab, can be used to confirm the subject is infected with SARS-CoV-2. To determine if a donor was infected with SARS-CoV-2, donor plasma or serum can be tested for IgM, IgG or IgA antibodies that bind to specific SARS-CoV-2 antigens. The antigens included in this assay could be any of the structural and non-structural proteins expressed by any of the SARS-CoV-2 open reading frames (ORFs). Alternatively, donor plasma or sera can be tested in neutralization assays using either pseudovirus expressing SARS-CoV-2 spike protein or full-length, infectious SARS-CoV-2. Binding to antigens from, or neutralization of, closely related viruses, such as SARS-CoV-1, may also be tested.
[0288] Peripheral blood mononuclear cells (PBMC) isolated from either acutely infected or previously infected subjects can be sorted for B cells using B cell markers by FACS and/or SARS-CoV-2 antigens as bait. In some embodiments, PBMCs isolated from either acutely infected or previously infected subjects will be stained with propidium iodide as a live/dead marker in addition to a panel of antibodies including CD3, CD14, IgM, IgA and IgD, CD19, CD20, CD27 and CD38. Cells that are CD19, CD20+, CD27+, CD38+ are initially selected. The sub-population of cells that are negative for CD3, CD14, IgM, IgA and IgD are considered plasmablasts.
Methods for Inducing a Prophylactic Immune Response
[0289] In one aspect, methods for inducing an in vivo immune response in a subject at risk of SARS-CoV-2 infection, or a subject potentially exposed to another person infected with SARS-Cov-2, following administration of a prophylactic antibody are provided. In some embodiments, the method comprises administering an antibody described herein to the subject and detecting an immune response. In some embodiments of the method, the antibody is administered intravenously. In some embodiments, the successful administration of antibody can be evaluated by testing if the serum or plasma from the donor binds to SARS-CoV-2 antigens in an ELISA or other binding assay. In some embodiments, the plasma or serum from the subject could also be tested for functional activity, including antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and/or complement-dependent cytotoxicity (CDC) or antibody-mediated virus neutralization. In some embodiments, the immune response results in protection from infection for a specific period of time following administration of the antibody described herein.
Methods for Inducing a Therapeutic Immune Response
[0290] In another aspect, methods for inducing an in vivo immune response in a subject infected with SARS-CoV-2 following administration of a therapeutic antibody are provided. In some embodiments, the method comprises administering an antibody described herein to the subject and detecting an immune response. In some embodiments of the method, the antibody is administered intravenously. In some embodiments, the successful administration of antibody is evaluated by testing if the serum or plasma from the donor binds to SARS-CoV-2 antigens in an ELISA or other binding assay. In some embodiments, the plasma or serum from the subject is also tested for functional activity, including antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and/or complement-dependent cytotoxicity (CDC) or antibody-mediated virus neutralization. In some embodiments, the immune response is measured by the amount of time to clinical improvement as defined by discharge from hospital, or reduction in 2 points on a 6-point scale, where 1 is sufficiently healthy for discharge, and 6 is death. In some embodiment's, the immune response is measured by seroconversion from positive SARS-CoV-2 RT-qPCR test to negative SARS-CoV-2 RT-qPCR test within a specific number of hours. In some embodiments, the total number of hours by which to quantify seroconversion is approximately 72 hours (see Li L, Zhang W, Hu Y, et al. Effect of Convalescent Plasma Therapy on Time to Clinical Improvement in Patients With Severe and Life-threatening COVID-19: A Randomized Clinical Trial. JAMA Published online Jun. 3, 2020 doi: 10.1001/jama.2020.10044). In some embodiments, the immune response is measured by the absolute reduction in viral load, or the percent reduction in viral load from treatment initiation to treatment cessation. In some embodiments, the immune is quantified by whether the patient required supplemental oxygen therapy, including mechanical ventilation or the duration of mechanical ventilation or supplemental oxygen therapy (see Wang, Y., et al., Remdesivir in adults with severe COVID-19: a randomised, double-blind, placebo-controlled, multicentre trial. The Lancet, Vol. 395; pages 1569-1578, May 16, 2020).
Methods of Treatment
[0291] In another aspect, a method for treating or preventing one or more symptoms of COVID-19 in a subject is provided, the method comprising administering to the subject a therapeutically effective amount of an antibody as disclosed herein, or a pharmaceutical composition comprising the antibody. In certain embodiments, an antibody described herein is administered to the subject in combination with one or more additional therapeutic agents used to treat a viral infection or the side-effects or associated symptoms thereof. In certain embodiments, the method comprises administering to a subject a therapeutically effective amount of an antibody as disclosed herein, or a pharmaceutical composition comprising the antibody, in combination with a therapeutically effective amount of one or more additional therapeutic agents. In one embodiment, a method for treating COVID-19 in a human having or at risk of having an infection by SARS-CoV-2 is described, the method comprising administering to the human a therapeutically effective amount of an antibody as disclosed herein, or a pharmaceutical composition comprising the antibody, in combination with a therapeutically effective amount of one or more additional therapeutic agents.
[0292] Symptoms of Covid-19 include fever or chills, cough, shortness of breath (dyspnea), fatigue, muscle or body aches, headache, sore throat, a new loss of taste or smell, congestion or runny nose, nausea, vomiting, diarrhea, inflammation of the skin, confusion, eye symptoms such as enlarged blood vessels, swollen eyelids, excessive watering and increased discharge, light sensitivity and irritation, and neurological complications such as delirium, brain inflammation, stroke and nerve damage. Symptoms may appear two to 14 days after exposure to SARS-CoV-2.
[0293] In some embodiments, the one or more additional therapeutic agents comprise an antibody that binds to SARS-CoV-2. In some embodiments, the antibody that binds to SARS-CoV-2 is selected from casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), or ADG20 (Adagio Therapeutics), LY-Cov1404 (AbCellera; Eli Lilly and Company), or combinations thereof. In some embodiments, an antibody of the present disclosure as described herein is combined with at least one of casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), ADG20 (Adagio Therapeutics), LY-Cov1404 (AbCellera; Eli Lilly and Company), or combinations thereof. In some embodiments, an antibody of the present disclosure as described herein is combined with at least one of casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), or bamlanivimab (Eli Lilly and Company), LY-Cov1404 (AbCellera; Eli Lilly and Company), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), or combinations thereof.
[0294] In some embodiments, the one or more additional therapeutic agents comprise antiviral drugs. In some embodiments, the one or more additional therapeutic agents comprise the antiviral drug molnupiravir (MK-4482/EIDD-2801). In some embodiments, the one or more additional therapeutic agents comprise the antiviral drug remdesivir (GS-5734) Molnupiravir is an investigational, orally administered form of a potent ribonucleoside analog that inhibits the replication of SARS-CoV-2. Remdesivir has demonstrated in vitro and in vivo activity in animal models against the viral pathogens that cause MERS and SARS, which are coronaviruses structurally similar to SARS-CoV-2.
[0295] Examples of additional therapeutic agents that may be useful for treating COVID-19 are shown below (see the internet at www.drugs.com/condition/covid-19.html)
[0296] Baricitinib: a Janus kinase (JAK) inhibitor (marketed under the brand name Olumiant for the treatment of rheumatoid arthritis).
[0297] Bemcentinib: An AXL kinase inhibitor. Bemcentinib has been reported to exhibit potent antiviral activity in preclinical models against several enveloped viruses, including Ebola and Zika virus, and recent data have expanded this to include SARS-CoV-2.
[0298] Bevacizumab. A VEGF inhibitor (marketed under the brand name Avastin for certain types of cancer) is being studied as a treatment for acute lung injury (ALI) and acute respiratory distress syndrome (ARDS) in critically ill patients with COVID-19 pneumonia.
[0299] Chloroquine phosphate. An anti-malaria drug that has been shown to have a wide range of antiviral effects, including anti-coronavirus. Studies in Guangdong Province in China suggest that chloroquine may help improve patient outcomes in people with novel coronavirus pneumonia.
[0300] Colchicine. An anti-inflammatory drug being studied to prevent complications of COVID-19 in high risk patients. Colchicine has long been used in the treatment of gout.
[0301] EIDD-2801. A broad spectrum oral antiviral that could be used as a potential prophylactic or treatment for COVID-19 and other coronaviruses.
[0302] Favipiravir. An antiviral drug approved in some countries for the treatment of Influenza, was also approved for use in clinical trials as a treatment for novel coronavirus pneumonia.
[0303] Fingolimod. An approved drug called fingolimod (marketed under the brand name Gilenya for the treatment of relapsing forms of multiple sclerosis) is being studied as a treatment for COVID-19.
[0304] Hydroxychloroquine and azithromycin. the anti-malaria drug hydroxychloroquine and the macrolide antibacterial drug azithromycin (Zithromax) currently in clinical trials in the U.S.
[0305] Hydroxychloroquine sulfate. a malaria drug shown to be effective in killing the coronavirus in laboratory experiments. Hydroxychloroquine was first approved by the FDA in 1995 under the brand name Plaquenil, and it is also used in the treatment of patients with lupus and arthritis. In March 2020, the US FDA issued an emergency use authorization (EUA) to allow the emergency use of hydroxychloroquine sulfate supplied from the Strategic National Stockpile (SNS) for the treatment of COVID-19 in certain hospitalized patients.
[0306] Ivermectin. An anti-parasitic drug shown to be effective against the SARS-CoV-2 virus in an in-vitro laboratory study. Further clinical trials need to be completed to confirm the effectiveness of the drug in humans with COVID-19.
[0307] Leronlimab. A CCR5 antagonist has shown promise in reducing the cytokine storm in a small number of critically ill COVID-19 patients hospitalized in the New York area.
[0308] Lopinavir and ritonavir. A drug combination called lopinavir/ritonavir approved to treat HIV under the brand name Kaletra. Currently being studied in combination with the flu drug oseltamivir (Tamiflu) in Thailand.
[0309] Methylprednisolone. A widely used glucocorticoid is being studied for safety and effectiveness in the treatment of novel coronavirus pneumonia in a number of hospitals in the Hubei province of China.
[0310] Sarilumab. An interleukin-6 (IL-6) receptor antagonist (marketed under the brand name Kevzara for the treatment of rheumatoid arthritis) is being studied as a potential treatment for acute respiratory distress syndrome (ARDS) in patients critically ill from COVID-19.
[0311] Tocilizumab. An interleukin-6 receptor antagonist (marketed under the brand name Actemra for the treatment of rheumatoid arthritis and other inflammatory conditions) is being studied in a number of locations worldwide for the treatment of patients with COVID-19.
[0312] Umifenovir. An antiviral drug (marketed in Russia under the brand name Arbidol, and also available in China for the treatment of Influenza) is being studied in China and other countries as a treatment for COVID-19.
[0313] In certain embodiments, when an antibody of the present disclosure as described herein is combined with one or more additional therapeutic agents as described above, the components of the composition are administered as a simultaneous or sequential regimen. When administered sequentially, the combination may be administered in two or more administrations.
[0314] In some embodiments, an antibody as disclosed herein is combined with one or more additional therapeutic agents in a unitary dosage form for simultaneous administration to a patient.
[0315] A patient refers to any subject receiving the antibody regardless of whether they have COVID-19. In some embodiments, a patient is a non-human subject, e.g., an animal that is used as a model of evaluating the effects of antibody administration.
[0316] Co-administration of an antibody as disclosed herein with one or more additional therapeutic agents generally refers to simultaneous or sequential administration of an antibody or fragment thereof disclosed herein and one or more additional therapeutic agents, such that therapeutically effective amounts of the antibody or fragment thereof disclosed herein and one or more additional therapeutic agents are both present in the body of the patient.
[0317] Co-administration includes administration of unit dosages of the antibody disclosed herein before or after administration of unit dosages of one or more additional therapeutic agents, for example, administration of the antibody within seconds, minutes, or hours of the administration of one or more additional therapeutic agents. For example, in some embodiments, a unit dose of an antibody disclosed herein is administered first, followed within seconds or minutes by administration of a unit dose of one or more additional therapeutic agents. Alternatively, in other embodiments, a unit dose of one or more additional therapeutic agents is administered first, followed by administration of a unit dose of an antibody within seconds or minutes. In some embodiments, a unit dose of an antibody disclosed herein is administered first, followed, after a period of hours (e.g., 1-12 hours), by administration of a unit dose of one or more additional therapeutic agents. In other embodiments, a unit dose of one or more additional therapeutic agents is administered first, followed, after a period of hours (e.g., 1-12 hours), by administration of a unit dose of the antibody.
[0318] The combined administration may be co-administration, using separate pharmaceutical compositions or a single pharmaceutical composition, or consecutive administration in either order, wherein there is optionally a time period while both (or all) therapeutic agents simultaneously exert their biological activities. Such combined therapy may result in a synergistic therapeutic effect. In certain embodiments, it is desirable to combine administration of an antibody of the invention with another antibody directed against another Plasmodium falciparum: antigen, or against a different SARS-CoV-2 target epitope.
[0319] As described herein, the antibody may also be administered by gene therapy via a nucleic acid comprising one or more polynucleotides encoding the antibody. In certain embodiments, the polynucleotide encodes an scFv. In particular embodiments, the polynucleotide comprises DNA, cDNA or RNA. In certain embodiments, the polynucleotide is present in a vector, e.g., a viral vector. In one embodiment, the antibody is administered via in vitro-transcribed (IVT) mRNA to express the antibody. See US20190309067, at Examples 12-14, hereby incorporated by reference.
Methods of Preventing Infection
[0320] In another aspect, a method for preventing infection by SARS-CoV-2 in a subject is provided, the method comprising administering to the subject an antibody described herein, or a pharmaceutical composition comprising the antibody, wherein the antibody or pharmaceutical composition is administered at a dose sufficient to prevent or reduce infection of one or more host cells in the subject by SARS-CoV-2.
[0321] In some embodiments, the antibody or pharmaceutical composition is administered to the subject in combination with one or more additional therapeutic agents that are effective at preventing infection of host cells by SARS-CoV-2. In some embodiments, the one or more additional therapeutic agents that are effective at preventing infection of host cells by SARS-CoV-2 comprise an antibody that binds to SARS-CoV-2. In some embodiments, the antibody that binds to SARS-CoV-2 is casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), ADG20 (Adagio Therapeutics) LY-Cov1404 (AbCellera; Eli Lilly and Company), AZD7442 (AstraZeneca), or AZD8895 (AstraZeneca). In some embodiments, an antibody of the present disclosure as described herein is combined with at least one of casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevima (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), CT-P59 (Celltrion Healthcare), BRII-196 (Brii Biosciences), BRII-198 (Brii Biosciences), VIR-7831 (Vir Biotechnology), AZD7442 (AstraZeneca), AZD8895 (AstraZeneca), AZD1061 (AstraZeneca), TY027 (Tychan Pte. Ltd.), SCTA01 (Sinocelltech Ltd.), MW33 (Mabwell Bioscience Co., Ltd.), JS016 (Junshi Biosciences), DXP593 (Singlomics/Beigene), DXP604 (Singlomics/Beigene), STI-2020 (Sorrento Therapeutics), BI 767551/DZIF-10c (U. Cologne/Boehringer Ingelheim), COR-101 (CORAT Therapeutics), HLX70 (Hengenix Biotech), ADM03820 (Ology Bioservices), HFB30132A (HiFiBiO Therapeutics), ABBV-47D11 (AbbVie), C144-LS (Bristol-Myers Squibb, Rockefeller University), C-135-LS (Bristol-Myers Squibb, Rockefeller University), LY-CovMab (Luye Pharma), JMB2002 (Jemincare), ADG20 (Adagio Therapeutics), or LY-Cov1404 (AbCellera; Eli Lilly and Company). In some embodiments, an antibody of the present disclosure as described herein is combined with at least one of casirivimab (Regeneron Pharmaceuticals), imdevimab (Regeneron Pharmaceuticals), etesevimab (Eli Lilly and Company), bamlanivimab (Eli Lilly and Company), LY-Cov1404 (AbCellera; Eli Lilly and Company), AZD7442 (AstraZeneca), or AZD8895 (AstraZeneca).
[0322] In some embodiments, the one or more additional therapeutic agents that are effective at preventing infection of host cells by SARS-CoV-2 comprise antiviral drugs. In some embodiments, the one or more additional therapeutic agents comprise the antiviral drug molnupiravir (MK-4482/EIDD-2801). In some embodiments, the one or more additional therapeutic agents comprise the antiviral drug remdesivir (GS-5734). In some embodiments, the one or more additional therapeutic agents that are effective at preventing infection of host cells by SARS-CoV-2 comprise baricitinib, bemcentinib, bevacizumab, chloroquine phosphate, colchicine, EIDD-2801, favipiravir, fingolimod, hydroxychloroquine and azithromycin, hydroxychloroquine sulfate, ivermectin, leronlimab, lopinavir and ritonavir, methylprednisolone, sarilumab, tocilizumab, or umifenovir, or combinations thereof.
[0323] In one embodiment, the subject has not responded to treatment with a SARS-CoV-2 vaccination regimen. In one embodiment, the subject is not eligible for treatment with a SARS-CoV-2 vaccination regimen. In one embodiment, the subject is not likely to respond to treatment with a SARS-CoV-2 vaccination regimen, such as an elderly subject (a subject who is 65 years of age or older) or a subject with altered immunocompetence.
Diagnostics
[0324] The antibodies described herein can also be used to detect viral antigens in a biological sample isolated from a subject, and therefore can be useful for diagnosing infection by SARS-CoV-2 in a subject. The sample can be, for example, blood, plasma, or serum. The antibodies described herein can also be used as biomarkers for monitoring the response to treatment of COVID-19 or for determining whether a patient will respond to a particular therapy. Thus, in another embodiment, a method of diagnosing a patient that is or was infected with a coronavirus is described, the method comprising detecting binding of an antibody described herein to a sample obtained from the patient, wherein binding greater than a negative control value indicates the patient is infected with the coronavirus. In some embodiments, the method is an in vitro method, such that detecting binding of an antibody described herein to a sample obtained from the patient is performed in vitro. It will be understood that in vitro methods are not the same as methods performed on an animal or human subject.
[0325] In another aspect, a method of identifying a patient that is infected with a coronavirus is described, the method comprising detecting binding of an antibody described herein to a sample obtained from the patient, wherein binding greater than a negative control value indicates the patient is infected with the coronavirus. In some embodiments, the method comprises testing a patient sample for binding to an antibody described herein and detecting binding of the antibody to components of the sample. Detecting binding of the antibody can be performed, for example, by a serological assay, including enzyme-linked immunosorbent assays (ELISAs), lateral flow assays, or Western blot-based assays. In some embodiments, the sample is a blood, plasma or serum sample.
B Cells
[0326] In some embodiments, samples described herein comprise immune cells. The immune cells can B cells. B-cells include, for example, activated B cells, blasting B cells, plasma cells, plasmablasts, memory B cells, B1 cells, B2 cells, marginal-zone B cells, and follicular B cells.
[0327] In general, a B cell refers to any cell that has at least one rearranged immunoglobulin gene locus. A B cell can include at least one rearranged immunoglobulin heavy chain locus or at least one rearranged immunoglobulin light chain locus. A B cell can include at least one rearranged immunoglobulin heavy chain locus and at least one rearranged immunoglobulin light chain locus. B cells are lymphocytes that are part of the adaptive immune system. B cells can include any cells that express antibodies either in the membrane-bound form as the B-cell receptor (BCR) on the cell surface or as secreted antibodies. B cells can express immunoglobulins (antibodies, B cell receptor). Antibodies can include heterodimers formed from the heavy and light immunoglobulin chains. The heavy chain is formed from gene rearrangements of the variable, diversity, and junctional (VDJ) genes to form the variable region, which is joined to the constant region. The light chain is formed from gene rearrangements of the variable and junctional (VJ) genes to form the variable region, which is then joined to the constant region. Owing to a large possible number of junctional combinations, the variable regions of the antibody gene (which is also the BCR) have huge diversity, enabling B cells to recognize any foreign antigen and mount a response against it.
B-Cell Activation and Differentiation
[0328] B cells are activated and differentiate when they recognize an antigen in the context of an inflammatory immune response. They usually include 2 signals to become activated, one signal delivered through BCR (a membrane-bound form of the rearranged immunoglobulin), and another delivered through CD40 or another co-stimulatory molecule. This second signal can be provided through interaction with helper T cells, which express the ligand for CD40 (CD40L) on their surface. B cells then proliferate and may undergo somatic hypermutation, where random changes in the nucleotide sequences of the antibody genes are made, and B cells whose antibodies have a higher affinity B cells are selected. They may also undergo class-switching, in which the constant region of the heavy chain encoding the IgM isotype is switched to the constant region encoding the IgG, IgA, or IgE isotype. Differentiating B cells may end up as memory B cells, which are usually of higher affinity and classed switched, though some memory B cells are still of the IgM isotype. Memory B cells can also become activated and differentiate into plasmablasts and ultimately, into plasma cells. Differentiating B cells may also first become plasmablasts, which then differentiate to become plasma cells.
Affinity Maturation and Clonal Families
[0329] A clonal family is generally defined by the use of related immunoglobulin heavy chain and/or light chain V(D)J sequences by 2 or more antibodies or B-cell receptors. Related immunoglobulin heavy chain V(D)J sequences can be identified by their shared usage of V(D)J gene segments encoded in the genome. Within a clonal family there are generally subfamilies that vary based on shared mutations within their V(D)J segments, that can arise during B cell gene recombination and somatic hypermutation.
[0330] Activated B cells migrate and form germinal centers within lymphoid or other tissues, where they undergo affinity maturation. B cells may also undergo affinity maturation outside of germinal centers. During affinity maturation, B cells undergo random mutations in their antibody genes, concentrated in the complementary determining regions (CDRs) of the genes, which encode the parts of the antibody that directly bind to and recognize the target antigen against which the B cell was activated. This creates sub-clones from the original proliferating B cell that express immunoglobulins that are slightly different from the original clone and from each other. Clones compete for antigen and the higher-affinity clones are selected, while the lower-affinity clones die by apoptosis. This process results in the affinity maturation of B cells and consequently in the generation of B cells expressing immunoglobulins that bind to the antigen with higher affinity. All of the B cells that originate from the same parent B cell form clonal families, and these clonal families include B cells that recognize the same or similar antigenic epitopes. In some aspects, we expect that clones present at higher frequencies represent clones that bind to antigen with higher affinity, because the highest-affinity clones are selected during affinity maturation. In some aspects, clones with different V(D)J segment usage exhibit different binding characteristics. In some aspects, clones with the same V(D)J segment usage but different mutations exhibit different binding characteristics.
Memory B Cells
[0331] Memory B cells are usually affinity-matured B cells and may be class-switched. These are cells that can respond more rapidly to a subsequent antigenic challenge, significantly reducing the time included for affinity-matured antibody secretion against the antigen from 14 days in a naive organism to 7 days.
Plasmablasts and Plasma Cells
[0332] Plasma cells can be either long-lived or short-lived. Long-lived plasma cells may survive for the lifetime of the organism, whereas short-lived plasma cells can last for 3-4 days. Long-lived plasma cells reside either in areas of inflammation, in the mucosal areas (in the case of IgA-secreting plasma cells), in secondary lymphoid tissues (such as the spleen or lymph nodes), or in the bone marrow. To reach these divergent areas, plasmablasts fated to become long-lived plasma cells may first travel through the bloodstream before utilizing various chemokine gradients to traffic to the appropriate areas. Plasmablasts are cells that are affinity matured, are typically classed-switched, and usually secrete antibodies, though generally in lower quantities than the quantity of antibody produced by plasma cells. Plasma cells are dedicated antibody secretors.
[0333] Following either vaccination or infection, nave or memory B cells enter germinal centers and are exposed to antigen. Following appropriate antigen presentation, a specific B cell subset, plasmablasts, are released into the blood and are responsible for making large amounts of antigen-specific antibodies. As an infection progresses, memory B cells re-enter germinal centers and undergo somatic hypermutation, a process which increases the affinity of a given B cell for the antigen of interest. Thus, the plasmablast population reflects not only the nave B cell response to a given pathogen, but also maturation of the B cell response to that pathogen in real time. Other B cell sorting techniques rely on bait-based selection methods to identify the extremely rare pathogen-specific, circulating memory B cell populations. Such bait-based selection methods bias the selected B cells for those that bind most strongly to the bait and exclude antibodies that either target different antigens/epitopes altogether or bind to conformationally-specific epitopes not formed when the bait is recombinantly expressed. During an acute infection or following vaccination, the plasmablast population can comprise up to 47% of the peripheral B cell population (Wrammert et al, 2012), making them ideal candidates to interrogate using an agnostic sorting strategy. Thus, plasmablasts represent a good source of antibodies that bind SARS-CoV-2 antigens.
EXAMPLES
Example 1
[0334] Generation of SARS-CoV-2 Antibodies.
[0335] The antibodies described herein were discovered in antibody repertoires generated by Immune Repertoire Capture (IRC) technology from plasmablast B cells isolated from patients actively infected with SARS-CoV-2. The IRC technology and its use in antibody discovery is well known and disclosed in, e.g., WO 2012148497A2, the entire content of which is herein incorporated by reference.
[0336] Peripheral blood mononuclear cells (PBMCs) isolated from human subjects actively infected with SARS-CoV-2. were stained with propidium iodide as a live/dead marker in addition to a panel of antibodies including CD3, CD14, IgM, IgA and IgD, CD19, CD20, CD27 and CD38. Cells that were CD19+, CD20, CD27+, CD38+ were initially selected. The sub-population of cells that were negative for CD3, CD14, IgM, IgA and IgD were considered IgG.sup.+ plasmablasts were single-cell sorted into 384 well plates containing lysis buffer (
[0337] Following production of cDNA, high-quality, paired heavy and light chain sequences were generated. In brief, cDNA samples were thawed, pooled, and amplified using a nested PCR reaction. PCR product were sequenced using Illumina next generation sequencing technology and processed with the IRC bioinformatics pipeline, resulting in the generation of variable heavy and light chain sequences. Barcodes employed early in the amplification process facilitated the pairing of native variable heavy and light chain sequences and allowed for generation of error-corrected sequences with 99.998% accuracy. See PCT/US2012/000221 (corresponding to US 2015/0133317) and PCT/US2014/072898 (corresponding to US 2015/0329891), which are incorporated by reference herein. Thus, the end product was a highly accurate, natively paired variable heavy and light chain sequences that included the signal sequence peptide on the 5 end and extended through part of the constant region at the 3 end, allowing for accurate identification of each antibody's subclass (See DeFalco et al., 2018).
[0338] Each paired set of sequences were analyzed using an Atreca-generated informatics platform and assigned to a specific lineage. Two sequences that originated from the same donor, used the same putative germline heavy and light variable (V) and joining (J) genes, have H-CDR3 and L-CDR3 sequences of the same length and that had at least 75% H-CDR3 and L-CDR3 nucleotide sequence identity were grouped together into lineages. Phylogenetic trees incorporating these sequence and lineage-specific data were constructed for each donor using rapidNJ software.
Example 2
[0339] Sequence characterization and selection.
[0340] Using the methods described in Example 1, paired heavy and light chain sequences were generated from 8 samples originating from 5 donors who were infected with SARS-CoV-2. The selection procedures defined below identified paired sequences for expression as human IgG1 antibody.
1) Lineage abundanceLineages containing the largest number of plasmablast-derived sequences were selected from each donor, and one representative sequence was selected per lineage.
2) Lineage persistenceLineages that were observed in multiple samples obtained at different timepoints were selected, one representative sequence per lineage.
3) ConvergenceAntibodies were determined to be convergent in this disclosure if their H-CDR3 and L-CDR3 are of comparable length and have similar sequence in this application. Convergent antibodies identified herein include those having two or more sequences that originated from different donors or one or more sequences from the Atreca set (i.e., a set of antibodies including any of the antibodies disclosed in this application) and a sequence reported in the literature that originated from the same or similar germline genes. A representative sequence was selected from pairs or groups of convergent sequences.
4) Unique sequence features: Sequences that exhibited long H-CDR3 lengths, low levels of somatic hypermutation, and/or multiple cysteine residues in H-CDR3 were selected in this category.
[0341] Using these methods, antibody sequences were selected and expressed across 4 experiments, which included between 1-99 unique sequences. Each set of antibodies were evaluated for binding using Biolayer Interferometry (BLI) against RBD, S1, S2 and N, and for binding to the S trimer by ELISA. These data are described by experiment (1-4) in Example 4. Envelope protein ELISA binding data are described for all antibodies in experiment 4. Neutralization data generated using replication competent virus is described for all antibodies in Example 5. Sequence Selection and binding evaluation for two additional sequences are described in Example 6. Neutralization data generated against SARS-CoV-2, SARS-CoV-2 variants and SARS-CoV using pseudoviruses is described in Example 7.
Example 3
[0342] Antibody Production.
[0343] After sequences were selected, gene fragments were synthesized and cloned into human variable heavy (VH) or variable light (VL) chain expression vectors. Fully human, IgG1 antibodies were expressed using a 293F transfection system and purified using high-throughput Protein A columns in sufficient quantities (250 g) to be tested in downstream binding and neutralization assays.
Example 4
[0344] Identification of antibodies that bind to SARS-CoV-2 antigens.
Binding Data: BLI & ELISA Assays
[0345] Antibodies were screened for binding to 6 proteins: S1, S2, RBD, Spike (S) trimer, Envelope (E) and Nucleocapsid (N) protein using the assays as specified in Table 1. Controls included antibodies obtained from both commercial and published sources with defined specificity for the antigens under evaluation. Cetuximab (AB-000129), an antibody that targets the EGF receptor, was used as the negative control, and positive control antibodies included CR3022 (AB-009073), an antibody that binds to both the SARS-CoV-1 and SARS-CoV-2 spike proteins, CA-1 (AB-009265) and, CB-6 (AB-009264) (Shi, et al (2020) https://www.ncbi.nlm.nih.gov/nuccore/MT470196.1) which both bind to the spike protein and potently neutralize SARS-CoV-2. The control antibodies were synthesized in parallel with the experimental antibodies if the sequences were publicly available and tested in parallel with the experimental antibodies.
[0346] For the BLI assays evaluating binding to the S1, S2, RBD and N proteins, antigens were diluted to 5 g/mL and loaded onto anti-human IgG Fc Capture sensors (AHC). Loaded sensors were dipped into antigen at a concentration of 300 nM in an assay buffer consisting of PBS with 0.1% BSA, 0.02% Tween-20 (pH 7.2). Binding experiments were performed on an Octet HTX at 25 C. Kinetic constants were calculated using a monovalent (1:1) binding model. On- and off-rates were reported for those antibody-antigen pairs with a binding response (nm) 0.05. AHC capture sensors were regenerated using a 10 mM Glycine buffer (pH 1.7).
[0347] To determine the appropriate concentration of antigen to add as the analyte, antigens were tested at two concentrations (300 nM and 1,000 nM) for binding to the commercially obtained positive and negative control antibodies.
[0348] For the ELISA assay, S trimer was coated to a 96-well ELISA plate at 2 g/mL at 4 C. and antibodies were tested at 2 dilutions, 1:50 and 1:500, except for antibodies AB-010020 and AB-010021. Anti-human IgG1 secondary antibody coupled to an enzyme were added, followed by the enzyme-specific substrate. The experiment was developed using a 3,3,5,5-Tetrarnethylbenzidine (TMB) substrate, and optical density (OD) at 450 nm was reported. Higher OD values indicate stronger binding of the antibody to the antigen. The values reported in Table 5 reflect the optical density (450 nm) measured at the 1:50 dilution if that value was 2-fold higher than hIgG1 background. No value is reported if binding was not observed to be 2-fold higher than background. Dose-response curves were evaluated or AB-010020 and AB-010021. In this experiment, 8, 4-fold serial dilutions beginning at 1000 nM were generated and the assay conducted as described above. The data from this experiment was plotted and used to calculate the half-maximal effective concentration (EC50) for the two antibodies.
Experiment 1 Results
[0349] Antibodies were tested for binding to the RBD, S1, S2 and N proteins by BLI and for binding to the S trimer by ELISA as described in Table 1. As expected, positive control antibody AB-009073 demonstrated strong binding to the RBD and S1 proteins by BLI (
[0350] Of the experimental antibodies, one mAb, AB-009108, demonstrated strong binding to the S1 protein and the S trimer by ELISA but not to the RBD. A second antibody, AB-009116, bound to the RBD and S1 proteins but not to the S trimer by ELISA (
[0351] When the same set of antibodies were evaluated for binding to the S2 protein, 9 demonstrated measurable on- and off-rates. The on-rates ranged from between 1.22E+03 to 4.22E+04 while the off-rates spanned a much wider range: 1.1E-03 to 2.15E-7. Antibodies with off-rates (Kd)<2E-4 reflect the limit of detection for the Kd measurement. Three antibodies, AB-009074, AB-009117 and AB-009123 demonstrated binding to S2. Interestingly, all three antibodies demonstrated measurable signal in the first ELISA assay, but the data was not replicated in the second experiment. Three antibodies, AB-009080, AB-009083 and AB-009106 demonstrated binding to S2 by BLI and to S trimer by ELISA. Antibodies AB-009078, AB-009095 and AB-009119 all demonstrated binding to the S2 protein by BLI, but no measurable binding to the S trimer, or to the S1 or RBD proteins (
[0352] Evaluation against the nucleocapsid protein identified a fifth group of eleven antibodies that bound to the nucleocapsid protein. Two of these antibodies, AB-009095 and AB-009119, demonstrated weak binding to the S2 protein (
Experiment 2 Results
[0353] In the second experiment, AB-009264, AB-009265 and AB-000129 and 96 experimental antibodies were tested for binding by BLI against the S1, S2, RBD and N proteins and by ELISA against the S trimer. As expected, positive control antibodies AB-009264 and AB-009265 demonstrated strong binding to the RBD and S1 proteins by BLI, and to the S-trimer by ELISA (
[0354] Of the experimental antibodies tested, two mAbs, AB-009221 and AB-009251, demonstrated binding to the RBD and S1 proteins by BLI, and to the S trimer by ELISA. Neither antibody bound to the S2 or N proteins (
[0355] When the same set of antibodies were evaluated for binding to the S2 protein, 4 demonstrated measurable on- and off-rates. Similar to the first experiment, the on-rates reflected a very narrow range of values, while the off-rates spanned a much wider range. Two of the 4 antibodies identified to bind to S2 in the second experiment, AB-009214 and AB-009226, both bound to S2 by BLI and to the S2 trimer by ELISA. A second group of antibodies, AB-009182 and AB-009263, both bound to S2 but did not bind to the S trimer (
[0356] An additional six antibodies demonstrated measurable binding to the S trimer by ELISA but not to any of the other antigens. These antibodies included AB-009174, AB-009202, AB-009231, AB-009237, AB-009239 and AB-009244. AB-009202 demonstrated a striking phenotype that included very strong binding to the S trimer, but no measurable binding to the RBD, S1 or S2 subunits of the spike protein (Table 5).
[0357] Evaluation against the nucleocapsid (N) protein identified a fifth group of 28 antibodies that bound to the N protein. None of these antibodies demonstrated binding to any of the spike subunits, or to the spike trimer (
Experiments 3 & 4 Results
[0358] In the third and fourth experiments, an additional 56 antibodies were expressed and tested for binding using the assays described in Experiments 1 & 2. Of these additional experimental Abs, 5 antibodies demonstrated binding to the RBD and S1 proteins by BLI and to the S trimer by ELISA. Three additional antibodies demonstrated binding to the S1 monomer and the S trimer, but did not demonstrate binding to the RBD protein. Neither of the two groups of antibodies demonstrated measurable binding to the Nucleocapsid protein or the S2 protein as measured by BLI, or to the Envelope protein as measured by ELISA (Table 5).
[0359] A third group of twelve antibodies demonstrated measurable binding to the Spike trimer by ELISA, but did not demonstrate binding to either the RBD or the S1 or S2 monomers. Binding to the spike trimer ranged from weak Optical Density measured at 450 nm (OD) values only slightly above the background to OD values measured 10-fold higher than background cutoff. In all ELISA experiments, binding considered significantly higher than background was calculated as 2-fold higher than the average binding measured for the human IgG1 (hIgG1) negative control (Table 5)
[0360] A fourth group of 8 antibodies bound to the S2 monomer and the S trimer, but did not bind to the RBD or the S1 monomers, or the Nucleocapsid or Envelope proteins. Lastly, a fifth group of two antibodies bound to the Nucleocapsid protein, but not to any of the Spike variants or Envelope proteins tested (Table 5).
Summary of Results for Envelope Binding
[0361] All 245 antibodies were also tested for binding to the Envelope protein using an ELISA assay similar to the assay developed to test for binding to the S trimer. Eleven antibodies demonstrated binding two-fold higher than the hIgG1 negative control and were considered to be Envelope-specific. Some antibodies demonstrated binding to two distinct proteins, including: AB-009231 demonstrated S Trimer (ELISA) & Envelope binding; AB-009214 demonstrated S2, S Trimer and Envelope binding; and AB-009112 and AB-009190 both demonstrated Nucleocapsid and Envelope binding. These patterns may indicate that the antibodies are polyreactive, or that they bind to a similar epitope exposed on both targets (Table 5).
Example 5
Summary of Results for In Vitro Neutralization Assays Using Replication-Competent Virus
[0362] The antibodies were also tested for functional activity against fully infectious SARS-CoV-2 in an in vitro neutralization assay. Antibodies were first screened against the virus at two concentrations: 50 g/mL and 5 g/mL. Antibodies which demonstrated a reduction in plaque formation (indicating potential neutralizing activity) at 50 g/mL were tested in a dilution series using 8, 3-fold dilutions beginning at 50 g/mL. The antibody concentration required to inhibit 50% of the viral infection was calculated using a dose-response model with a variable slope. Nine demonstrated potential neutralizing activity in the initial screen. Of those nine, three demonstrated IC.sub.50 values 50 g/mL, the upper limit of detection for the assay. Those antibodies included AB-009271 (
Example 6
[0363] Two antibodies, AB-010020 and AB-010021, were identified via convergence analysis as per Example 2, expressed as described in Example 3 and assayed for binding as described in Example 4. AB-010020 (
Example 7
[0364] Identification of Antibodies with Neutralizing Activity Against SARS CoV-2 Variants Using Pseudovirus.
[0365] The antibodies identified to potentially have neutralizing activity in Example 5 were also assayed for neutralizing activity against the SARS CoV-2 Wuhan virus and variants using the Phenosense Anti-SARS-CoV-2 Neutralizing Antibody Assay (CoV nAb Assay) (Monogram Biosciences/Labcorp). (Huang, Y., et al., medRxiv 2021.09.09.21263049, incorporated by reference herein in its entirety.) Neutralizing antibody activity was measured in a formally validated assay that utilized lentiviral particles pseudotyped with full-length SARS-CoV-2 Spike protein and containing a firefly luciferase (Luc) reporter gene for quantitative measurements of infection by relative luminescence units (RLU). The backbone vector used in pseudovirus creation, F-lucP.CNDOAU3, encodes the HIV genome with firefly luciferase replacing the HIV env gene. A codon-optimized version of the full-length spike gene of the Wuhan-1 SARS-CoV-2 strain (MN908947.3) (GenScript) was cloned into the Monogram proprietary env expression vector, pCXAS-PXMX, for use in the assay. All of the spike mutations described in
[0366] Pseudovirus stock was produced in HEK 293 cells via a calcium phosphate transfection using a combination of spike plasmid (pCXAS-SARS-CoV-2-D614G) and lentiviral backbone plasmid (F-lucP.CNDOAU3). Transfected 10 cm2 plates were re-fed the next day and harvested on Day 2 post transfection. The pseudovirus stock (supernatant) was collected, filtered and frozen at <70 C. in single-use aliquots. Pseudovirus infectivity was screened at multiple dilutions using HEK293 cells transiently transfected with ACE2 and TMPRSS2 expression vectors. RLUs were adjusted to 50,000 for use in the neutralization assay. Neutralization was performed in white 96-well plates by incubating pseudovirus with 8, serial 4-fold dilutions of antibody starting at a concentration of 50 g/mL for one hour at 37 C.
[0367] HEK293 target cells, which had been transfected the previous day with ACE2 and TMPRSS2 expression plasmids, were detached from 10 cm2 plates using trypsin/EDTA and re-suspended in culture medium to a final concentration that accommodated the addition of 10,000 cells per well. Cell suspension was added to the antibody-virus mixtures and assay plates were incubated at 37 C. in 7% CO2 for 3 days. On the day of assay read, Steady Glo (Promega) was added to each well. Reactions were incubated briefly and luciferase signal (RLU) was measured using a luminometer. Neutralization titers represent the antibody concentrations at which RLUs were reduced by either 50% (ID50) or 80% (ID80) compared to virus control wells (no antibody wells).
[0368] The Monogram assay employs a specificity control which is created using the same HIV backbone/Luc sequence used in the SARS-CoV-2 pseudovirus. The envelope is 1949 Influenza A H10N3. It is unlikely for antibodies to have been discovered against this rare avian Influenza virus in humans. The specificity control is designed to detect non-antibody factors (e.g., ART therapy) that could inhibit SARS-CoV-2 pseudovirus and result in false positive measurements of antibody neutralization. Positive anti-SARS-CoV-2 nAb activity was defined as an anti-SARS-CoV-2 nAb titer >3 times greater than the titer of the same serum tested with the specificity control.
[0369] Using the Monogram assay, the antibodies were assayed for neutralizing activity against the following SARS-CoV-2 variants. Alpha (B.1.1.7), Beta (B.1.351), Gamma (P.1.B.1.1.28), Delta (B.1.617.2), Delta-plus (B.1.617.2.1) and Epsilon (B.1.427/9;
[0370] Known neutralizing antibodies COVA1-21; CA1; REGN10933 (Casirivimab); REGN10987 (Imdevimab); LY-CoVO16 (CB-6, JS-016, LY3832479, etesevimab) and LY-CoV555 (bamlanivimab) were included as positive controls. CR3022 and an anti-nucleocapsid antibody were included as negative controls.
[0371] The results of the assay are shown in Table 6. Of the antibodies tested, AB-009271, AB-010020, AB-010021, AB-009613, and AB-009610 showed neutralizing activity against the SARS-CoV2 Wuhan virus and at least one of the viral variants. AB-010020 and AB-010021 neutralized all of the variants tested. In addition to demonstrating 100% breadth, AB-010020 also demonstrated the most potent neutralizing activity of all of the tested variants (
Example 8
[0372] This example describes a SPR assay that can be used to determine the affinity and binding kinetics of the antibodies described herein.
[0373] For SPR, each antibody can be directly coupled to a Carterra Chip or coupled using a goat anti-human Fc antibody. The uncoupled antibodies are washed off and various concentration gradients of the targets are flowed over the antibodies, where the highest concentration of each target is expected to be in the range 0.5-8 g/mL. Each antibody is immobilized in two different locations on the chip to allow for duplicate measurements. The affinity for each antibody-target combination is determined using 4-5 target concentrations in Mathematica software. If variation between the two duplicates was >3-fold, the antibody-target measurement will be repeated.
[0374] One exemplary method is described below (see Wang Q, et al. Structural and Functional Basis of SARS-CoV-2 Entry by Using Human ACE2. Cell. 2020; 181(4):894-904.e9. doi:10.1016/j.cell.2020.03.045). The CM5 biosensor chip (GE Healthcare) is first immobilized with anti-mIgG anti-body for flow cells (Fc) 1 and 2, according to manufacturer's amine-coupling chemistry protocol (GE Healthcare). The indicated mFc tagged protein is then injected and captured on Fc 2. Fc 1 is used as the negative control. hACE2 used for this assay are in buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, and 0.005% (v/v) Tween 20. Concentrated supernatant containing SARS-CoV-2-S1-mFc, SARS-CoV-2-NTD-mFc, SARS-CoV-2-CTD-mFc and SARS-RBD-mFc are individually captured by the antibody immobilized on the CM5 chip at approximately 200-500 response units. Various concentrations of hACE2s are then flowed through the chip and the real-time response is recorded. To test the interaction with SARS-CoV-2-S1-mFc, SARS-CoV-2-NTD-mFc, SARS-CoV-2-CTD-mFc and SARS-RBD-mFc, The concentrations of hACE2 are 50, 100, 200, 400 and 800 nM. After each reaction, the chip is re-generated using pH 1.7 glycine.
[0375] To prepare the mouse Fc-fusion proteins containing the coding sequence for the indicated protein, SARS-CoV-2-S1, SARS-CoV-2-NTD, SARS-CoV-2-CTD, HEK293T cells are transfected with pCAGGS plasmid. 24 h later, the supernatant containing the indicated protein is collected, concentrated and then used for FACS, immunostaining and SPR assays. Exemplary proteins include SARS-CoV-2-S1 (1-685), SARS-CoV-2-NTD (residues 1-286), SARS-CoV-2-CTD (319-541). ACE2 (19-615) used in this study is produced in Hi5 cells(insect).
Assay Design/Workflow:
[0376] Spike protein CTD (or any relevant truncations established with BLI assay) with mFc, anti-Mouse capture sensor chip (with regeneration protocol).
[0377] Antibody in solution (HBS EP+) single cycle kinetics reference BLI K.sub.D (i.e., start from to 5K.sub.D concentration), ref the above conc, it will be 30 g Antibody per SCK run.
[0378] SPR assays are suitable for accurate affinity measurement (titration) and/or affinity ranking of antibody candidates (single concentration screening).
[0379] Another exemplary method is described in Ju B., et al., Potent human neutralizing antibodies elicited by SARS-CoV-2 infection, 2020. (see the internet at doi.org/10.1101/2020.03.21.990770). In this method, spike RBD is immobilized to CM5 at RU-250.
[0380] Another exemplary method is described in Lan, J., et al. Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature 581, 215-220 (2020) (https://doi.org/10.1038/s41586-020-2180-5. ACE2 is immobilized on a CM5 sensorchip (GE Healthcare) to a level of around 500 response units using a Biacore T200 (GE Healthcare) and a running buffer composed of 10 mM HEPES pH 7.2, 150 mM NaCl and 0.05% Tween-20. Serial dilutions of the SARS-CoV RBD and SARS-CoV-2 RBD are flowed through with a concentration ranging from 62.5 to 1.9 nM. (both protein S-RBD (R319-F541) and ACE2 (S19-N615) are expressed and purified from Hi5 cells.
Example 9
[0381] This example describes methods for generating antibody variants.
[0382] Antibodies produced as described herein will be modified to generate variant antibodies having improved developability and/or to reduce the risk of clinical immunogenicity, as described above, using methods described in PCT/US2020/018745. Briefly, to reduce risk of clinical immunogenicity, the antibody sequences are evaluated to identify residues that can be engineered to increase similarity to the intended population's native immunoglobulin variable region sequences. One approach to engineering a variant to be as much like self as possible is to identify a close germline sequence and mutate as many mismatched positions (also known as germline deviations) to the germline residue type as possible. Each germline gene can present as different alleles in the population. The least immunogenic drug candidate, in terms of minimizing the percent of patients with an immunogenic response, would likely be one which matches an allele commonly found in the patient population. Single nucleotide polymorphism (SNP) data from the human genome can be used to approximate the frequency of alleles in the population.
[0383] Another approach to engineering a lead for reduced immunogenicity risk is to use in silico predictions of immunogenicity, such as the prediction of T cell epitopes, or use in vitro assays of immunogenicity, such as ex vivo human T cell activation. For example, services such as those offered by Lonza, United Kingdom, are available that employ platforms for prediction of HLA binding and in vitro assessment to further identify potential epitopes.
[0384] Antibody variants can also be designed to enhance the efficacy of the antibody. For example, design parameters can focus on CDRs, e.g., CDR3. Positions to be mutated can be identified based on structural analysis of antibody-antigen co-crystals (Oyen et al., Proc. Natl. Acad Sci. USA 114:E10438-E10445, 2017; Epub Nov. 14 2017) and based on sequence information of other antibodies from the same lineage as the parent or reference antibody.
Approaches to Mutation Design
[0385] Development liabilities can be removed or reduced by one or more mutations. Mutations are designed to preserve antibody structure and function while removing or reducing development liabilities and to improve function. In one aspect, mutations to chemically similar residues can be identified that maintain size, shape, charge, and/or polarity. Illustrative mutations are described in Table 7 or Table 8.
[0386] The antibody sequences described herein can be aligned to the putative, D and germline genes. CDRs, germline deviations, and potential liabilities can be identified. For example, non-canonical cysteines and N-glycosylation sites can be identified across the full VH and VL sequences, whereas other potential liability motifs can be identified within the CDRs.
[0387] Potential PK risk can also be estimated (Sharma et al., Proc. Nat. Acad. Sci. USA 111:18601-18606, 2014). High hydrophobicity index (HI) correlates with faster clearance, where HI<5 is preferred to reduce risk, and HI<4 is most preferred to reduce risk. However, some antibodies with HI>4, or HI>5, will not exhibit fast clearance. Secondly, too high or too low Fv charge as calculated at pH 5.5 correlates with faster clearance, where charge between (2, +8) is preferred to reduce risk, and charge between (0, +6.2) is most preferred to reduce risk of fast clearance. Table 7 and Table 8 summarize the types and number of potential liabilities.
Design of Variants to Germline Antibodies
[0388] Framework and complementary-determining region (CDR) germline deviations in antibody sequences can be analyzed for their potential to be mutated, individually or in combination, to germline sequence, without negatively impacting binding to target SARS-CoV-2 antigens/epitopes. For each of the candidate mutations from antibody sequence to germline sequence, the risk of making the mutation can be assessed based on: (1) the change in charge, if any, since change in charge is intrinsically risky; (2) conservation of the native residue in the antibody lineage versus the presence of the germline residue or other mutations at that position in the lineage and (3) the structural location of the position with respect to the target antigen epitope. Some mutations may be coupled to at least one other mutation, meaning that the risk prediction is based on making the mutation in conjunction with the other mutation(s).
Design of Variants to Remove Liabilities from Antibody Sequences
[0389] Various sequence-based liabilities in antibody sequences described herein can be analyzed for their potential to be mutated to reduce or remove the risk of liability without negatively impacting binding to SARS-CoV-2 antigens or potency of the variant antibody. Residues that contributed to the hydrophobicity index, or to reducing the Fv charge can also be assessed. Similar to the germline design, risk can be assessed based on change in charge, shape, polarity, backbone conformation preference, and maintenance or enhancement of side chain interactions.
Example 10
[0390] This example describes a representative in vivo assay to test antibodies for protection from SARS-CoV-2 infection.
Passive Transfer of Neutralizing Antibodies and SARS-CoV-2 Challenge in Syrian Hamsters
[0391] Antibodies described herein can be tested in vivo for the ability to prevent infection by SARS-CoV-2. Antibodies are selected for passive transfer/challenge experiments in a Syrian hamster animal model. See Rogers et al., Id. Candidate neutralizing antibodies are injected intraperitoneally into Syrian hamsters at a starting dose of 2 mg/animal (on average 16.5 mg/kg) and 8 g/animal at the lowest dose. Control animals can receive 2 mg of a control IgG1. Each group of 6 animals are then challenged intranasally 12 h post-infusion with 110.sup.6 PFU of SARS-CoV-2. Serum is collected at the time of challenge (Day 0) and Day 5, and the weight of the animals monitored as an indicator of disease progression. On day 5, lung tissue is collected for viral burden assessment.
[0392] Syrian hamsters typically clear virus within one week after SARS-CoV-2 infection. Hamsters were weighed as a measure of disease due to infection. Lung tissues were collected to measure viral load on day 5. Lung viral loads are measured by real-time PCR. It is expected that animals that receive an effective dose of neutralizing antibody will show less weight loss than animals that receive a control antibody.
[0393] Antibody serum concentrations can also be measured to determine the amount of circulating antibody required for protection against SARS-CoV-2 in vivo. Antibody serum concentrations can be measured prior to intranasal virus challenge. It is expected that antibody serum concentrations of approximately 22 g/mL of neutralizing antibody will provide complete protection and a serum concentration of about 12 g/mL is adequate for 50% reduced disease as measured by weight loss. Sterilizing immunity at serum concentrations that represent a large multiplier of the in vitro neutralizing IC50 is observed for many viruses.
REFERENCES
[0394] Wrammert J, et al., Rapid and massive virus-specific plasmablast responses during acute dengue virus infection in humans. J Virol. 86, 2911-2918 (2012). [0395] DeFalco J et al., Non-progressing cancer patients have persistent B cell responses expressing shared antibody paratopes that target public tumor antigens. Clin Immunol. 187, 37-45 (2018). [0396] Zhiqiang Ku, et al., Antibody therapies for the treatment of COVID-19, Antibody Therapetitcs, Volume 3, Issue 2, April 2020, Pages 101-108. [0397] Walls et al., Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein, 2020, Cell 180, 1-12, Mar. 19, 2020. [0398] Claudia A. Castro Jaramillo, et al. (2017) Toward in vitro-to-in vivo translation of monoclonal antibody pharmacokinetics: Application of a neonatal Fc receptor-mediated transcytosis assay to understand the interplaying clearance mechanisms, mAbs, 9:5, 781-791, DOI: 10.1080/19420862.2017.1320008. [0399] Chung S, Nguyen V, Lin Y L, et al. An in vitro FcRn-dependent transcytosis assay as a screening tool for predictive assessment of nonspecific clearance of antibody therapeutics in humans. MAbs. 2019; 11(5):942-955. doi:10.1080/19420862.2019.1605270. [0400] Rogers et al., Rapid isolation of potent SARS-CoV-2 neutralizing antibodies and protection in a small animal model. doi: //doi.org/10.1101/2020.05.11.088674.
[0401] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications may be suggested to persons skilled in the art after reviewing this disclosure, which are to be included within the scope of the appended claims. All publications, sequence accession numbers, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
TABLE-US-00003 TABLE 1 Antigen Assay Type of data output S trimer ELISA OD value, RLUs S1 protein BLI On-rate and off-rate S2 protein BLI On-rate and off-rate Receptor Binding Domain (RBD) BLI On-rate and off-rate Nucleocapsid (N) BLI On-rate and off-rate Envelope (E) ELISA OD value
TABLE-US-00004 TABLE 2 Anti-S (Sino) Anti-S2 ACE2-hFc K.sub.a K.sub.d K.sub.D K.sub.a K.sub.d K.sub.D K.sub.a K.sub.d K.sub.D Response (1/Ms) (1/s) (M) Response (1/Ms) (1/s) (M) Response (1/Ms) (1/s) (M) RBD 0.59 1.21 6.89 5.70 N/A N/A N/A N/A 0.26 5.38 9.42 1.75 E+05 E07 E12 E+05 E04 E09 S1 0.7 1.94 5.23 2.69 N/A N/A N/A N/A 0.43 1.04 1.07 1.03 E+04 E05 E09 E+05 E02 E07 S2 N/A N/A N/A N/A 0.99 2.37 4.88 2.06 N/A N/A N/A N/A E+04 E07 E11
TABLE-US-00005 TABLE3 SEQ SEQ Anti- ID ID body VH NO: VL NO: AB- QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAV 1. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 2. 010020 QWVRQARGQRLEWIGWIVVGSGNTNYAQKFQE KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRL RVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPAC EPEDFAVYYCQQYGSSPWTFGQGTKVEIK SSTSCYDGFDIWGQGTMVTVSS AB- QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAV 3. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 4. 010021 QWVRQARGQRLEWIGWIVVGSGNTNYAQKFQE KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE RVTITRDMSTSTAYMELSSLRSEDTAVYYCAAVYC PEDFAVYYCQQYGSSRGWTFGQGTKVEIK SGGSCLDAFDIWGQGTMVTVSS AB- QVQMVQSGAEVKKPGSSVKVSCKASGGSFSDYD 5. QSALTQPASVSGSPGQSITISCTGTTNDVGTYDLVSWY 6. 009662 FSWVRQAPGQGLEWMGGSLRVFATAVYAQNF QQRPGKAPKLIMYEVTKRPSGLFNRFSGSKSGNTASLTI QGRVTITADESTSTTFMELRSLSFADTAVYYCARD SRLQAEDEAHYYCCSHAGRGTFVFGTGTQVTVL DAQTLDQWGQGTLVTVSS AB- QVQLVQSGAEVKKPGASVKVSCKVSGYTLIELSM 7. QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQ 8. 009665 HWVRQAPGKGLEWMGGFDPEDGETIYAQKFQ QLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITG GRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAAA LQTGDEADYYCGTWDSSLSAGVFGGGTKLTVL RVFGVATWFDPWGQGTLVTVSS AB- EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDM 9. DIQMTQSPSSLSASVGDRVTITCRASQSISRYLNWYQQ 10. 009666 HWVRQATGKGLEWVSTIGTAGDTYYPGSVKGRF KPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ TISRENAKNSLYLQMNSLRAEDTAVYYCARVNYD PEDFATYNCQQSYSSPPWTFGQGTKVEIK SSGYPTYWYFDLWGRGTLVTVSS AB- QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYY 11. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 12. 009679 WSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSRVT KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE ISVDTSKNQFSLKLSSVTAADTAVYYCARAAATITIF PEDFAVYYCQQYGSSPLTFGGGTKVEIK GVVINWFDPWGQGTLVTVSS AB- QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYY 13. QSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWY 14. 009627 WSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRV QQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLT TISVDTSKNQFSLKLSSVTAADTAVFYCARGGYSSS ISGLQAEDEADYYCCSYAGSPYVFGTGTKVTVL WYGEKYWFDPWGQGTLVTVSS AB- QITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGV 15. QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWY 16. 443921978 GWIRQPPGKALEWLALIYWDDDKRYSPSLKSRLTI QQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTI TKDTSKNQVVLTMTNMDPVDTATYYCAHHTVTT SGLQAEDEADYYCSSYTSSSLVFGGGTKLTVL LWGYWGQGTLVTVSS AB- EVQLVESGGGLIQPGGSLRLSCAASGFIVSSNYMS 17. EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQ 18. 009271 WVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTI KPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQ SRDNSKNTLYLQMNSLRAEDTAVYYCARDYGDFY SEDFAVYYCQQYYNWPRTFGQGTKVEIK FDYWGQGTLVTVSS AB- QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAI 19. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 20. 009610 SWVRQAPGQGLEW KPG MGRIIPILGIANYAQKFQGRVTITADKSTSTAYMEL QAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPED SSLRSEDTAVYYCATTPYYYDSSGYYLDYWGQGTL FAVYY VTVSS CQQYVSSPRTFGQGTKVEIK AB- EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMS 21. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 22. 009613 WVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTI KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRL SRDNSKNTLYLQMNSLRAEDTAVYYCARDYGDFY EPEDFAVYYCQQYGSSPRTFGQGTKVEIK FDYWGQGTLVTVSS AB- EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWM 23. SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQK 24. 009231 SWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGR PG FTISRDNAKNSLYLQMNSLRAEDTAVYYCARVSM QAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQA RFLEWSFYYYYYMDVWGKGTTVTVSS EDEADYY CNSRDSSGNHLGVVFGGGTKLTVL AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGM 25. SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQK 26. 009214 HWVRQAPGKGLEWVAVIWYDGSNKYYADSVKG SG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDEP QAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVE PSYYGSGSRFDYWGQGTLVTVSS DEADYY CYSTDSSGNHWVFGGGTKLTVL AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAM 27. SYELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQK 28. 009112 HWVRQAPGKGLEWVAVISYDGSNKYYADSVKGR PG FTISRDNSKNTLYLQMNSLRAEDTAVYYCASSLVG QAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQA ATKSYYYYYYGMDVWGQGTTVTVSS GDEADYY CQVWDSSSVVFGGGTKLTVL AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAM 29. SYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQK 30. 009190 HWVRQAPGKGLEWVAVISYDGSNKYYADSVKGR PG FTISRDNSKNTLYLQMNSLRAEDTAVYYCARLNG QAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAE DAYYYYGMDVWGQGTTVTVSS DEADYY CQSADSSGTYWVFGGGTKLTVL AB- QVQLQESGPGLVKPSETLALTCTVSGDSIINNNFY 31. SYELTQPPSVSVSLGQTARISCSGDALPTKYVHWYQQK 32. 009108 WGWLRQPPGQGLEWIGSLFHTGSAYYNSSLKSR AGQAPVVVIFRDTERPSEIPERFSGSSSGTTVTLTISGVQ VRSSVDTARNQISLRLSSVTAADTAVYYCARVNIV AEDEADYYCQSVDGSGFYVFGSGTKVTVL SVPAPPGAIEGWFDPWGQGTRVTVSP AB- QVQLQESGPGLVKPSETLSLTCSVSGDSVNTYYW 33. EIVLTQSPATLSLSPGERATLSCRASQSVSTYLAWYQQQ 34. 009916 SWIRHPPGKGLEWIAYIYYNGNTNYNPSLKSRVT PGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTITSLE MSLDASKNQFTLRLNSVTAADTAVYYCAGSLRGS PEDFAVYYCQQRTIWPQWTFGQGTKVDIK QWLWGLWGHGTLVTVSS AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGM 35. SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQK 36. 009074 HWVRQAPGKGLEWVAVIWYDGSNKYYADSVKG SGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQ RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGL VEDEADYYCYSTDSSGNHGVFGTGTKVTVL VGATTGFDYWGQGTLVTVSS AB- ELQLVESGGGLVKPGGSLRLSCTASGFTFISYSISW 37. EIVMTQSPATLSVSPGERATLSCRASQSISINLAWYQQR 38. 009117 VRQAPGKGLEWVSSISSYSNYIFYGDSVKGRFNIS PGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQS RDNPKNSVYLQLNSLRAEDTAVYYCVRDTSFYEG EDSAVYYCQQYNNWPPYTFGQGTTLEIK GGYYNRFEPWGQGTRVTVSS AB- QVQLLQSGAEVRKPGASVKVSCKASGYTFSSYVM 39. SYELTQPPSVSVSSGQTASIPCSGDRVGDRYVCWYQQK 40. 009123 HWVRQAPGQGLEWMGWINTGNGNTRYSQKIQ PGQSPVLVIYQDSKRPSGIPERFSGSNSGSTATLTISGTQ GRVTFTIDTAANTVNMEVSSLRSEDTAVYYCARE AIDEADYYCQAWDSSTGGVFGGGTKLTVL GLRATHYFDYWGRGTLVTVSS AB- QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYY 41. EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ 42. 009080 WSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRV KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRL TISVDTSKNQFSLKLSSVTAADTAVYYCARGLPVTT EPEDFAVYYCQQYGSSPRTFGQGTKVEIK FYYYYYGMDVWGQGTTVTVSS AB- EVHLLESGGGLVQPGGSLTLTCAASGFSFGNYVM 43. EIVLTQSPASLSLSPGGWATLSCRASRSIGNSLAWYQQR 44. 009083 GWVRQAPGKGLEWVSSIFGSGANPHYGGSVKG PGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLE RFTISRDNSQNTLFLQMDSLTAEDTAVYYCARDG PEDFAIYYCQQRNSWPPLYTFGQGTKLEIK GTMVGGIITGGFNYFDSWGQGTLVTVSS AB- QVQLAQSGAEVKRPGASVKVSCKASGFDLTTYGV 45. QSALTQPASVSGSPGQSITITCTGSSSDIGGFDFVSWYQ 46. 009106 GWVRQAPGQGLEWMGWISGSSGDTHYAQQF QYPGKAPKLVISEVTNRPSGVSIRFSGSKSGNTASLTISG QDRVTMTTDTPTSTAYMELRSLRSDDTAVYYCVR LQAEDEADYYCSSYASSYPTTNTRVFGTGTKVTVL ENIAHYGSRTFLVRYYRGMDVWGQGTTVTVAS AB- QITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGV 47. DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLD 48. 009078 GWIRQPPGKALEWLALIYWDDDKRYSPSLKSRLTI WYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFT TKDTSKNQVVLTMTNMDPVDTATYYCAHRPGDF LKISRVEAEDVGVYYCMQALQTPLTFGGGTKVEIK WSGYYRYWGQGTLVTVSS AB- EVQLVQSGAEVKKPGESLIISCTGSGYTFATFWIT 49. QSALTQPPSASGSPGQSVTISCAGASTDVGVYNFVSWY 50. 009095 WVRQMPGKGLEWLGRIDPSDSYTNYNPSFQGH QQHPGKAPKLIIFDVNKRPSGVPDRFSGSKSGNTASLTV VTVSVDRSINTAYLELTSLKASDTAIYYCARQMYN SGLQAEDEADYYCSSYEVGNNFVFGTGTKVTVL TGWPIPNYSDYWGQGTLVTVSS AB- EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAM 51. SYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQK 52. 009119 HWVRQASGKGLEWVGRIRSKANSYATAYAASVK PGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQ GRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTRH AEDEADYYCQSADSSGTYVVFGGGTKLTVL GTTVNWGQGTLVTVSS AB- QVQLRQWGAGLLKPSETLSVTCAVFGGSLNDFS 53. DIQMTQSPSTLSAYVGDRVTITCRASENINRWLAWYQ 54. 009086 WSWIRQPLGKGLEWIGEINQSGSINYNPSLKSRV QKPGKAPKLLIYKASNLENGVPSRFSGSGSGTDFTLTIN TMSLDTSKNQFSLKLTSVTAADTAIYYCARERRDR NLQPDDFATYHCQQYKSDFTFGQGTRVEIK EYFYYYYYMDVWGTGTTVTVSS AB- EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSM 55. DTVMTQSPLSLAVTPGEPASMSCTSSQSLLSGNGHNYL 56. 009144 NWVRQVPGKGLEWVSSISSGSTHIYYADSVKGRF NWYVQKPGQSPQLLIHVGSTRASGVPDRFSGSGSGTD TISRDNAKNSLYLQMSSLRAEDTAVYYCARPPGYC FTLRITRVEAEDVGVYYCMQTLQTPTFGQGTKLEIK SGSTCSLVWGDFFDYWGPGTLVTVSS AB- EVQLLESGGGLVQPGGSLRLSCAASGITFSDYGM 57. EIVLTQSPGTLSVSPGERATLSCRASQSVGNAFAWYQR 58. 009155 TWVRQAPGKGLEWVSATYNDVDTHYANSVKGR KPGQAPRLLIYDAYIRATGIPVRISGSGSGTDFTLTISSLQ FTTSRDNSRSTLYLQMNNLRAGDTAIYYCATYCSY SEDFAVYYCQQYHDWPLTFGGGTKVEIK TNCNPHGMHVWGQGTTVTVSS AB- QVQLVQSGAEVKEPGASVKVSCNASGYIFTSYGIS 59. EILLTQSPATLSVSPGERGSLSCRASQSVGTNLAWYQQK 60. 009110 WVRQAPGQGLEWVGWISGNNGNTNYAQKFQG PGQAPRLLIYGASARATGIPARFSGSGSGTEFTLTISSLQ RVTLTTDTSTSTAYLELRSLTSADTGVYFCARARLP SEDFGVYYCQQYNDWPPWTFGQGTKVEIK SAYWGPGTLLTVSS AB- EVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYM 61. DIQMTQSPSSLSASVGDRVSITCQASQDISNDLNWYQ 62. 009221 SWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFT QKPGKAPKLLVYDASKLETGVPPRFSGSGSGTDFTFTISS ISRHNSKNTLYLQMNSLRAEDTAVYYCARDRNAF LQPEDIATYYCQQYDNLPLYSFGQGTKLEIK DIWGQGTMVIVSS AB- QVQLVQSGAEVKKPGASVKVSCKTSGYTFTTFYIH 63. QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWY 64. 009251 WVRQVPGQGLEWMGIINPDGGSTNYAQEFQAR QQLPGTAPKLLIFDNNNRPSGVPYRFSGSRSGTSASLAI VTMTTDTSTSTAYMELSSLRFEDTAVFYCATSLGA TGLQPEDEADYYCQSYDSSLSGRVFGGGTRVTVL PPGLSPRTGPQRRGPPGFDFWGQGTLITVSA AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAM 65. QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWY 66. 009226 HWVRQAPGKGLEWVAVISYDGSNKYYADSVKGR QQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLT FTISRDNSKNTLYLQMNSLRAEDTAVYYCARARS ISGLQAEDEADYYCSSYTSSSTLYVFGTGTKVTVL GSYYYGMDVWGQGTTVTVSS AB- QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYY 67. QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWF 68. 009182 WSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRV QQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALT TISVDTSKNQFSLKLSSVTAADTAVYYCARGSTVTT LSGAQPEDEAEYYCLLSYSGARVFGGGTKLTVL FYYYYGMDVWGQGTTVTVSS AB- EVQLVQSGAEVKKPGESLRISCQSSGYSFSTYWIA 69. QSALTQPDSVSGSPGQSIAISCTGTSRDVGGYNYVSWY 70. 009263 WVRQTPEKGLEWMGIIYPGDSDTRYSPTFQGQV QQHPGKAPKLMIYEVSNRPSGVSDRFSGSKSDNTASLTI TISADTSISTAYLQWSSLKASDTAVYYCARFRFNW SGLQGDDEANYYCSSYTDSGTLVFGGGTKVTVL LLSYYYYYMDVWGKGTTVSVSS AB- QVQLQQWGAGLLKPSETLSLTCAVYGESFSGYY 71. QSALTQPASVSGSPGQSITISCTGTSSDVGRYNYVSWY 72. 009174 WNWIRQPPGKGLEWIGEIDQSGSTNYNPSLKSR QQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLT VTISVDTSKNQFSLKLTSVTAADTAVYYCARVSGR ISGLQAEDEADYYCSSYTTSSTRVFGGGTKLTVL MQLWLRAGYMDVWDKGTTVTVSS AB- QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGM 73. SYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQK 74. 009202 HWVRQAPGKGLEWVAVIWYDGSNKYYADSVKG PGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQ RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDG AEDEADYYCQSADSSGTYNVVFGGGTKLTVL GPEYYFDYWGQGTLVTVSS AB- EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSM 75. DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQ 76. 009213 NWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFT KPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSL ISRDNAKNSLYLQMNSLRAEDTAVYYCARDKLRE QPEDIATYYCQQYDNLPLTFGGGTKVEIK DGDYDDAFDIWGQGTMVTVSS AB- QVQLLQSGAEVKKPGASVSVSCKASGFTFTSYYFH 77. DIQVTQSPSTLSASVGDRVTITCRASQSILTYLAWYQQK 78. 009237 WVRQAPGQGLEWMGIVSPAGGSTNYAQKFQG PGKAPNLLIYKASNLQSGVPSRFSGSGSGTEFTLTISSLQ RVTMTRDTSTSTVHMELRNVRYDDTAVFYCARS PDDFATYHCQQYKSYPFSFGQGTKLAIK VYCSSPSCPHGMDVWGPGTMVTVSS AB- QVHLEESGGGVVQPGRSLRLSCAASGFTFSGYAM 79. DVVMTQSPLSLPVTLGQPASISCRSSQSLVHSDGHTYL 80. 009239 HWVRQAPGKGLAWVAVISYDGTNKYYTDSVKG NWIQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDF RFSISRDNSNNTLYLQMNSLRTEDTALYYCARALT TLKISRVEADDVGIYYCVQGTHWPPWTFGQGTKVEIK GYYGQFDFDSWGQGTLVTVSS AB- EVQLVESGGGLVQPGGSLRLSCAASGFAFNTYGI 81. EVVMTQSPATLSVSSGERVTLSCRASQSVSNNLAWYQ 82. 009244 NWVRQAPGKGLEWVSFISSRSTTIHYADSVRGRF QKPGQAPRLLIYGASTRATGFPARFSGSGSGTEFTLTISS TISRDNAKNSLYLQMNNLRDEDTAVYYCARDLLI LQSEDFAVYYCQQYNIWPPGTFGQGTKLEIK WFGETGAFDIWGQGTMVTVSS
TABLE-US-00006 TABLE4 Anti- SEQID SEQID SEQID SEQID SEQID SEQID body HCDR1 NO: HCDR2 NO: HCDR3 NO: LCDR1 NO: LCDR2 NO: LCDR3 NO: AB- GFTFTSSAV 83. WIVVGSGN 84. AAPACSSTSCY 85. RASQSVSSSY 86. GASSRAT 87. QQYGSSPW 88. 010020 Q TNYAQKFQ DGFDI LA T E AB- GFTFTSSAV 89. WIVVGSGN 90. AAVYCSGGSCL 91. RASQSVSSSY 92. GASSRAT 93. QQYGSSRG 94. 010021 Q TNYAQKFQ DAFDI LA WT E AB- GGSFSDYD 95. GSLRVFAT 96. ARDDAQTLDQ 97. TGTTNDVGT 98. EVTKRPS 99. CSHAGRGTF 100. 009662 FS AVYAQNFQ YDLVS V G AB- GYTLIELSM 101. GFDPEDGE 102. AAARVFGVAT 103. SGSSSNIGNN 104. DNNKRPS 105. GTWDSSLSA 106. 009665 H TIYAQKFQ WFDP YVS GV G AB- GFTFSSYD 107. TIGTAGDTY 108. ARVNYDSSGY 109. RASQSISRYL 110. AASSLOS 111. QQSYSSPP 112. 009666 MH YPGSVKG PTYWYFDL N WT AB- GGSISSGGY 113. YIYYSGSTY 114. ARAAATITIFG 115. RASQSVSSSY 116. GASSRAT 117. QQYGSSPLT 118. 009679 YWS YNPSLKS VVINWFDP LA AB- GGSFSGYY 119. EINHSGST 120. ARGGYSSSWY 121. TGTSSDVGGY 122. DVSKRPS 123. CSYAGSPYV 124. 009627 WS NYNPSLKS GEKYWFDP NYVS AB- GFSLSTSGV 125. LIYWDDDK 126. AHHTVTTLWG 127. TGTSSDVGGY 128. EVSNRPS 129. SSYTSSSLV 130. 443921978 GVG RYSPSLKS Y NYVS AB- GFIVSSNY 131. VIYSGGSTY 132. ARDYGDFYFD 133. RASQSVSSNL 134. GASTRAT 135. QQYYNWPR 136. 009271 MS YADSVKG Y A T AB- GGTFSNYAI 137. RIIPILGIAN 138. ATTPYYYDSSG 139. RASQSVSSSY 140. GASSRAT 141. QQYVSSPRT 142. 009610 S YAQKFQG YYLDY LA AB- GFTVSSNY 143. VIYSGGSTY 144. ARDYGDFYFD 145. RASQSVSSSY 146. GASSRAT 147. QQYGSSPRT 148. 009613 MS YADSVKG Y LA AB- GFTFSSYW 149. NIKQDGSE 150. ARVSMRFLEW 151. QGDSLRSYYA 152. GKNNRPS 153. NSRDSSGNH 154. 009231 MS KYYVDSVK SFYYYYYMDV S LGVV G AB- GFTFSSYG 155. VIWYDGSN 156. ARDEPPSYYGS 157. SGDALPKKYA 158. EDSKRPS 159. YSTDSSGNH 160. 009214 MH KYYADSVK GSRFDY Y WV G AB- GFTFSSYA 161. VISYDGSNK 162. ASSLVGATKSY 163. GGNNIGSKN 164. RDSNRPS 165. QVWDSSSV 166. 009112 MH YYADSVKG YYYYYGMDV VH V AB- GFTFSSYA 167. VISYDGSNK 168. ARLNGDAYYY 169. SGDALPKQYA 170. KDSERPS 171. QSADSSGTY 172. 009190 MH YYADSVKG YGMDV Y WV AB- GDSIINNNF 173. SLFHTGSAY 174. ARVNIVSVPAP 175. SGDALPTKYV 176. RDTERPS 177. QSVDGSGFY 178. 009108 YWG YNSSLKS PGAIEGWFDP H V AB- GDSVNTYY 179. YIYYNGNT 180. AGSLRGSQWL 181. RASQSVSTYL 182. DASNRAT 183. QQRTIWPQ 184. 009916 WS NYNPSLKS WGL A WT AB- GFTFSSYG 185. VIWYDGSN 186. AREGLVGATT 187. SGDALPKKYA 188. EDSKRPS 189. YSTDSSGNH 190. 009074 MH KYYADSVK GFDY Y GV G AB- GFTFISYSIS 191. SISSYSNYIF 192. VRDTSFYEGG 193. RASQSISINLA 194. GASTRAT 195. QQYNNWPP 196. 009117 YGDSVKG GYYNRFEP YT AB- GYTFSSYV 197. WINTGNG 198. AREGLRATHYF 199. SGDRVGDRY 200. QDSKRPS 201. QAWDSSTG 202. 009123 MH NTRYSQKI DY VC GV QG AB- GGSFSGYY 203. EINHSGST 204. ARGLPVTTFYY 205. RASQSVSSSY 206. GASSRAT 207. QQYGSSPRT 208. 009080 WS NYNPSLKS YYYGMDV LA AB- GFSFGNYV 209. SIFGSGANP 210. ARDGGTMVG 211. RASRSIGNSL 212. DASNRAT 213. QQRNSWPP 214. 009083 MG HYGGSVKG GIITGGFNYFD A LYT S AB- GFDLTTYG 215. WISGSSGD 216. VRENIAHYGSR 217. TGSSSDIGGF 218. EVTNRPS 219. SSYASSYPTT 220. 009106 VG THYAQQFQ TFLVRYYRGM DFVS NTRV D DV AB- GFSLSTSGV 221. LIYWDDDK 222. AHRPGDFWS 223. RSSQSLLHSN 224. LGSNRAS 225. MQALQTPL 226. 009078 GVG RYSPSLKS GYYRY GYNYLD T AB- GYTFATFW 227. RIDPSDSYT 228. ARQMYNTGW 229. AGASTDVGV 230. DVNKRPS 231. SSYEVGNNF 232. 009095 IT NYNPSFQG PIPNYSDY YNFVS V AB- GFTFSGSA 233. RIRSKANSY 234. TRHGTTVN 235. SGDALPKQYA 236. KDSERPS 237. QSADSSGTY 238. 009119 MH ATAYAASV Y VV KG AB- GGSLNDFS 239. EINQSGSIN 240. ARERRDREYFY 241. RASENINRWL 242. KASNLEN 243. QQYKSDFT 244. 009086 WS YNPSLKS YYYYMDV A AB- GFTFSSYS 245. SISSGSTHIY 246. ARPPGYCSGST 247. TSSQSLLSGN 248. VGSTRAS 249. MQTLQTPT 250. 009144 MN YADSVKG CSLVWGDFFD GHNYLN Y AB- GITFSDYG 251. ATYNDVDT 252. ATYCSYTNCNP 253. RASQSVGNA 254. DAYIRAT 255. QQYHDWPL 256. 009155 MT HYANSVKG HGMHV FA T AB- GYIFTSYGIS 257. WISGNNG 258. ARARLPSAY 259. RASQSVGTNL 260. GASARAT 261. QQYNDWPP 262. 009110 NTNYAQKF A WT QG AB- GFTVSSNY 263. VIYSGGSTY 264. ARDRNAFDI 265. QASQDISNDL 266. DASKLET 267. QQYDNLPLY 268. 009221 MS YADSVKG N S AB- GYTFTTFYI 269. IINPDGGST 270. ATSLGAPPGLS 271. TGSSSNIGAG 272. DNNNRPS 273. QSYDSSLSG 274. 009251 H NYAQEFQA PRTGPQRRGP YDVH RV PGFDF AB- GFTFSSYA 275. VISYDGSNK 276. ARARSGSYYYG 277. TGTSSDVGGY 278. EVSNRPS 279. SSYTSSSTLY 280. 009226 MH YYADSVKG MDV NYVS V AB- GGSFSGYY 281. EINHSGST 282. ARGSTVTTFYY 283. GSSTGAVTSG 284. DTSNKHS 285. LLSYSGARV 286. 009182 WS NYNPSLKS YYGMDV HYPY AB- GYSFSTYWI 287. IIYPGDSDT 288. ARFRFNWLLSY 289. TGTSRDVGG 290. EVSNRPS 291. SSYTDSGTLV 292. 009263 A RYSPTFQG YYYYMDV YNYVS AB- GESFSGYY 293. EIDQSGST 294. ARVSGRMQL 295. TGTSSDVGRY 296. EVSNRPS 297. SSYTTSSTRV 298. 009174 WN NYNPSLKS WLRAGYMDV NYVS AB- GFTFSSYG 299. VIWYDGSN 300. ARDGGPEYYF 301. SGDALPKQYA 302. KDSERPS 303. QSADSSGTY 304. 009202 MH KYYADSVK DY Y NVV G AB- GFTFSSYS 305. SISSSSSYIY 306. ARDKLREDGD 307. QASQDISNYL 308. DASNLET 309. QQYDNLPLT 310. 009213 MN YADSVKG YDDAFDI N AB- GFTFTSYYF 311. IVSPAGGST 312. ARSVYCSSPSC 313. RASQSILTYLA 314. KASNLQS 315. QQYKSYPFS 316. 009237 H NYAQKFQG PHGMDV AB- GFTFSGYA 317. VISYDGTNK 318. ARALTGYYGQ 319. RSSQSLVHSD 320. KVSNRDS 321. VQGTHWPP 322. 009239 MH YYTDSVKG FDFDS GHTYLN WT AB- GFAFNTYGI 323. FISSRSTTIH 324. ARDLLIWFGET 325. RASQSVSNNL 326. GASTRAT 327. QQYNIWPP 328. 009244 N YADSVRG GAFDI A GT
TABLE-US-00007 TABLE 5 Antibody RBD: BLI S1: BLI S2: BLI ID Epitope Response KD (M) K.sub.a (1/Ms) K.sub.d (1/s) Response KD (M) K.sub.a (1/Ms) K.sub.d (1/s) Response AB-009074 S2 0.2948 AB-009078 S2 0.0579 AB-009080 S2, S Trimer 0.3306 (ELISA) AB-009083 S2, S Trimer 0.2073 (ELISA) AB-009084 Envelope AB-009085 Nucleocapsid AB-009090 Envelope AB-009091 Nucleocapsid AB-009094 Nucleocapsid AB-009095 S2, Nucleocapsid 0.111 AB-009099 Envelope AB-009103 Envelope AB-009104 Envelope AB-009106 S2, S Trimer 0.1889 (ELISA) AB-009108 S1, S Trimer 0.1437 9.43E08 1.34E+05 1.26E02 (ELISA) AB-009110 S Trimer (ELISA) AB-009112 Nucleocapsid, Envelope AB-009114 Nucleocapsid AB-009115 Nucleocapsid AB-009116 RBD 0.3183 2.0327E08 2.90E+04 5.90E04 AB-009117 S2 0.5327 AB-009119 S2, Nucleocapsid 0.0483 AB-009123 S2 0.5001 AB-009126 Nucleocapsid AB-009127 Nucleocapsid AB-009147 Envelope AB-009162 Envelope AB-009166 Nucleocapsid Negative Control (AB- 000129) CR3022: RBD, S1, S 0.7096 4.3769E09 2.65E+05 1.16E03 0.5066 6.85E08 1.50E+05 1.03E02 SARS- Trimer (ELISA) CoV-1 Control; AB-009073 AB-009168 Nucleocapsid AB-009170 Nucleocapsid AB-009172 Envelope AB-009173 Nucleocapsid AB-009174 S Trimer (ELISA) AB-009177 Nucleocapsid AB-009180 Nucleocapsid AB-009182 S2 0.3217 AB-009185 Nucleocapsid AB-009189 Nucleocapsid AB-009190 Nucleocapsid, Envelope AB-009196 Nucleocapsid AB-009197 Nucleocapsid AB-009202 S Trimer (ELISA) AB-009203 Nucleocapsid AB-009204 Nucleocapsid AB-009206 Envelope AB-009209 Nucleocapsid AB-009211 Envelope AB-009212 Nucleocapsid AB-009213 Nucleocapsid AB-009214 S2, S Trimer 0.0684 (ELISA), Envelope AB-009217 Nucleocapsid AB-009218 Nucleocapsid AB-009220 Nucleocapsid AB-009221 RBD, S1, S 0.3021 2.6419E08 4.58E+04 1.21E03 0.1715 3.40E08 3.77E+04 1.28E03 Trimer (ELISA) AB-009224 Nucleocapsid AB-009226 S2, S Trimer 0.6826 (ELISA) AB-009227 Nucleocapsid AB-009228 Nucleocapsid AB-009229 Nucleocapsid AB-009230 Nucleocapsid AB-009231 S Trimer (ELISA), Envelope AB-009232 Nucleocapsid AB-009233 Nucleocapsid AB-009235 Nucleocapsid AB-009236 Nucleocapsid AB-009237 S Trimer (ELISA) AB-009239 S Trimer (ELISA) AB-009244 S Trimer (ELISA) AB-009248 Nucleocapsid AB-009251 RBD, S1, S 0.3003 9.3056E09 5.04E+04 4.69E04 0.06 4.81E08 1.13E+04 5.44E04 Trimer (ELISA) AB-009263 S2 0.1983 AB-009268 Envelope SARS- RBD, S1, S 0.58 4.7684E09 1.77E+05 8.44E04 0.3608 2.77E08 3.86E+05 1.07E02 CoV-2 Trimer (ELISA) Pos Control CB6 (AB- 009264) SARS- RBD, S1, S 0.53 5.7227E09 1.19E+05 6.81E04 0.27 4.36E08 2.91E+05 1.27E02 CoV-2 Trimer (ELISA) Pos Control CA-1 (AB- 009265) AB-009271 RBD, S1, S 0.5181 1.509E08 9.32E+04 1.41E03 0.4888 5.54E08 7.59E+04 4.20E03 Trimer (ELISA) AB-009610 RBD, S1, S 0.3927 2.158E08 4.95E+04 1.07E03 0.2789 1.11E07 4.11E+04 4.56E03 Trimer (ELISA) AB-009613 RBD, S1, S 0.5563 4.261E09 7.34E+04 3.13E04 0.3458 1.61E08 6.36E+04 1.02E03 Trimer (ELISA) AB-009617 S Trimer (ELISA) AB-009618 S Trimer (ELISA) AB-009621 S1, S Trimer 0.0859 (ELISA) AB-009622 S Trimer (ELISA) AB-009623 S Trimer (ELISA), Envelope AB-009624 S Trimer (ELISA) AB-009625 S2, S Trimer 0.1266 (ELISA) AB-009626 S2, S Trimer 0.1156 (ELISA) AB-009627 S2, S Trimer 0.1052 (ELISA) AB-009632 S2, S Trimer 0.0792 (ELISA) AB-009634 S1, S Trimer 0.4137 2.48E08 2.00E+04 4.96E04 (ELISA) AB-009636 S1, S Trimer 0.1141 (ELISA) AB-009648 Envelope AB-009653 Nucleocapsid AB-009658 Nucleocapsid AB-009663 S2, S Trimer 0.3131 (ELISA) AB-009665 S Trimer (ELISA) AB-009666 RBD, S1, S 0.3715 3.036E09 2.04E+05 6.20E04 0.482 1.19E08 4.59E+04 5.46E04 Trimer (ELISA) AB-009668 S Trimer (ELISA) AB-009670 S Trimer (ELISA) AB-009673 S Trimer (ELISA) AB-009685 S1, S Trimer 0.1031 3.77E09 1.79E+04 6.74E05 (ELISA) AB-009688 S Trimer (ELISA) AB-009694 S Trimer (ELISA) AB-009696 S2, S Trimer 0.1034 (ELISA), Envelope AB-009698 S1, S Trimer 0.1131 2.66E06 8.28E+02 2.21E03 (ELISA) AB-009701 S Trimer (ELISA) AB-009704 RBD, S1, S 0.3421 1.87E08 5.55E+04 1.04E03 0.1646 2.42E08 2.60E+04 6.29E04 Trimer (ELISA) AB-010020 RBD, S1, S 0.2436 2.16E09 9.80E+05 2.12E03 0.3754 1.3477E08 5.12E+05 6.90E03 Trimer (ELISA) AB-010021 RBD, S1, S 0.3566 1.24E08 2.21E+05 2.75E03 0.2144 1.2515E08 1.71E+05 2.14E03 Trimer (ELISA) S trimer: Envelope: ELISA ELISA Optical Optical Density Density Antibody S2: BLI (OD; Nucleocapsid: BLI (OD; ID Epitope KD (M) K.sub.a (1/Ms) K.sub.d (1/s) 450 nm) Response KD (M) K.sub.a (1/Ms) K.sub.d (1/s) 450 nm) AB-009074 S2 9.13 1.20E+04 1.10E03 E08 AB-009078 S2 4.74 5.15E+03 2.44E07 E11 AB-009080 S2, S Trimer 1.11 2.52E+03 2.79E07 0.166 (ELISA) E10 AB-009083 S2, S Trimer 1.64 3.01E+03 4.95E07 0.249 (ELISA) E10 AB-009084 Envelope 0.192 AB-009085 Nucleocapsid 1.0612 4.06E09 4.54E+04 1.85E04 AB-009090 Envelope 0.191 AB-009091 Nucleocapsid 0.8585 1.19E08 8.53E+04 1.01E03 AB-009094 Nucleocapsid 0.7628 1.15E08 8.36E+04 9.65E04 AB-009095 S2, Nucleocapsid 1.76 1.22E+03 2.15E07 1.0121 8.33E10 7.11E+04 5.93E05 E10 AB-009099 Envelope 1.182 AB-009103 Envelope 0.197 AB-009104 Envelope 0.503 AB-009106 S2, S Trimer 4.13 6.37E+03 2.63E07 0.1 (ELISA) E11 AB-009108 S1, S Trimer 0.28 (ELISA) AB-009110 S Trimer (ELISA) 0.081 AB-009112 Nucleocapsid, 0.8133 3.27E08 2.95E+04 9.64E04 0.248 Envelope AB-009114 Nucleocapsid 1.2449 3.41E09 6.06E+04 2.07E04 AB-009115 Nucleocapsid 0.2037 5.22E08 2.83E+04 1.48E03 AB-009116 RBD AB-009117 S2 1.15 3.82E+04 4.38E04 E08 AB-009119 S2, Nucleocapsid 5.83 4.39E+03 2.56E07 1.0548 7.35E09 8.80E+04 6.47E04 E11 AB-009123 S2 1.89 4.25E+04 8.02E04 E08 AB-009126 Nucleocapsid 0.1829 1.94E11 1.35E+04 2.60E07 AB-009127 Nucleocapsid 1.0426 7.85E12 6.50E+04 5.11E07 AB-009147 Envelope 0.198 AB-009162 Envelope 0.193 AB-009166 Nucleocapsid 0.4779 2.20E08 8.52E+04 1.87E03 Negative 0.041 Control (AB- 000129) CR3022: RBD, S1, S 1.378 SARS- Trimer (ELISA) CoV-1 Control; AB-009073 AB-009168 Nucleocapsid 0.4786 5.82E08 7.51E+03 4.37E04 AB-009170 Nucleocapsid 0.7056 1.45E08 4.23E+04 6.15E04 AB-009172 Envelope 0.249 AB-009173 Nucleocapsid 0.6644 2.33E08 2.66E+04 6.19E04 AB-009174 S Trimer (ELISA) 0.154 AB-009177 Nucleocapsid 0.9986 1.31E09 1.09E+05 1.43E04 AB-009180 Nucleocapsid 0.6708 3.49E11 6.56E+03 2.29E07 AB-009182 S2 1.63 1.49E+04 2.43E07 E11 AB-009185 Nucleocapsid 0.9818 1.86E09 1.02E+05 1.90E04 AB-009189 Nucleocapsid 1.0082 1.24E09 8.49E+04 1.05E04 AB-009190 Nucleocapsid, 0.4885 5.41E08 1.75E+04 9.47E04 0.469 Envelope AB-009196 Nucleocapsid 0.434 3.07E07 2.83E+03 8.70E04 AB-009197 Nucleocapsid 0.323 9.40E08 1.17E+04 1.10E03 AB-009202 S Trimer (ELISA) 1.986 AB-009203 Nucleocapsid 0.2337 3.78E08 1.03E+05 3.89E03 AB-009204 Nucleocapsid 0.766 1.27E08 3.81E+04 4.83E04 AB-009206 Envelope 0.302 0.298 AB-009209 Nucleocapsid 0.88 3.94E09 1.07E+05 4.22E04 AB-009211 Envelope 0.422 AB-009212 Nucleocapsid 0.9858 4.86E10 8.13E+04 3.95E05 AB-009213 Nucleocapsid 0.7125 1.00E08 1.12E+05 1.12E03 AB-009214 S2, S Trimer 2.32 1.54E+04 3.58E04 0.691 0.417 (ELISA), E08 Envelope AB-009217 Nucleocapsid 0.9572 3.71E09 8.63E+04 3.20E04 AB-009218 Nucleocapsid 0.2142 6.61E08 1.80E+05 1.19E02 AB-009220 Nucleocapsid 1.0306 1.26E09 9.06E+04 1.14E04 AB-009221 RBD, S1, S Trimer (ELISA) AB-009224 Nucleocapsid 0.9527 3.61E09 8.09E+04 2.92E04 AB-009226 S2, S Trimer 2.79 2.81E+04 7.83E04 2.329 (ELISA) E08 AB-009227 Nucleocapsid 0.973 1.90E09 9.41E+04 1.79E04 AB-009228 Nucleocapsid 0.8409 5.85E09 6.65E+04 3.89E04 AB-009229 Nucleocapsid 0.9551 1.39E10 5.25E+04 7.31E06 AB-009230 Nucleocapsid 0.8123 7.01E09 7.32E+04 5.13E04 AB-009231 S Trimer (ELISA), 0.46 0.782 Envelope AB-009232 Nucleocapsid 1.0421 1.86E09 7.74E+04 1.44E04 AB-009233 Nucleocapsid 0.4522 7.02E08 2.25E+04 1.58E03 AB-009235 Nucleocapsid 0.9774 2.02E09 1.05E+05 2.12E04 AB-009236 Nucleocapsid 0.7 1.63E08 1.56E+04 2.55E04 AB-009237 S Trimer (ELISA) 0.228 AB-009239 S Trimer (ELISA) AB-009244 S Trimer (ELISA) 0.239 AB-009248 Nucleocapsid 0.9737 5.28E09 9.65E+04 5.10E04 AB-009251 RBD, S1, S 0.886 Trimer (ELISA) AB-009263 S2 3.83 9.98E+03 3.82E07 AB-009268 Envelope E11 0.258 SARS- RBD, S1, S 2.81 CoV-2 Trimer (ELISA) Pos Control CB6 (AB- 009264) SARS- RBD, S1, S 2.743 CoV-2 Trimer (ELISA) Pos Control CA-1 (AB- 009265) AB-009271 RBD, S1, S 2.944 Trimer (ELISA) AB-009610 RBD, S1, S 2.02 Trimer (ELISA) AB-009613 RBD, S1, S 2.473 Trimer (ELISA) AB-009617 S Trimer (ELISA) 1.516 AB-009618 S Trimer (ELISA) 1.29 AB-009621 S2, S Trimer 1.105 3422 3.78E07 1.805 (ELISA) E10 AB-009622 S Trimer (ELISA) 1.376 AB-009623 S Trimer (ELISA), 2.229 0.21 Envelope AB-009624 S Trimer (ELISA) 0.503 AB-009625 S2, S Trimer 6.719 22550 0.001515 1.064 (ELISA) E08 AB-009626 S2, S Trimer 2.011 19980 0.004019 1.274 (ELISA) E07 AB-009627 S2, S Trimer 2.456 1159 2.847E07 0.823 (ELISA) E10 AB-009632 S2, S Trimer 5.18 6319 3.273E07 1.969 (ELISA) E11 AB-009634 S1, S Trimer 2.465 (ELISA) AB-009636 S2, S Trimer 6.271 38820 0.002435 0.864 (ELISA) E08 AB-009648 Envelope 0.779 AB-009653 Nucleocapsid 0.453 4.158E08 62340 0.002592 AB-009658 Nucleocapsid 0.9882 5.94E12 87740 5.212E07 AB-009663 S2, S Trimer 4.386 1.97E+04 8.624E06 2.224 (ELISA) E10 AB-009665 S Trimer (ELISA) 1.382 AB-009666 RBD, S1, S 2.764 Trimer (ELISA) AB-009668 S Trimer (ELISA) 1.159 AB-009670 S Trimer (ELISA) 1.932 AB-009673 S Trimer (ELISA) 1.393 AB-009685 S1, S Trimer 2.726 (ELISA) AB-009688 S Trimer (ELISA) 0.236 AB-009694 S Trimer (ELISA) 0.279 AB-009696 S2, S Trimer 1.998 1.22E+03 2.441E07 1.542 0.95 (ELISA), E10 Envelope AB-009698 S1, S Trimer 2.064 (ELISA) AB-009701 S Trimer (ELISA) 1.225 AB-009704 RBD, S1, S 0.65 Trimer (ELISA) AB-010020 RBD, S1, S 0.15* Trimer (ELISA) AB-010021 RBD, S1, S 0.23* Trimer (ELISA) *Half Maximal Effective Concentration (EC50)
TABLE-US-00008 TABLE 6 Pseudovirus Neutralization (g/mL) SARS- SARS- SARS- Neutralization SARS- CoV-2 Beta CoV-2 SARS- CoV-2 SARS- (Infectious SARS- CoV2 Alpha A_ Gamma CoV-2 Delta- CoV-2 Antibody virus; SARS- CoV-2 Wuban UKB. SAv2B. BrazilP.1. Delta plus Epsilon ID (g/mL)) CoV-1 Wuban D614G 1.1.7 1.351 B.1.1.28 B.1.617.2 B.1.617.2.1 B.1.427/9 AB-009271 0.181 >50 0.058 0.036 0.275 >50 >50 0.012 >50 0.028 AB-010020 N/T >50 0.004 0.003 0.013 0.0180 0.0114 0.003 0.001 0.003 AB-010021 N/T >50 1.560 0.700 2.686 8.2705 5.3877 0.574 0.078 0.629 AB-009613 3.4 >50 1.53 0.830 7.234 >50 >50 0.101 >50 1.16 AB-009610 6.25 >50 6.77 2.21 2.84 >50 >50 >50 >50 >50 Anti- N/T >50 >50 >50 >50 >50 >50 >50 >50 >50 Nucleo- capsid (Neg Control) N/T = Not Potency Tested 0.001 Potency Ab < 1.0 Ab < 0.001 1.0 0.001 Ab < 1.0 Ab < 1.0 1.0 > Ab 1.0 > Ab