Nanobody Exchange Chromatography
20240027467 · 2024-01-25
Inventors
- Jan Steyaert (Beersel, BE)
- Els Pardon (Wezemaal, BE)
- Alexandre Wohlkönig (Brussel, BE)
- Thomas Zögg (Heverlee, BE)
- Valentina Kalichuk (Brussel, BE)
- Phebe De Keyser (Kessel-Lo, BE)
- Baptiste Fischer (Watermaal-Bosvoorde, BE)
Cpc classification
International classification
Abstract
The present invention relates to the field of affinity purification and provides for means and methods applying protein binding agents competing for a target protein for use as capture and elution tool, wherein the elution agent comprises an immunoglobulin single variable domain (ISVD), and is capable of displacing the capturing binding agent. More specifically, the displacement efficiency of the ISVD-containing protein binding agent is driven by its dissociation kinetics, with a rate constant of dissociation (k.sub.off) equal or lower as compared to the capturing agent. Furthermore, said protein binding agents are deployable in high-throughput purification from complex mixtures, or for capturing protein-complexes, thereby facilitating structural, biochemical and physicochemical analysis of said target proteins.
Claims
1. A method for purification of a target protein, the method comprising: a) mixing a first protein binding agent which specifically binds the target protein with a sample containing the target protein, b) adding to the mix of a), second protein binding agent, wherein the second protein binding agent competes with the first binding agent for binding to the target protein, and by specifically binding the target protein thereby displaces the first binding agent from the target protein, and c) collecting the eluting second protein binding agent bound to the target protein, wherein the second protein binding agent comprises an immunoglobulin single variable domain (ISVD) or a functional variant thereof specifically binding the target protein, and wherein the rate constant of dissociation (k.sub.off value) of the second protein binding agent is lower or equal as compared to the k.sub.off value of the first binding agent.
2. The method according to claim 1, wherein the second protein binding agent recognizes and binds to the same or a largely overlapping epitope as the first binding agent.
3. The method according to claim 1, wherein the K.sub.D value for binding the target protein is in the range of 1 mM to 1 nM for the first protein binding agent and below 1 M for the second protein binding agent.
4. The method according to claim 3, wherein the K.sub.D value of the first protein binding agent is at least 2-fold higher as compared to the K.sub.D value of the second protein binding agent.
5. The method according to claim 1, wherein the binding agents specifically bind a tag on the target protein.
6. The method according to claim 1, wherein the binding agents specifically bind a post-translational modification on the target protein.
7. The method according to claim 1, wherein the binding agents specifically bind a scaffold protein domain of the target protein comprising an antigen-binding chimeric protein, wherein the antigen-binding chimeric protein is an ISVD fused to a scaffold protein via at least two sites.
8. The method of any of claims 1 to 7 according to claim 1, wherein the second protein binding agent is a multivalent or multiparatopic form of the first protein binding agent.
9. The method according to claim 1, wherein the first protein binding agent comprises an ISVD or functional variant thereof specifically binding the target protein.
10. The method according to claim 9, wherein the first protein binding agent comprises an ISVD which is mutated in the binding region to the target protein as compared to the second protein binding agent ISVD, and wherein the first protein binding agent has a higher k.sub.off as compared to the second protein binding agent.
11. The method according to claim 9, wherein the first and second binding agents comprise an identical ISVD, wherein the ISVD specifically binds the target protein, and preferably with a k.sub.off equal or higher than 0.0001 s.sup.1.
12. The method according to claim 1, wherein the first and/or second protein binding agent comprise a functional moiety or a detectable label.
13. The method according to claim 12, wherein the first and/or second protein binding agent comprise a functional moiety characterized in that the functionalized binding agent is an antigen-binding chimeric protein comprising an ISVD fused to a scaffold protein via at least two sites, wherein the ISVD specifically binds the target protein.
14. The method according to claim 1, wherein the first protein binding agent is immobilized, and the second protein binding agent is in solution.
15. The method according to claim 1, wherein the sample is a biological sample, a complex mixture, a cellular sample, or an in vitro sample.
16. The method according to claim 1, further comprising the steps of: repeating steps a) to c) of the method of claims 1-15, using a 3.sup.rd and 4.sup.th protein binding agent instead of, or in addition to the 1.sup.st and 2.sup.nd protein binding agents, respectively, wherein the 3.sup.rd and 4.sup.th binding agent specifically bind a different epitope of the target protein as compared to the epitope for the 1.sup.st and 2.sup.nd binding agent, and wherein the 4.sup.th protein binding agent comprises an ISVD and has a rate constant of dissociation (k.sub.off value) that is lower or equal as compared to the k.sub.off value of the 3.sup.rd protein binding agent.
17. (canceled)
18. A kit comprising a first and second protein binding agent, wherein the first protein binding agent specifically binds to target protein, wherein the second protein binding agent competes with the first binding agent for binding to the target protein, and by specifically binding the target protein, thereby displaces the first binding agent from the target protein, and wherein the second protein binding agent comprises an immunoglobulin single variable domain (ISVD) or a functional variant thereof specifically binding the target protein, wherein the rate constant of dissociation (k.sub.off value) of the second protein binding agent is lower or equal as compared to the k.sub.off value of the first binding agent, and wherein the first protein binding agent is immobilized on a surface and/or provided as a microcolumn or microchip.
19. A kit comprising a first and second protein binding agent, wherein the first protein binding agent specifically binds to a tag on the target protein, wherein the second protein binding agent competes with the first binding agent for binding to the tag, and by specifically binding the tag, thereby displaces the first binding agent from the target protein, and wherein the second protein binding agent comprises an immunoglobulin single variable domain (ISVD) or a functional variant thereof specifically binding the tag, wherein the rate constant of dissociation (k.sub.off value) of the second protein binding agent is lower or equal as compared to the k.sub.off value of the first binding agent, and wherein the binding agents comprise a sequence selected from the group of: a. SEQ ID NO: 1 to 6, 18 or 19, or a sequence with at least 90% amino acid identity thereof, for specific binding to GFP, b. SEQ ID NO: 20 and 21, or a sequence with at least 90% amino acid identity thereof, for specific binding to GST, c. SEQ ID NO: 23 and 24, or a sequence with at least 90% amino acid identity thereof, for specific binding to SMT3, d. SEQ ID NO: 26, 27 and 28, or a sequence with at least 90% amino acid identity thereof, for specific binding to mCherry, or comprising any of those sequences without the C-terminal His-EPEA tag, and wherein the first and second protein binding agent cannot be identical when the binding agent has a K.sub.D which is below 0.1 nM.
20. (canceled)
21. (canceled)
22. (canceled)
23. (canceled)
24. (canceled)
25. (canceled)
26. The method according to claim 5, wherein the tag is selected from the group of GFP, mCherry, GST, SMT3, and EPEA.
27. The method according to claim 7, wherein the scaffold protein domain comprises HopQ, Ygjk, or a derivative thereof.
Description
DESCRIPTION OF THE FIGURES
[0025] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0026] The drawings described are only schematic and are non-limiting. In the drawings, the size of some of the elements may be exaggerated and not drawn on scale for illustrative purposes.
[0027]
[0028] 1) A protein of interest (POI) is retained on beads coated with a specific Nanobody trapper (grey spheres) and 2) eluted using a Nanobody stripper (hatched spheres) that binds to an overlapping epitope on the POI.
[0029]
[0030] NANEX purification of GFP using CA15816 a medium-affinity trapper immobilized on a HiTrap NHS-activated Sepharose HP column (1 mL) and eluted using CA12760 a high-affinity stripper. 2 mg of purified GFP was spiked into a bacterial lysate. The CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH7.5, 150 mM NaCl) followed by the injection of the stripper. Left panel: brief description of the procedure. Middle panel: elution chromatogram showing absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of CA12760 stripper. The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel: SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder from ThermoFisher cat. 26616).
[0031]
[0032] Left: Crystal structure of CA12760 (ribbon representation) in complex with GFP (surface representation). Middle: Surface representation of GFP. Residues composing the epitope of CA12760 on GFP are colored in dark grey and labeled. Right: table summarizing the residues that compose the CA12760 binding epitope on GFP.
[0033]
[0034] GFP is represented in surface mode. CA12760 is represented in ribbon mode. Thr54, Val55, and Phe103 are represented as sticks.
[0035]
[0036] Real-time kinetic analysis of the binding of GFP to Nanobody CA12760 (SEQ ID NO: 1), CA15818 (SEQ ID NO: 2), CA15816 (SEQ ID NO: 3), and CA15861 (SEQ ID NO: 4), respectively. Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several GFP concentrations (1 nM to 5 M range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0037]
[0038] NANEX purification of GFP using CA12760 (high-affinity trapper) as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as strippers. 50 l of CA12760 agarose beads were mixed in an Eppendorf tube with 200 g GFP, washed and incubated with 53 M (800 g/mL) of strippers in a final volume of 1 mL (100 mM Hepes pH 7.5, 150 mM NaCl). GFP elution was monitored by spinning down the beads at 5 different time points (0, 15, 30, 60, 120 minutes) and measuring the absorbance of the supernatant at 488 nm.
[0039]
[0040] NANEX purification of GFP using CA15818 (medium affinity trapper) as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as strippers. 50 l of CA12760 agarose beads were mixed in an Eppendorf tube with 200 g GFP, washed and incubated with 53 M (800 g/mL) of strippers in a final volume of 1 mL (100 mM Hepes pH 7.5, 150 mM NaCl). GFP elution was monitored by spinning down the beads at 5 different time points (0, 15, 30, 60, 120 minutes) and measuring the absorbance of the supernatant at 488 nm.
[0041]
[0042] NANEX purification of GFP using CA15816 (medium affinity trapper) as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as strippers. 50 l of CA12760 agarose beads were mixed in an Eppendorf tube with 200 g GFP, washed and incubated with 53 M (800 g/mL) of strippers in a final volume of 1 mL (100 mM Hepes pH 7.5, 150 mM NaCl). GFP elution was monitored by spinning down the beads at 5 different time points (0, 15, 30, 60, 120 minutes) and measuring the absorbance of the supernatant at 488 nm.
[0043]
[0044] NANEX purification of GFP using CA15861 (low-affinity trapper) as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as strippers. 50 l of CA12760 agarose beads were mixed in an Eppendorf tube with 200 g GFP, washed and incubated with 53 M (800 g/mL) of strippers in a final volume of 1 mL (100 mM Hepes pH 7.5, 150 mM NaCl). GFP elution was monitored by spinning down the beads at 5 different time points (0, 15, 30, 60, 120 minutes) and measuring the absorbance of the supernatant at 488 nm.
[0045]
[0046] For the purification of GFP by NANEX, CA12760 (high-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). For each experiment, 2 mg of purified GFP was injected on this NANEX column. The loaded CA12760-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of strippers CA12760, CA15818, CA15816, CA15861, per column, respectively. The elution of GFP by these different strippers was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the respective stripper (CA12760, CA15818, CA15816, CA15861). The right peak eluted upon regeneration of the columns with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder from ThermoFisher cat. 26616).
[0047]
[0048] For the purification of GFP by NANEX, CA15816 (medium-affinity trapper) was immobilized on a HiTrap NHS-activated Sepharose HP column (1 mL). For each experiment, 2 mg of purified GFP was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the respective stripper (CA12760, CA15818, CA15816, CA15861). The elution of GFP by these different strippers was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the strippers (CA12760, CA15818, CA15816, CA15861). The right peak eluted upon regeneration of the column with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0049]
[0050] For the purification of GFP by Na nobody exchange chromatography, CA15861 (low-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). For each experiment, 2 mg of purified GFP was injected on this NANEX column. The loaded CA15861-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of respective stripper (CA12760, CA15818, CA15816, CA15861). The elution of GFP by these different strippers was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the strippers (CA12760, CA15818, CA15816, CA15861). The right peak eluted upon regeneration of the column with 20 0 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0051]
[0052] For the purification of GFP by NANEX, CA15816 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 2 mg of purified GFP was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA15621 a functionalized Nanobody (Mega Body Mb.sub.CA12760.sup.cHopQ). The elution of GFP by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (CA15621). The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0053]
[0054] For the purification of GFP by NANEX chromatography, CA15816 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 2 mg of purified GFP was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA15616 a functionalized Nanobody (MegaBody Mb.sub.CA12760.sup.YgjK). The elution of GFP by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (CA15616). The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0055]
[0056] For the purification of GFP by NANEX, CA15816 (medium-affinity trapper) was immobilized as a trapper on NHS-Activated agarose beads to prepare a custom-made micro-column. 0.1 mg of purified GFP was injected on this NANEX microcolumn. The loaded CA15816-microcolumn was washed twice with 5 mL of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA12760 (high-affinity). The elution of GFP by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (CA12760). The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0057]
[0058] For the purification of EPEA-tagged GFP (GFP-EPEA) by NANEX, CA4375 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 1 mg of purified EPEA-tagged GFP (GFP-EPEA) protein was injected on this NANEX column. The loaded CA4375-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA4375 (medium-affinity stripper). The elution of EPEA-tagged GFP (GFP-EPEA) by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (CA4375). The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0059]
[0060] For the purification of EPEA-tagged GFP (GFP-EPEA) protein by Nanobody exchange chromatography, CA4375 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 1 mg of purified EPEA-tagged GFP (GFP-EPEA) protein was spiked into a bacterial lysate and injected on this NANEX column. The loaded CA4375-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper a bivalent CA4375 (high-affinity stripper). The elution of EPEA-tagged GFP (GFP-EPEA) protein by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (bivalent CA4375). The right peak eluted upon regeneration with 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0061]
[0062] For the purification of recombinant human Synaptojanin by Nanobody exchange chromatography, CA13016 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 10 mL of bacterial lysate containing overexpressed recombinant human Synaptojanin was injected on this NANEX column. The loaded CA13016-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA13080 (high-affinity stripper). The elution of recombinant human Synaptojanin by this stripper was monitored by following the absorbance at 280 nm. The high peak on the left eluted upon injection of the stripper (CA13080). The right peak eluted upon addition of 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0063]
[0064] For the purification of recombinant human coagulation factor IXa by NANEX, CA11138 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 0.4 mg of purified recombinant human coagulation factor IXa fluorescently labelled with Dylight-647 was injected on this NANEX column. The loaded CA11138-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA10304 (high-affinity stripper). The elution of recombinant human coagulation factor IXa by this stripper was monitored by following the absorbance at 280 nm and 650 nm. The high peak on the left eluted upon injection of the stripper (CA10304). The right peak eluted upon addition of 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0065]
[0066] For the purification of recombinant human coagulation factor IXaCA10304 complex by NANEX, CA10502 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). Purified recombinant human coagulation factor IXaCA10304 from Example 14 was injected on this NANEX column. The loaded CA10502-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the stripper CA10309 (high-affinity stripper). The elution of recombinant human coagulation factor IXa by this stripper was monitored by following the absorbance at 280 nm and 650 nm. The high peak on the left eluted upon injection of the stripper (CA10309). The right peak eluted upon addition of 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder).
[0067]
[0068] In this example, two chromatographic columns containing different affinity matrices are connected. Tandem-NANEX can also be performed by mixing the different affinity matrices in a single column. This scheme shows the Tandem Nanobody exchange chromatography (tandem-NANEX) principle which uses two Nanobody pairs that pairwise compete for two different epitopes.
[0069] 1) As a first purification step the protein of interest (POI) is retained on beads coated with a specific Nanobody trapper1 (beads1 coupled to grey spheres). 2) After washing the target is eluted from eluted using a Nanobody stripper1 (tilted hatched spheres) that binds to an overlapping epitope of trapper 1 on the POI. As a result, the POIStripper1 complex is retained on beads that are coated with trapper2 that binds another epitope (black spheres) 3) the POIStripper1 complex can be eluted using a stripper that overlaps with tarpper2 (stripper 2, vertical hatched spheres) to recover POIStripper1Stripper2 as a highly purified ternary complex.
[0070]
[0071] For the purification of recombinant human coagulation factor IXa by Tandem-NANEX, a first NANEX column where CA11138 (medium-affinity trapper) was immobilized as a trapper1 on a HiTrap NHS-activated Sepharose HP column (1 mL) was connected to a second NANEX column consisting of CA10502 (medium-affinity trapper) immobilized as a trapper2 on a HiTrap NHS-activated Sepharose HP column (1 mL). 0.4 mg of purified recombinant human coagulation factor IXa fluorescently labelled with Dylight-647 was injected on both NANEX columns that were washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) then connected to on an Akta-Pure (GE) FLPC system. Injection of the stripper1 CA10304 (high-affinity stripper) was followed by a washing step of 5 mL of the same buffer before the injection of the stripper2 CA14208 (high-affinity stripper). The elution of recombinant human coagulation factor IXa by both strippers was monitored by following the absorbance at 280 nm and 650 nm. The peak on the left eluted upon injection of the stripper1 (CA10304). The right peak eluted upon injection of the stripper2 (CA14208). Right panel SDS-PAGE of the different purification steps, molecular weight marker (PageRuler Prestained Protein Ladder from ThermoFisher cat. 26616).
[0072]
[0073] For the purification of GFP-RPP1A protein by NANEX, CA15816 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 20 mL of clarified Yeast lysate was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of the high affinity stripper (CA12760). Elution of GFP-RPP1A protein by this stripper was monitored by following the absorbance at 280 nm and 488 nm. The high peak on the left eluted upon injection of the stripper (CA12760). The right peak eluted upon addition of 200 mM glycine at pH 2.3. Right panel SDS-PAGE of the different fractions of the main elution peak, molecular weight marker (PageRuler Prestained Protein Ladder).
[0074]
[0075] For staining, 3 l of the major eluting peak (fraction 6, 0.1 mg/mL protein concentration) from NANEX on a lysate of yeast clone GFP+35: G8 was applied for 30 seconds onto a glow-discharged grid and washed in uranyl acetate (2% w/v) for 30 s prior to drying. Images were taken on a Jeol1400 microscope with a 50 magnification.
[0076]
[0077]
[0078]
[0079] GFP is represented in surface mode. CA16047 is represented in ribbon mode. Tyr119 is represented as sticks.
[0080]
[0081] Real-time kinetic analysis of the binding and the dissociation of GFP to Nanobody CA16047 (SEQ ID NO: 18) and CA16695 (SEQ ID NO: 19). Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several GFP concentrations (8 nM to 500 nM range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0082]
[0083] For the purification of GFP by NANEX, CA16695 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 2 mg of purified GFP was injected on this NANEX column. The loaded CA16695-column was washed twice with 10 CVs of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of 1 mg of the stripper CA16047.
[0084]
[0085]
[0086]
[0087] GST is represented in surface mode. CA16239 is represented in ribbon mode. Tyr109 is represented as sticks.
[0088]
[0089] Real-time kinetic analysis of the binding and the dissociation of GST to Nanobody CA16239 (SEQ ID NO: 20) and CA16240 (SEQ ID NO: 21). Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several GST concentrations (63 nM to 1667 nM range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0090]
[0091] For the purification of GST by NANEX, 4 mg of CA16240 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 2 mg of purified GST was injected on this NANEX column. The loaded CA16240-column was washed twice with 10 CVs of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of 2 mg of the stripper CA16239.
[0092]
[0093]
[0094]
[0095] SMT3 is represented in surface mode. CA15839 is represented in ribbon mode. Asp50 is represented as sticks.
[0096]
[0097] Real-time kinetic analysis of the binding and the dissociation of SMT3 to Nanobody CA15839 (SEQ ID NO: 23) and CA16687 (SEQ ID NO: 24). Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several SMT3 concentrations (10 nM to 500 nM range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0098]
[0099] For the purification of SMT3 by NANEX, 1 mg of purified CA16687 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 2 mg of purified SMT3 was injected on this NANEX column. The loaded CA16687-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of 2 mg of the stripper CA15839.
[0100]
[0101]
[0102]
[0103] Real-time kinetic analysis of the binding of mCherry to Nanobody CA17302 (SEQ ID NO: 27) and CA16964 (SEQ ID NO: 26). Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several mCherry concentrations (8.23 nM to 222 nM range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0104]
[0105] For the purification of mCherry by NANEX, 1 mg of CA16964 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). Recombinant FmIH-lectin-mCherry-his was expressed in BL21 expression strain by over-night induction at 28 C. using 1 mM IPGT. A 2 L bacterial pellet was lysed in 50 mL of resuspension buffer (25 mM HEPES pH 7.5, 150 mM NaCl) and clarified by centrifugation and filtering. This bacterial lysate was then manually injected on the NANEX column. The loaded CA16964-column was manually washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) prior collecting the column to an Akta Pure, then followed by the injection of 1 mg of the stripper CA17302.
[0106]
[0107] Real-time kinetic analysis of the binding of mCherry to Nanobody CA17302 (SEQ ID NO: 27) and CA17341 (SEQ ID NO: 28). Streptavidin-coated Octet biosensors were used to capture biotinylated Nanobodies (1 g/mL). Binding and dissociation isotherms at several mCherry concentrations (8.23 nM to 222 nM range) were analyzed on an OctetRed (molecular devices). All assays were performed in Hepes 25 mM pH7.5, NaCl 150 mM supplemented with BSA 0.1% and Tween.sup.20 0.005% at room temperature.
[0108]
[0109] For the purification of mCherry by NANEX, 1 mg of CA17341 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). Recombinant FmIH-lectin-mCherry-his was expressed in BL21 expression strain by over-night induction at 28 C. using 1 mM IPGT. A 2 L bacterial pellet was lysed in 50 mL of resuspension buffer (25 mM HEPES pH 7.5, 150 mM NaCl) and clarified by centrifugation and filtering. This bacterial lysate was then manually injected on the NANEX column. The loaded CA17341-column was manually washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) prior collecting the column to an Akta Pure, then followed by the injection of 1 mg of the stripper CA17302.
[0110]
[0111] For the purification of native human coagulation factor IX by NANEX, CA11143 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 30 mL of human recovered plasma treated with ACD anticoagulant was loaded on this NANEX column by recirculation for 120 minutes. The loaded CA11143-column was washed with 15 CV of buffer (20 mM Hepes, pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2) followed by the injection of MegaBody CA16383.
[0112]
[0113] For the purification of native human coagulation factor IX by NANEX, MegaBody CA16388 was immobilized as a medium-affinity trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 30 mL of human recovered plasma treated with ACD anticoagulant was loaded on this NANEX column by recirculation for 60 minutes. The loaded CA16388-column was washed with 15 CV of buffer (20 mM Hepes, pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2) followed by the injection of the stripper Mega Body CA16383.
[0114]
[0115]
[0116] For the purification of GFP-GR by NANEX, CA15816 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 10 mL of lysate was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of 1 mg of the stripper CA12670.
[0117]
[0118] For the purification of GFP-ARb by NANEX, CA15816 (medium-affinity trapper) was immobilized as a trapper on a HiTrap NHS-activated Sepharose HP column (1 mL). 10 mL of lysate was injected on this NANEX column. The loaded CA15816-column was washed twice with 10 CV of buffer (100 mM Hepes pH 7.5, 150 mM NaCl) followed by the injection of 1 mg of the stripper CA12670.
[0119] Western blot using commercial anti-GFP antibody (GFP Monoclonal Antibody (C163), ThermoFisher) as primary antibody confirmed that the band at 128 KDa is GFP-ARb.
[0120]
[0121] This list provides detailed information, including the name and abbreviation, the reference number in the yeast GFP-clone collection (Huh et al., 2003), the molecular weight of the GFP fusion proteins, an estimation of the molecules per cell and the anticipated amount of protein produced in a yeast culture.
[0122]
[0123] 12 GFP-fusion proteins were expressed and purified from different Yeast (S. cerevisae) clones from the yeast GFP-clone collection (Huh et al., 2003). Cell pellets from 1 mL cultures were lysed for 1 hour in, dialyzable Yeast Protein Extraction Reagent (Y-PER Plus) and spun after a freeze-thaw-cycle. The lysates were processed using a KingFisher Flex (ThermoFisher) instrument suitable for handling magnetic beads in 96 well format. Tosyl-activated magnetic Dynabeads were coupled with the trapper Nb CA15816 at a concentration of 40 g trapper/mg of beads according to the manufacturer's instructions. 5 L of a 100 mg/mL solution of beads (corresponding to 20 g of coupled trapper CA15816) was used per clone. The purification steps involved 30 seconds pre-equilibration of the beads, 30 minutes incubation with the lysate, 3 washes of 1 minute and 15 minutes elution with 40 L stripper Nb CA12760 at 0.5 mg/mL concentration (33.35 uM). Samples of the CA15816-beads were harvested before the elution step to track the trapping efficiency. Panel A to C represent the SDS-PAGE analysis: (
[0124]
[0125] All measures are in millimeters (mm).
[0126]
[0127] Panels A to F: Fluorescence images from the column contained in the -fluidics chip for the purification of GFP by NANEX, monitored using an inverted fluorescence microscope (Olympus IX71 model IX71S1F-3). Bottom panel 1. 2. 3. 4. 5. 6.: a. b. c. d. e. f. fractions that eluted from the microfluidics device were visually inspected using a blue light transilluminator (ThermoFisher).
DETAILED DESCRIPTION
[0128] The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. Of course, it is to be understood that not necessarily all aspects or advantages may be achieved in accordance with any particular embodiment of the invention. Thus, for example those skilled in the art will recognize that the invention may be embodied or carried out in a manner that achieves or optimizes one advantage or group of advantages as taught herein without necessarily achieving other aspects or advantages as may be taught or suggested herein. The invention, both as to organization and method of operation, together with features and advantages thereof, may best be understood by reference to the following detailed description when read in conjunction with the accompanying drawings. The aspects and advantages of the invention will be apparent from and elucidated with reference to the embodiment(s) described hereinafter. Reference throughout this specification to one embodiment or an embodiment means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases in one embodiment or in an embodiment in various places throughout this specification are not necessarily all referring to the same embodiment but may.
Definitions
[0129] Where an indefinite or definite article is used when referring to a singular noun e.g. a or an, the, this includes a plural of that noun unless something else is specifically stated. Where the term comprising is used in the present description and claims, it does not exclude other elements or steps. Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments, of the invention described herein are capable of operation in other sequences than described or illustrated herein. The following terms or definitions are provided solely to aid in the understanding of the invention. Unless specifically defined herein, all terms used herein have the same meaning as they would to one skilled in the art of the present invention. Practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 4.sup.th ed., Cold Spring Harbor Press, Plainsview, New York (2012); and Ausubel et al., Current Protocols in Molecular Biology (Supplement 114), John Wiley & Sons, New York (2016), for definitions and terms of the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art (e.g. in molecular biology, biochemistry, structural biology, and/or computational biology).
[0130] The terms protein, polypeptide, and peptide are interchangeably used further herein to refer to a polymer of amino acid residues and to variants and synthetic analogues of the same. A peptide may also be referred to as a partial amino acid sequence derived from its original protein, for instance after tryptic digestion. Thus, these terms apply to amino acid polymers in which one or more amino acid residues is a synthetic non-naturally occurring amino acid, such as a chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally-occurring amino acid polymers. This term also includes posttranslational modifications of the polypeptide, such as glycosylation, phosphorylation, ubiquitination, sumoylation, and acetylation, among others known in the art. Based on the amino acid sequence and the modifications, the atomic or molecular mass or weight of a polypeptide is expressed in (kilo)dalton (kDa). By isolated or purified is meant material that is substantially or essentially free from components that normally accompany it in its native state. For example, an isolated polypeptide or purified polypeptide refers to a polypeptide which has been purified from the molecules which flank it in a naturally-occurring state, e.g., an antibody or Nanobody as identified and disclosed herein which has been removed from the molecules present in the sample or mixture, such as a production host, that are adjacent to said polypeptide. An isolated protein or peptide can be generated by amino acid chemical synthesis or can be generated by recombinant production or by purification from a complex sample.
[0131] Homologue, Homologues of a protein encompass peptides, oligopeptides, polypeptides, proteins and enzymes having amino acid substitutions, deletions and/or insertions relative to the unmodified protein in question and having similar biological and functional activity as the unmodified protein from which they are derived. The term amino acid identity as used herein refers to the extent that sequences are identical on an amino acid-by-amino acid basis over a window of comparison. Thus, a percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met, also indicated in one-letter code herein) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. A substitution, or mutation, or variant as used herein, results from the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively as compared to an amino acid sequence or nucleotide sequence of a parental protein or a fragment thereof. It is understood that a protein or a fragment thereof may have conservative amino acid substitutions which have substantially no effect on the protein's activity.
[0132] Binding means any interaction, be it direct or indirect. A direct interaction implies a contact between the binding partners. An indirect interaction means any interaction whereby the interaction partners interact in a complex of more than two molecules. The interaction can be completely indirect, with the help of one or more bridging molecules, or partly indirect, where there is still a direct contact between the partners, which is stabilized by the additional interaction of one or more molecules. By the term specifically binds, as used herein is meant a binding domain which recognizes a specific target protein or specific target component or molecule, but does not substantially recognize or bind other molecules in a sample. Specific binding does not mean exclusive binding. However, specific binding does mean that proteins have a certain increased affinity or preference for one or a few of their binders. The term affinity, as used herein, generally refers to the degree to which a ligand, chemical, protein or peptide binds to another (target) protein or peptide so as to shift the equilibrium of single protein monomers toward the presence of a complex formed by their binding. Affinity is the strength of binding of a single molecule to its ligand. It is typically measured and reported by the equilibrium dissociation constant (K.sub.D), which is used to evaluate and rank order strengths of bimolecular interactions. The binding of an antibody to its antigen is a reversible process, and the rate of the binding reaction is proportional to the concentrations of the reactants. At equilibrium, the rate of [antibody] [antigen] complex formation is equal to the rate of dissociation into its components [antibody]+[antigen]. The measurement of the reaction rate constants can be used to define an equilibrium or affinity constant (1/K.sub.D). In short, the smaller the K.sub.D value the greater the affinity of the antibody for its target. The rate constants of both directions of the reaction are termed: the association reaction rate constant (K.sub.on), which is the part of the reaction used to calculate the on-rate (K.sub.on), a constant used to characterize how quickly the antibody binds to its target. Vice versa, the dissociation reaction rate constant (K.sub.off), is the part of the reaction used to calculate the off-rate (K.sub.off), a constant used to characterize how quickly an antibody dissociates from its target. In measurements as shown herein, the flatter the slope, the slower off-rate, or the stronger antibody binding. Vice versa, the steeper downside indicates a faster off-rate and weaker antibody binding. The ratio of the experimentally measured off- and on- rates (K.sub.off/K.sub.on) is used to calculate the K.sub.D value. Several determination methods are known to the skilled person to measure on and off rates and to thereof calculate the K.sub.D (see below and examples), which is therefore, taking into account standard errors, considered as a value that is independent of the assay used.
[0133] As used herein, the term protein complex or complex or assembled protein(s) refers to a group of two or more associated macromolecules, whereby at least one of the macromolecules is a protein. A protein complex, as used herein, typically refers to associations of macromolecules that can be formed under physiological conditions. Individual members of a protein complex are linked by non-covalent interactions. A protein complex can be a non-covalent interaction of only proteins, and is then referred to as a protein-protein complex; for instance, a non-covalent interaction of two proteins, of three proteins, of four proteins, etc. More specifically, a complex of the protein binding agent and the target protein, optionally with other proteins or compounds bound to it.
[0134] A binding agent relates to a molecule that is capable of binding to another molecule, wherein said binding is preferably a specific binding, recognizing a defined binding site, pocket or epitope. The binding agent may be of any nature or type and is not dependent on its origin. The binding agent may be chemically synthesized, naturally occurring, recombinantly produced (and purified), as well as designed and synthetically produced. Said binding agent may hence be a small molecule, a chemical, a peptide, a polypeptide, an antibody, or any derivatives thereof, such as a peptidomimetic, an antibody mimetic, an active fragment, a chemical derivative, among others. Preferably, the binding agent is a protein binding agent in the method described herein. The term binding pocket or binding site refers to a region of a molecule or molecular complex, that, as a result of its shape and charge, favourably associates with another chemical entity, compound, proteins, peptide, antibody, ISVD, or Nb. The term pocket includes, but is not limited to cleft, channel or site. The term part of a binding pocket/site/epitope, or overlapping epitope as interchangeably used herein, refers to less than all of the amino acid residues that define the binding pocket, or binding site, or epitope. For example, the portion of residues may be key residues that play a role in ligand binding, or may be residues that are spatially related and define a three-dimensional compartment of the binding pocket. The residues may be contiguous or non-contiguous in primary sequence. For antibody-related molecules, the term epitope is also used to describe the binding site, as used interchangeably herein. A adjacent or minimally overlapping binding site, as used herein, refers to no overlapping amino acids (but binding to a site close by), or maximum of about 30% overlap in the binding amino acid residues respectively. An epitope, refers to an antigenic determinant of a polypeptide, constituting a binding site or binding pocket on a target protein molecule, which is an accessible epitope or binding site on the extracellular side. An epitope could comprise 3 amino acids in a spatial conformation, which is unique to the epitope. Generally, an epitope consists of at least 4, 5, 6, 7 such amino acids, and more usually, consists of at least 8, 9, 10 such amino acids. Methods of determining the spatial conformation of amino acids are known in the art, and include, for example, X-ray crystallography, multi-dimensional nuclear magnetic resonance, Cryo-EM Hydrogen
[0135] Deuterium-Exchange (HDX)-MS, as well as Cross-linking Mass-spectrometry (XL-MS), epitope binning, or used to a lower extent also Neutron scattering, X-ray Free electron-laser (XFEL) or Small-angle neutron scattering (SANS) and small-angle x-ray scattering (SAXS) technology. A conformational epitope, as used herein, refers to an epitope comprising amino acids in a spatial conformation that is unique to a folded 3-dimensional conformation of a polypeptide. Generally, a conformational epitope consists of amino acids that are discontinuous in the linear sequence but that come together in the folded structure of the protein. However, a conformational epitope may also consist of a linear sequence of amino acids that adopts a conformation that is unique to a folded 3-dimensional conformation of the polypeptide (and not present in a denatured state). In protein complexes, conformational epitopes consist of amino acids that are discontinuous in the linear sequences of one or more polypeptides that come together upon folding of the different folded polypeptides and their association in a unique quaternary structure. Similarly, conformational epitopes may here also consist of a linear sequence of amino acids of one or more polypeptides that come together and adopt a conformation that is unique to the quaternary structure. The term conformation or conformational state of a protein refers generally to the range of structures that a protein may adopt at any instant in time. One of skill in the art will recognize that determinants of conformation or conformational state include a protein's primary structure as reflected in a protein's amino acid sequence (including modified amino acids) and the environment surrounding the protein. The conformation or conformational state of a protein also relates to structural features such as protein secondary structures (e.g., -helix, -sheet, among others), tertiary structure (e.g., the three dimensional folding of a polypeptide chain), and quaternary structure (e.g., interactions of a polypeptide chain with other protein subunits). Posttranslational and other modifications to a polypeptide chain such as ligand binding, phosphorylation, sulfation, glycosylation, ubiquitylation or alike, or attachments of hydrophobic groups, among others, can influence the conformation of a protein. Furthermore, environmental factors or conditions, such as temperature, pH value, salt concentration, ionic strength, and osmolality of the surrounding solution, and interaction with other proteins and co-factors, among others, can affect protein conformation and binding properties. The conformational state of a protein may be determined by either functional assay for activity or binding to another molecule or by means of physical methods such as X-ray crystallography, NMR, or spin labeling, among other methods. For a general discussion of protein conformation and conformational states, one is referred to Cantor and Schimmel, Biophysical Chemistry, Part I: The Conformation of Biological. Macromolecules, W.H. Freeman and Company, 1980, and Creighton, Proteins: Structures and Molecular Properties, W.H. Freeman and Company, 1993.
[0136] The term antibody, antibody fragment and active antibody fragment as used herein refer to a protein comprising an immunoglobulin (Ig) domain or an antigen binding domain capable of specifically binding the antigen, or target protein epitope. Antibodies can further be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. The term active antibody fragment refers to a portion of any antibody or antibody-like structure that by itself has high affinity for an antigenic determinant, or epitope, and contains one or more CDRs accounting for such specificity. Non-limiting examples include immunoglobulin domains, Fab, F(ab)2, scFv, heavy-light chain dimers, immunoglobulin single variable domains (ISVDs), Nanobodies, domain antibodies, and single chain structures, such as a complete light chain or complete heavy chain. An additional requirement for activity of said fragments in the light of the present invention is that said fragments are capable of specifically binding the target epitope. The term immunoglobulin (Ig) domain, or more specifically immunoglobulin variable domain (abbreviated as IVD) means an immunoglobulin domain essentially consisting of four framework regions which are referred to in the art and herein below as framework region 1 or FR1; as framework region 2 or FR2; as framework region 3 or FR3; and as framework region 4 or FR4, respectively; which framework regions are interrupted by three complementarity determining regions or CDRs, which are referred to in the art and herein below as complementarity determining region 1 or CDR1; as complementarity determining region 2 or CDR2; and as complementarity determining region 3 or CDR3, respectively. Thus, the general structure or sequence of an immunoglobulin variable domain can be indicated as follows: FR1- CDR1-FR2-CDR2-FR3-CDR3-FR4. It is the immunoglobulin variable domain(s) (IVDs) that confer specificity to an antibody for the antigen by carrying the antigen-binding site. Typically, in conventional immunoglobulins, such as monoclonal antibodies, a heavy chain variable domain (VH) and a light chain variable domain (VL) interact to form an antigen binding site. In this case, the complementarity determining regions (CDRs) of both VH and VL will contribute to the antigen binding site, i.e. a total of 6 CDRs will be involved in antigen binding site formation. In view of the above definition, the antigen-binding domain of a conventional 4-chain antibody (such as an IgG, IgM, IgA, IgD or IgE molecule; known in the art) or of a Fab fragment, a F(ab)2 fragment, an Fv fragment such as a disulphide linked Fv or a scFv fragment, or a diabody (all known in the art) derived from such conventional 4-chain antibody, with binding to the respective epitope of an antigen by a pair of (associated) immunoglobulin domains such as light and heavy chain variable domains, i.e., by a VH-VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective antigen. An immunoglobulin single variable domain (ISVD) as used herein, refers to a protein with an amino acid sequence comprising 4 Framework regions (FR) and 3 complementary determining regions (CDR) according to the format of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, said amino acid sequence -containing protein domain being sufficient for antigen or epitope binding, thus only requiring 3 CDR loop regions for interaction with its target epitope. The active fragment of ISVDs as described herein is defined as the portion of an ISVD that is sufficient to specifically bind the epitope in an identical or similar manner as the ISVD where this fragment is derived from binds to. An immunoglobulin domain of this invention also refers to immunoglobulin single variable domains (abbreviated as ISVD), equivalent to the term single variable domains and single domain antibody, and defines molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets immunoglobulin single variable domains apart from conventional immunoglobulins or their fragments, wherein two immunoglobulin domains, in particular two variable domains, interact to form an antigen binding site. The binding site of an immunoglobulin single variable domain is formed by a single VH/VHH or VL domain. Hence, the antigen binding site of an immunoglobulin single variable domain is formed by no more than three CDR's. As such, the single variable domain may be a light chain variable domain sequence (e.g., a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g., a VH-sequence or VHH sequence) or a suitable fragment thereof; as long as it is capable of forming a single antigen binding unit (i.e., a functional antigen binding unit that essentially consists of the single variable domain, such that the single antigen binding domain does not need to interact with another variable domain to form a functional antigen binding unit).
[0137] In particular, the immunoglobulin single variable domain may be a Nanobody (as defined herein) or a suitable fragment thereof. Note: Nanobody, Nanobodies and Nanoclone are registered trademarks of Ablynx N.V. (a Sanofi Company). For a general description of Nanobodies, reference is made to the further description below, as well as to the prior art cited herein, such as e.g. described in WO2008/020079. VHH domains, also known as VHHs, VHH domains, VHH antibody fragments, and VHH antibodies, have originally been described as the antigen binding immunoglobulin (Ig) (variable) domain of heavy chain antibodies (i.e., of antibodies devoid of light chains; Hamers-Casterman et al (1993) Nature 363: 446-448). The term VHH domain has been chosen to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as VH domains) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as VL domains). For a further description of VHHs and Nanobody, reference is made to the review article by Muyldermans (Reviews in Molecular Biotechnology 74: 277-302, 2001), as well as to the following patent applications, which are mentioned as general background art: WO 94/04678, WO 95/04079 and WO 96/34103 of the Vrije Universiteit Brussel; WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1134231 and WO 02/48193 of Unilever; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527 of the Vlaams Instituut voor Biotechnologie (VIB); WO 03/050531 of Algonomics N.V. and Ablynx N.V.; WO 01/90190 by the National Research Council of Canada; WO 03/025020 (=EP 1433793) by the Institute of Antibodies; as well as WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551, WO 05/044858, WO 06/40153, WO 06/079372, WO 06/122786, WO 06/122787 and WO 06/122825, by Ablynx N.V. and the further published patent applications by Ablynx N.V. As described in these references, Nanobody (in particular VHH sequences and partially humanized Nanobody) can in particular be characterized by the presence of one or more Hallmark residues in one or more of the framework sequences. A further description of the Nanobody, including humanization and/or camelization of Nanobody, as well as other modifications, parts or fragments, derivatives or Nanobody fusions, multivalent or multispecific constructs (including some non-limiting examples of linker sequences) and different modifications to increase the half-life of the Nanobody and their preparations can be found e.g. in WO 08/101985 and WO 08/142164. Nanobodies form the smallest antigen binding fragment that completely retains the binding affinity and specificity of a full-length antibody. Nbs possess exceptionally long complementarity-determining region 3 (CDR3) loops and a convex paratope, which allow them to penetrate into hidden cavities of target antigens. Immunoglobulin single variable domains such as Domain antibodies and Nanobody (including VHH domains) can be subjected to humanization, i.e. increase the degree of sequence identity with the closest human germline sequence. In particular, humanized immunoglobulin single variable domains, such as Nanobody (including VHH domains) may be immunoglobulin single variable domains in which at least one amino acid residue is present (and in particular, at least one framework residue) that is and/or that corresponds to a humanizing substitution (as defined further herein). Moreover, further suitable mutations, in particular substitutions, can be introduced to generate a polypeptide with reduced binding to pre-existing antibodies present in human or animal cells (reference is made for example to WO 2012/175741 and WO2015/173325), for example at at least one of the positions: 11, 13, 14, 15, 40, 41, 42, 82, 82a, 82b, 83, 84, 85, 87, 88, 89, 103, or 108. The amino acid sequences and/or VHH of the invention may be suitably humanized at any framework residue(s), such as at one or more Hallmark residues (as defined herein) or at one or more other framework residues (i.e. non-Hallmark residues) or any suitable combination thereof. Depending on the host organism used to express the amino acid sequence, VHH or polypeptide of the invention, such deletions and/or substitutions may also be designed in such a way that one or more sites for posttranslational modification (such as one or more glycosylation sites) are removed, as will be within the ability of the person skilled in the art. Alternatively, substitutions or insertions may be designed so as to introduce one or more sites for attachment of functional groups (as described herein), for example to allow site-specific pegylation, or for attachment of labels, such as biotinylation or fluorophores.
[0138] As used herein, the terms determining, measuring, assessing,, identifying, screening, and assaying are used interchangeably and include both quantitative and qualitative determinations.
Detailed Description
[0139] The present invention relates to the purification of proteins by affinity chromatography. In particular, a pair of target-specific protein binding agents specifically binding an epitope on a target in a competitive manner, is used in a complementary kinetic context. Such a pair of binders which is competing in its target binding though with binding sites at non-overlapping or different epitopes, has been seen in affinity displacement to act via transient sandwich complexes and within defined dose- and kinetic relations. However, in cases where a pair of a first protein binding agent (trapper) with the same or overlapping epitope as the second binding agent is used, it will depend on the binding nature whether a cross-block or displacement can occur. Using ISVDs, or more specifically Nbs, as displacers, we found that even if a pair targeting the same epitope on a target protein was combined, under certain kinetic requirements, displacement is efficiently established, more specifically when the dissociation rate constant is higher for the first than the second protein binding agent, and wherein said second, known as the displacer or stripper, comprises an ISVD or Nanobody-specific binding nature. So for ISVD-binding agents used as displacer, the k.sub.off seems to drive the displacement efficiency. This purification technology has been shown to function most optimally when the immobilized (trapper) protein binding agent is used with a higher off-rate (or k.sub.off value) and/or a lower affinity as compared to the second ISVD-comprising protein binding agent for competitive elution of the target, the latter thus with a lower off rate and/or higher affinity for the target protein. Indeed, it is known from the art that antibodies or antibody domains, including ISVDs and Nanobodies compete for binding their targets when they interact with a similar or overlapping epitope. Purely based on the competitive nature, one could use the same binding agent, such as a Nanobody for binding (or trapping) and eluting (or stripping) to purify the target, hoping that competition allows to obtain a satisfying yield of purified protein in the elution fraction. Thus, binding agents with a dissociation rate allowing such equal competition (i.e. k.sub.off not too low, or affinity not too high, see below) will result in a certain amount of protein to be eluted using the same binding agent or Nb as trapper and stripper. However, in this case, the purification will not provide for the most optimal result, since the equally competing trapper will retain part of the protein bound to the immobilized surface, and elution yields will be suboptimal. The skilled artisan searching for a binding agent that is capable of fully outcompeting the trapper binding to the target, which is desired in high-throughput application, would find that conventional antibody binders to the same epitope mostly block any displacement reaction (e.g. as demonstrated for monoclonals in Abdiche et al. 2017), and one would rather use protein binding agents such as antibodies binding to an adjacent or minimally overlapping epitope as compared to the trapper, as to avoid such a block of the epitope by competition. Using as a second protein binding agent an ISVD, binding the same, substantially the same, or large overlapping epitope as the first protein binding agent, and wherein said second ISVD-comprising protein binding agent has a lower dissociation rate constant (k.sub.off), showed that the ISVD was capable to efficiently displace the first protein binding agent, thereby outcompeting for binding to the same epitope of the target protein, and allowing elution of the target protein at high yields. The present invention hence relates to ISVD-based displacement, or more particularly Nanobody exchange or Nanobody exchange chromatography or NANEX, as interchangeably used herein, resulting in highly pure eluted protein complexes of said second ISVD-comprising protein binding agent with the target (as shown in the Examples). Even when a binding pair is used for displacement on a target whereby the epitopes are not or minimally overlapping, a displacement reaction, the ISVD binding nature seems to function according to displacement kinetics driven by a difference in k.sub.off between capture and elution agent.
[0140] When using NANEX purification, the elution complex thus contains the stripper or displacer, which has the advantage that this allows to apply ISVD-comprising second protein binding agents (called strippers, or Nanostripper in the case of Nanobodies) that are additionally functionalized, i.e. they provide for a specific function to the eluted protein complex. Such a functionalization may relate to visualization of the protein complex (via fluorescence or labelling of the agent) or relates to functioning as a chaperone or adapter protein (including for instance but not limited to a MegaBody), among other examples, to elute the target in a functionalized complex. Moreover, following the elution step and a regeneration procedure, the affinity matrix, which may be any type of surface, such as beads, a column, or a resin, is ready for the next affinity purification cycle and can be used in high-throughput platforms, such as a screening platform, a chip, or a microfluidics setup or device.
[0141] By using this next-generation affinity purification technology, called NANEX or Nanobody exchange chromatography, a leap forward can be foreseen in analytical purification, as well as in high-throughput platform or screening applications such as screening assays, and structure-based drug design and discovery, as well as structure-based screening of novel compounds. In fact, protein binding agents with conformation-selective recognition of antigens or targets, to stabilize the target in a functional conformation, such as an active conformation, more specifically an agonist, partial agonist or biased agonist conformation can be selected for. With the rapid advancement of such technologies in biotechnology, it is foreseeable that the invention will impact the efficiency and potential of novel therapeutic drug screening as well as increase throughput and the potential of proteomics, MS-based, and other analytics.
[0142] A first aspect relates to a purification process for a target protein present in a sample, the process comprising the steps of: [0143] a) Mixing a first protein binding agent that specifically binds an epitope on the target protein, with a sample containing said target protein, [0144] b) Adding a second protein binding agent which competes for the target protein binding with the binding of the first binding agent, and [0145] c) Elution of the protein complex comprising the target protein and the second protein binding agent,
upon exchange or displacement of the target protein from the first to the second protein binding agent, said eluted protein complex comprising said target protein and said second protein binding agent, and wherein said second protein binding agent comprises and ISVD or a functional variant thereof, which is specifically bound to its epitope of the target protein, and wherein the dissociation rate (or rate constant of dissociation or k.sub.off, as used interchangeably herein) is slower or equal (or the k.sub.off value lower or equal) for the second protein binding agent as compared to the k.sub.off of the first protein binding agent. In further applications, said method may also comprise a washing step prior to addition of the second protein binding agent.
[0146] The term functional variant of an ISVD is defined herein as any polypeptide that contains the binding region or paratope for binding the target protein that is identical to the binding region or paratope of the ISVD, so that the variant may differ in its sequence or composition, but retains its functionality in binding to the target protein with the same binding region as the ISVD. In particular, this paratope or binding region of an ISVD most often comprises at least the CDR3 region, preferably 3CDRs, and occasionally also part of the FR regions.
[0147] The feature as to compete for the target binding may be interpreted as competing for the same epitope, or may also mean competing in a different manner, such a kinetically or allosterically. So in one embodiment, the stripper may compete for binding by targeting minimally overlapping or adjacent epitopes, or alternatively, the stripper can even disrupt the interaction between the trapper and the target by binding to an allosteric site on the target, by inducing a conformation change of the target. Competing binding agents may be established using several methods as known in the art, for example, but not limited to, a competition ELISA, alphalisa, Octet measurements or bio-layer interferometry (BLI), SPR Biacore, Microscale thermophoresis (MST), amongst others.
[0148] More specifically, to obtain an efficient displacement in the purification method, a difference in requirements may be considered for binding pairs which compete for the target through binding to the same or largely overlapping epitope, versus binding pairs which compete for the target through binding to minimally or non-overlapping epitopes, for instance by binding to adjacent epitopes, or by binding to an allosteric site which induces conformational changes forcing the displacement. The displacement reaction using the first type of pairs, wherein the ISVD-containing stripper binds a similar epitope is driven by the difference in k.sub.off, and hence requires a displacer with a lower k.sub.off value as compared to the capturing agent, which often also results in a stripper with a higher affinity as the trapper. So herein, the displacement is not driven by the association rate constant.
[0149] The displacement reaction using the second type of pairs, wherein the ISVD-containing stripper binds a different or minimally overlapping epitope is also driven by a difference in k.sub.off, or affinity, but allows for a more gentle difference, and shown for instance by just a 2-fold difference to allow displacement. In a specific embodiment, said binding agents are not monoclonal or conventional antibodies, as this will require different displacement kinetics.
[0150] In said purification method, binders with the same epitope are defined herein as that the amino acid residues of the target protein interacting with said binding agents are identical, wherein interacting or in contact with the binding agent is described as closer than 3 from said residue (or atom) upon binding of the binding agent with said target protein at said epitope. The term substantially the same or largely overlapping epitope as described herein refers to the number of identical amino acid residues of both epitopes being at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of the total or highest number of amino acid residues of the epitopes. Most preferably, substantially the same epitopes referring to the number of identical amino acid residues of both epitopes being at least 85-99% over the highest number of amino acid residues of the epitopes. Most preferably, largely overlapping epitopes referring to the number of identical amino acid residues of both epitopes being at least 50-84% over the highest number of amino acid residues of the epitopes. Further, said purification method delivers the most optimal result when the first binding agent or trapper has a higher dissociation rate or lower or equal affinity as compared to the second binding agent, and vice versa, when the second binding agent has a lower dissociation rate and/or the same or higher affinity for the epitope as compared to the first binding agent. From current state of the art knowledge, the rate constant of dissociation (or off-rate or k.sub.off) and the rate constant of association (or on-rate or k.sub.on) are interrelated as K.sub.D=k.sub.off/k.sub.on, wherein K.sub.D is defined as the dissociation constant, which is inversely correlated with the affinity of a binding agent for its target, as described also in detail in the definitions above. So, if the dissociation constant K.sub.D value is low(er), the affinity is high(er) (if k.sub.on is the same). Alternatively, if k.sub.on is higher, the K.sub.D is lower and the affinity is higher (if k.sub.off is the same).
[0151] So, for the purification method of the present invention, the protein binding agents described herein are relatively different in k.sub.off and/or affinity (or K.sub.D) for the same, substantially the same or largely overlapping epitope. The method as described herein refers more specifically to the k.sub.off of the second binding agent being lower than the k.sub.off of the first binding agent for the same, substantially same, or largely overlapping epitope of the target protein, with lower referring herein to a value that is at least 2-fold lower, 5-fold lower, or 10-fold lower, or at least 30-fold lower, or at least 100-fold lower, or at least 200-fold, at least 300-fold, at least 400-fold, or at least 500-fold lower. More preferably, said k.sub.off value of the second binding agent is in the range of at least 2-fold lower to at least 10-fold lower, or at least 5-fold lower to at least 20-fold lower, or at least 10-fold lower to at least 30-fold lower, or at least 100-fold lower, as compared to the k.sub.off value of the first protein binding agent.
[0152] Similarly, the affinity of the second binding agent may be equal or higher than the affinity of the first binding agent for the epitope of the target protein, wherein higher affinity refers to a K.sub.D value of the second protein binding agent being a K.sub.D value that is at least 2-fold lower, or at least 5-fold lower, 10-fold lower, 20-fold lower or 100-fold lower, or in the range of at least 2- to at least 2000-fold lower, as compared to the K.sub.D value of the first protein binding agent.
[0153] In a preferred embodiment, the purification method as described herein discloses a first binding agent with a K.sub.D value for the epitope of the target protein of 1 mM to about 1 nanomolar and discloses a second protein binding agent with a K.sub.D value, optionally with substantially the same or largely overlapping epitope for said target, of 1 nanomolar or lower, optionally down to 1 picomolar. More preferably, said first binding agent has a K.sub.D in the nano- to millimolar range (i.e. 10E9 to 10E3) and the second binding agent has a K.sub.D value in the femto-to micromolar range (i.e. 10E12 to 10E6), most preferable with a relative difference between the first and second binding agent of at least 2-fold. In one embodiment said K.sub.D value for the first protein binding agent is at least 2-fold higher than the K.sub.D of the displacer, a difference which is driven by the difference in k.sub.off value, especially when the displacer binds to the same or largely overlapping epitope.
[0154] The method of the present invention comprises a second protein binding agent, which is in solution, and soluble in elution conditions. Said elution conditions preferably relate to physiological conditions, as known to the skilled person. The term soluble as used herein refers to the fact that the protein binding agent is in a functional form, meaning that it is capable of specifically binding its target within the expected range of its affinity for the epitope. Said method of purification comprises said first protein binding agent, which may be present as a free, labelled, or covalently bound protein binding agent in a solute for mixing with the sample of interest. Said first binding agent may for instance be coupled to beads, which may be agarose or magnetic beads, or may be present on a surface or matrix, more specifically on packed as an affinity column, which may be suited for preparative as well as analytical purification scales, more particularly, which may be a microcolumn in the order of below 1 mL column volume, or even in submicromolar volumes, or even provided on a chip using microfluidics technology. Said first protein binding agent is preferably immobilized for the method of the present invention, wherein it may be immobilized on a surface via covalent or other means of coupling. Most preferably, said first protein binding agent is immobilized on a solid support or resin. A resin or affinity resin as used interchangeably herein, is an activated affinity chromatography support for the immobilization of biomolecules such as ISVDs or other protein binding agents. In a specific embodiment, said first protein binding agent comprises an ISVD and is coupled to a resin using known coupling methods from the art (see examples).
[0155] The method of purification as described herein comprises the steps of mixing the first protein binding agent, optionally immobilized, with a sample in step a), wherein said sample comprises the target protein specifically binding the first protein binding agent. In specific embodiments said sample may relate to a biological sample, a biopsy sample, a cellular or tissue-containing sample, a cellular lysate, a mixture of cells, or a complex mixture, solvent or lysate comprising non-specified components. Other embodiments relate to synthetic or non-natural compound containing samples, composed samples, or other in vitro samples.
[0156] Depending on the nature of the sample, the optional washing of the column after step a) of the method of the present invention may require neutral, or very mild, or rather harsh conditions, or may require repetitions to remove any unbound abundant components. Depending on the nature of the sample, and the amount of target protein present in the sample, as well as on the first protein binding agent following step a) or b) of the method of the present invention, the elution in step c) using the second protein binding agent may be repeated, or may require larger volumes of elution as to allow complete elution of the target protein. The method as presented herein has the advantage that upon said elution, using physiological conditions, and optionally including a mild regeneration step, the affinity column (i.e. the first protein binding agent immobilized on a resin) is reusable for further purifications from additional samples.
[0157] When the eluate of step c) of the method of the present invention requires a higher purity than what is obtained after the purification step of the method described herein, an additional purification step is preferable, wherein the same steps of the purification method as described herein are repeated using a a third and fourth protein binding agent, which both bind to the same epitope of the target protein, said epitope being non-overlapping, adjacent or different from the epitope bound by the first and second protein binding agent. Said method for tandem purification of a target protein comprising the steps of [0158] a) mixing a first protein binding agent specifically binding an epitope of a target protein with a sample containing said target protein, [0159] b) adding a second protein binding agent, competing for the target protein with the first binding agent, to displace the first binding agent from the target protein by specifically binding the target protein, [0160] c) collecting the elution complex comprising the second protein binding agent bound to the target protein, and [0161] d) repeating steps a) to c), using a 3.sup.rd and 4.sup.th protein binding agent instead of the 1.sup.st and 2.sup.nd protein binding agents, respectively, wherein said 3.sup.rd and 4.sup.th binding agent specifically bind a different epitope of said target protein as compared to the epitope for the 1.sup.st and 2.sup.nd binding agent, and
wherein the second (and/or fourth) protein binding agent comprises an immunoglobulin single variable domain (ISVD) or an active fragment thereof specifically binding the epitope, and wherein the rate constant of dissociation (k.sub.off value) of the second and fourth protein binding agent is lower or equal as compared to the k.sub.off value of the first and third protein binding agent, respectively.
[0162] In fact, such a tandem-NANEX affinity purification method is suitable for generically purify protein complexes comprising more than one target protein as well, as is also aimed for the classical tandem affinity purification (TAP) using a TAP tag. Indeed, the epitope recognized by the 3rd and 4th protein binding agent may also be present on a target protein which is different from the target protein binding the 1st and 2nd binding agent, but which will allow to capture and purify a complex formed between said first and second target protein, even for purifying such a protein-protein interaction from highly complex matrices, where a one-step purification step is not sufficient. The advantage of this tandem affinity purification method over the known TAP methods in the art is that the purification does not require enzymatic cleavage (of a tag), and no remaining protease is present in the eluate. Further advantages of this method include that there is no need for a concentration step or dialysis to certain buffer conditions, and that excess of the 2nd protein binding agent or stripper Nb can be removed in the second step of the tandem approach. Alternatively, a tandem-NANEX may be envisaged wherein the first and third binding agent are both coupled on the same column or resin, and the tandem is exerted as a type of multiplex reaction, using the second and fourth as strippers simultaneously or subsequently, optionally allowing a washing step in-between.
[0163] Finally, the purification method as described herein preferably applies a trapper/stripper pair wherein the protein binding agents both comprise ISVDs, or more specifically VHHs, or even more specifically Nanobodies, since this type of protein binding agents has the advantageous properties to be highly specific, well expressed in E. coli/Pichia, high (thermal) stability, and can be selected for salt/pH tolerance of the binding affinity, and all bind to their targets via a single variable domain as described herein, allowing to apply similar displacement kinetics for this class of ISVD-containing strippers.
[0164] Another embodiment relates to the method of purifying a target protein as disclosed herein, wherein the second (or fourth) protein binding agent comprises a label or detectable label. The term detectable label or labelling, refers to detectable labels or tags allowing the detection, visualization, and/or isolation, further purification and/or immobilization of the isolated or purified (poly-)peptides or complex described herein, and is meant to include any labels/tags known in the art for these purposes. Particularly preferred are fluorescent labels or tags (i.e., fluorochromes/-phores), such as fluorescent proteins (e.g., GFP, YFP, RFP etc.) and fluorescent dyes (e.g., FITC, TRITC, coumarin and cyanine); luminescent labels or tags, such as luciferase; and (other) enzymatic labels (e.g., peroxidase, alkaline phosphatase, beta-galactosidase, urease or glucose oxidase). Also included are affinity tags, such as chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), poly(His) (e.g., 6x His or His6), Strep-tag, Strep-tag II and Twin-Strep-tag; solubilization tags, such as thioredoxin (TRX), poly(NANP) and SUMO; chromatography tags, such as a FLAG-tag; epitope tags, such as V5-tag, myc-tag and HA-tag. Also included are combinations of any of the foregoing labels or tags. The second (or fourth) protein binding agent may, for example, be fused or conjugated to a half-life extension module, or may function as a half-life extension module itself. Such modules are known to a person skilled in the art and include, for example, albumin, an albumin-binding domain, an Fc region/domain of an immunoglobulins, an immunoglobulin-binding domain, an FcRn-binding motif, and a polymer. Particularly preferred polymers include polyethylene glycol (PEG), hydroxyethyl starch (HES), hyaluronic acid, polysialic acid and PEG-mimetic peptide sequences. Modifications preventing aggregation of the isolated (poly-)peptides are also known to the skilled person and include, for example, the substitution of one or more hydrophobic amino acids, preferably surface-exposed hydrophobic amino acids, with one or more hydrophilic amino acids.
[0165] In a further embodiment, protein binding agents specifically binding an epitope on different types of target proteins are described, wherein said epitope may for instance constitute or comprise a tag as present on a fusion protein. Examples of tags are herein included but not limited to affinity tags such as commonly used Polyhistidine (His), gluthatione transferase (GST), maltose binding protein (MBP), calmodulin binding peptide (CBP) , intein-chitin binding domain (intein-CBD), Streptavidin/Biotin-based tags, His-Patch ThioFusion (thioredoxin based), EPEA (CaptureSelect C-tag; US9518084B2), ubiquitin, or Small ubiquitin-like modifier (SUMO), yeast SUMO or SMT3, or HaloTag. Furthermore, tags may constitute epitope tags, such as HA, FLAG, or cMyc, or even reporter tags, such as HRP, or Alkaline phosphatase, though the latter being less preferred for affinity purification. A number of non-limiting examples is provided for example in Kimple et al. (2015 Table 9.9.1).
[0166] Alternatively, the protein binding agents of the method for purification described herein specifically bind an epitope of a native, a naturally occurring, and/or an endogenous protein, not requiring a fusion to a tag. Another alternative is that the epitope is present on a recombinantly produced exogenous protein, not requiring a tag. For such protein binding agent pairs, in order to compete for the same target, one may screen and select to provide for a pair of competing binding agents, or one may design towards a higher affinity and lower affinity pair of protein binding agents. Indeed, using a 3D-structure of the stripper or 2nd protein binding agent bound to the target allows to design mutations in the binding site of the protein binding agent that will result in a reduced affinity or higher k.sub.off, and thereby provide for compatible trapper or 1st protein binding agent. Besides, more straightforward methods, not requiring structural information also allow to determine pairs based on a single binding agent, once the sequence is known. As shown in the examples, in a non-limiting way, for the mCherry target protein, based on a screening for different binders, their competing nature was analysed by epitope mapping using BLI, or alternatively, based on the sequence of a nanomolar binder, or stripper, using an alanine mutation scan in the CDR3 region, known to be most critical in defining the binding kinetics, new pairs with lower dissociation rate constants could be identified, to function as trappers in the NANEX method. In this way, pairs of protein binding agents binding the same epitope with a different k.sub.off or affinity will be obtained simply by introducing single or multiple mutations.
[0167] In the specific embodiment relating to a method wherein not only the second but also the first (and optionally the 3rd and 4th) protein binding agent comprise an ISVDs, the monovalent format may be used as a trapper (first or third binding agent), and a multivalent format in combination as a stripper (2nd or 4th binding agent), since multivalent formats have a higher avidity as compared to the monovalent forms, with higher k.sub.off, resulting in optimal elution yields and target protein purity as well (see Example 12). The term monovalent format herein refers to an ISVD, as used herein, that can only recognize one antigenic determinant, while the term multivalent format refers to an ISVD as used herein that can recognize more than one antigenic determinant, such asbut not limited tobivalent, trivalent or tetravalent formats. Moreover, instead of a multivalent stripper, also a multiparatopic or multispecific stripper may be envisaged, wherein said stripper may comprise an identical building block binding to the same antigenic determinant, and at least one or more building blocks binding that may be different and may bind the same or another epitope on the target protein, or alternatively, an epitope on another target protein in complex with the first target protein.
[0168] In a further embodiment, the method for purification of the target protein applies a MegaBody as a first and/or second protein binding agent. The term MegaBody as used herein refers to the novel fusion proteins disclosed in Steyaert et al. (WO2019/086548A1), also called antigen-binding chimeric proteins herein, referring to the fusion protein comprising an antigen-binding domain, which is connected to a scaffold protein, wherein said scaffold protein is coupled to said antigen-binding domain at one or more amino acid sites accessible or exposed at the surface of said domain, resulting in an interruption of the topology of said antigen-binding domain. Said antigen-binding chimeric protein is further characterized in that it retains its antigen-binding functionality as compared to the antigen-binding domain not fused to said scaffold protein. The MegaBody as described herein relates to the particular MegaBody or antigen-binding chimeric protein for which the antigen-binding domain comprises an immunoglobulin single variable domain (ISVD) or a Nanobody, which is fused or connected to a scaffold protein, at an accessible surface of said ISVD domain ( turn or loop, excluding the CDRs), resulting in an interruption of the topology of said antigen-binding domain, and retaining its antigen-binding functionality, i.e. the specific epitope recognition. In a specific embodiment, said second protein binding agent relates to the MegaBody or antigen-binding chimeric protein comprising an ISVD connected to the scaffold protein via an insertion of the scaffold protein in the first beta-turn connecting the beta-strand A and B of the ISVD (as defined according to IMGT nomenclature, and as defined in WO2019/086548A1). In an even more specific embodiment, the scaffold protein used herein is the HopQ or Ygjk scaffold protein, wherein the fusion of the scaffold interrupts the topology of the ISVD, but not its overall 3D-structure, neither its epitope-binding specificity. The HopQ or HopQ-derived scaffold as used herein relates to a protein scaffold of the Adhesin domain of the type 1 HopQ of Helicobacter pylori strain G27 (Protein Database: PDB 5LP2), or a circularly permutated protein thereof, also called cHopQ or c7HopQ (see also WO2019/086548A1). The Ygjk or Ygjk-derived scaffold as used herein relates to a protein scaffold of the Escherichia coli K12 YgjK (PDB 3W7S), or a circularly permutated gene encoding said protein thereof, also called cYgjk (see also WO2019/086548A1).
[0169] The embodiment relating to said method wherein the second protein binding agent is a MegaBody, specifically binding the epitope of the target protein via its ISVD antigen-binding domain, results in the elution of the target protein bound to said MegaBody. As disclosed in Steyaert et al. (WO2019/086548A1), as well as in Laverty et al. (2019), Masiulis et al. (2019) and Uchanski et al (2019), these exemplified Megabodies act as a novel type of Nanobody-based chaperones for improved structural resolution in cryo-EM analysis. So, the method of purification applying a MegaBody as described herein as second or fourth protein binding agent, i.e. as a stripper, is advantageous for straightforward preparation and purification of complex samples for cryo-EM or other structural analyses. The k.sub.off of the ISVD comprised in said MegaBody is lower than the k.sub.off of the first protein binding agent, which constitutes another protein binding agent binding the same, substantially the same or largely overlapping epitope.
[0170] In fact, a specific embodiment relates to a method for purification of a target protein comprising the steps of: a) mixing a first protein binding agent, comprising an ISVD, specifically binding an epitope of a target protein with a sample containing said target protein, followed by optionally, washing the mixture of step a) to remove non-bound sample components, and b) adding a second protein binding agent recognizing the same or largely overlapping epitope of said target protein as the first binding agent, to displace the first binding agent from the target protein by specifically binding the target protein, and c) collecting the eluate comprising the bound target protein to the second protein binding agent, wherein said second protein binding agent comprises a MegaBody, as described herein, comprising an ISVD specifically binding the same, substantially the same or largely overlapping epitope as the first protein binding agent, and wherein the rate constant of dissociation (koff value) of said MegaBody is lower, and its affinity is equal or higher as compared to the first ISVD-comprising binding agent. In a specific embodiment said ISVD of the first binding agent is a mutant ISVD of the ISVD comprised in the MegaBody. Said method of purification ultimately provides for a single step purification from, for instance, complex cellular sample, or small sample mixtures for use in structural biology and physicochemical characterization or analytical studies.
[0171] Another embodiment relates to the method of purification of a target protein as described herein, wherein the epitope recognized by the first and second protein binding agent relates to a protein binding site or epitope present on a scaffold protein as comprised in a Mega Body. Said Mega Body may preferably be built using a scaffold protein derived from HopQ or Ygjk protein, hence said HopQ or Ygjk protein scaffolds containing the epitope specifically binding to the protein binding agents of the method. Said pair of protein binding agents specifically binding the scaffold protein epitopes present on a MegaBody as disclosed herein, or as disclosed in Steyaert et al. (WO2019/086548A1), or as may be described elsewhere has the further advantage that the purification method can be applied to capture or scavenge MegaBody-bound target protein from complex mixtures.
[0172] Furthermore, if said protein binding agents specifically binding said epitope of HopQ or Ygjk scaffold proteins would still bind HopQ and Ygjk when fused to other proteins, or via other fusion formats, besides MegaBody fusions, the pair of HopQ- and/or Ygjk-specific protein binding agents can be used in said method for further applications requiring purification of said HopQ- or Ygjk-based fusion proteins, in a similar manner as for the tags discussed herein.
[0173] Altogether the method as presented herein further provides for another aspect of the invention, which constitutes the pairs of binding agents itself, as to allow a full-blown toolbox for analytics of endogenous (often present in small amounts) and difficult to isolate proteins, as well as analytical tools for tagged proteins, to further miniaturize the method on for instance microfluidics chips to allow HTP analytical application in Mass spec and structural analysis. So a second aspect of the invention relates to a kit comprising the first and second protein binding agent of the method for purification of a target protein, wherein said second protein binding agent comprises an ISVD or a functional variant thereof, and wherein the rate constant of dissociation of the second protein binding agent is equal or lower as compared to the first binding agent and competed for the target protein. Said kit may further comprise buffers for solubilizing, washing or eluting, or a resin. Furthermore, instructions or protocol of performing the method of purification may be provided in said kit. The first and second protein binding agent of said kit relate to a protein binding agent, the second one being defined as the one with the lower dissociation rate or alternatively, the higher affinity. If more than 2 protein binding agents are present in said kit, these multiple protein binding agents may specifically bind the same, substantially the same or largely overlapping epitope, or different epitopes, and/or may differ in format (ISVD comprising and/or functional variants thereof) and antibodies, peptides, among others as a first/third binding agent. Alternatively, said kit comprising multiple protein binding agent for the method of purification of a target protein as described herein, may comprise protein binding agents binding to different epitopes or even different proteins (e.g. of a protein complex), to allow purification of a mixture of proteins or of a protein complex. Said multiple protein binding agents however should at least be present in pairs as described herein to allow for using them in the purification or tandem purification method as described herein. In another embodiments said kit comprising said binding agents may comprise the first binding agent or trapper in an immobilized format, present on a solid structure, such as beads, resin, or in a chip.
[0174] In a specific embodiment, said kit comprises a first and second protein binding agent for use in the method of purification of a GFP-tagged protein, wherein said protein binding agent is selected from the group of SEQ ID NO: 1-6, 18 or 19 (or comprising any of these sequences without the his-EPEA tag) or a sequence with a homologous amino acid sequence of at least 70%, or at least 80%, or at least 90%, or at least 95%, or at least 99% identity thereof, and wherein the first and second binding agent must not be identical in said selected sequence of the KD of said ISVD is below 0.1nM, or more specifically if SEQ ID NO: 1 is selected. Similarly, the kit may comprise other protein binding agents for use in the method as described herein, wherein the agents specifically recognized a commercially available tag for a protein, such as GST, EPEA, mCherry, Ubiquitin, SMT3 or others, as exemplified and described herein.
[0175] Another embodiment relates to the use of said kit for the method as described herein, for purification or analysis purposes, as well as the use in a screening assay for instance in which binders for a druggable conformation are screened for.
[0176] A further aspect of the invention relates to a protein complex comprising the second (or fourth) protein binding agent of the method of purification, bound to the target protein. Said protein complex is provided for in the elution step c) (or repeat of c) in d)) of the method as described herein, which provides for the sample containing the protein complex of interest for further analysis. Indeed, the (second or fourth) protein binding agent eluted in complex with the target protein may provide for a stabilizing chaperone required for high-resolution structural analysis, and/or may provide for a stabilizing effect for certain target protein conformations, and/or may provide for an increased protein mass required for atomic resolution cryo-EM microscopy imaging, or may provide for a visually detectable complex, for instance when a labelled protein binding agent was used, or may provide for alternative applications, such as mass spec analysis, and is not limited by the examples provided herein. The elution fraction of step c) (or repeat of c) in d)) of the method described herein does provides at least for the protein complex, but may also contain additional buffer components, residual impurities, and/or components added to the elution solution to provide for suitable analytical conditions for the protein complex. Furthermore, said complex comprising the target protein of interest and the displacer, may also contain further proteins bound to said target protein, as part of a protein-protein complex that is isolated from the sample through NANEX purification.
[0177] A specific embodiment relates to the protein complex wherein the epitope of the target protein, which is recognized by and bound to the 2.sup.nd or 4.sup.th protein binding agent is a protein comprising a tag or consisting of said tag, as selected from the list of GFP, mCherry, GST, EPEA, SMT3, among others as listed herein. Hence said protein complex comprises the second (or fourth) protein binding agent, and the target protein comprising or constituting said tag as selected from said group. Furthermore, said protein complex may be a crystalline complex or a crystal.
[0178] A further aspect relates to the use of said protein complex as described herein for structural analysis, structure-based drug design, drug discovery, mass spectrometry, but also as a diagnostic tool, or for in-vivo imaging. Indeed, quantitative mass spectrometry analysis of low abundant proteins present in complex mixtures is often difficult and unreliable due to the low signal to noise ratio. So, the method of purification as described herein may be advantageous to provide for highly pure analytical samples of such target proteins for MS profiling, or for identification of interacting protein partners.
[0179] Furthermore, the protein complex as described herein may provide for a 3-dimensional structural representation at atomic resolution of said complex, in a high resolution, preferably with a resolution between 0.1 and 3 , obtained by cryo-EM structural analysis. In an alternative embodiment, the crystalline protein complex as described herein may specifically relate to a crystal of a GFP-specific Nanobody and GFP target protein, said GFP-specific Nanobody as depicted in SEQ ID NO: 1 or a sequence with at least 90%, at least 95%, or at least 99% identity thereof, and said GFP protein as depicted in SEQ ID NO: 16, or a sequence with at least 90% , at least 95%, or at least 99% identity thereof, wherein said crystal is characterized in that the crystal lattice constants are: a=74.4975% b=103.450 5% c=209.7745% =90.00 =90.00 =90.00 (Space group P212121).
[0180] From said crystal structure, the binding site or epitope on the GFP protein where said Nb as depicted in SEQ ID NO: 1 is interacting with, consist of a subset of atomic coordinates, providing for the binding site consisting of amino acids residues number PRO89, GLU90, GLU111, LYS113, PHE114, GLU115, GLY116 of SEQ ID NO: 16.
[0181] Said binding site or epitope as determined by the 3D-structural representation of crystal may further allow to design and generate mutant protein binding agents, such as mutant ISVDs, to reduce their affinity, or increase their k.sub.off as compared to the protein binding agent or ISVD present in the protein complex. For designing such a mutant variant, which will differ in at least one amino acid from the protein binding agent present in the complex, a skilled person will rely on (computer-assisted) methods available in the art as to obtain a higher k.sub.off and/or lower affinity for the epitope on the target protein, as defined herein. So using the 3D structure of the protein complex as described herein, the skilled person may create mutation(s) in the binding agent its binding domain of the 3D structure using a computer-assisted method, further allowing him to display a superimposing model of said mutated binding domain on the three-dimensional model, and finally allowing him to assess whether said mutated binding domain results in a higher k.sub.off and/or lower affinity to the target protein. As presented herein in Examples 1 and 2, the GFP binding agents were designed in a similar manner.
[0182] Finally, the application of the method and means of the present invention for use in structure-based drug design, drug discovery and structure-based drug screening is also encompassed herein. The iterative process of structure-based drug design often proceeds through multiple cycles before an optimized lead goes into phase I clinical trials. The first cycle includes the cloning, purification and structure determination of the target protein or nucleic acid by one of three principal methods: X-ray crystallography, NMR, or homology modeling. Using computer algorithms, compounds or fragments of compounds from a database are positioned into a selected region of the structure. One could use the purification method and the ISVD-based protein binding agent of the invention to purify, fix and/or stabilize certain structural conformations of a target. The selected compounds are scored and ranked based on their steric and electrostatic interactions with this target site, and the best compounds are tested with biochemical assays. In the second cycle, structure determination of the target in complex with a promising lead from the first cycle, one with at least micromolar inhibition in vitro, reveals sites on the compound that can be optimized to increase potency. Also at this point, the purified protein complex of the invention may come into play, as it facilitates the structural analysis of said target in a certain conformational state. Additional cycles include synthesis of the optimized lead, structure determination of the new target:lead complex, and further optimization of the lead compound. After several cycles of the drug design process, the optimized compounds usually show marked improvement in binding and, often, specificity for the target. A library screening leads to hits, to be further developed into leads, for which structural information as well as medicinal chemistry for Structure-Activity-Relationship analysis is essential. Applying protein binding agents as described herein that comprise an ISVD such as a Nanobody or MegaBody offer the additional advantage for said drug discovery method that only average images of correctly folded target proteins will be encompassed because the selection for displayed targets using Nanobodies or MegaBodies reveals mostly binders to conformational epitopes. According to a particularly preferred embodiment, the above described method of identifying conformation-selective compounds is performed by a ligand binding assay or competition assay, even more preferably a radioligand binding or competition assay. Most preferably, the above described method of identifying conformation-selective compounds is performed in a comparative assay, more specifically, a comparative ligand competition assay, even more specifically a comparative radioligand competition assay. The compounds to be tested can be any small chemical compound, or a macromolecule, such as a protein, a sugar, nucleic acid or lipid. Typically, test compounds will be small chemical compounds, peptides, antibodies or fragments thereof. It will be appreciated that in some instances the test compound may be a library of test compounds. In particular, high-throughput screening assays for therapeutic compounds such as agonists, antagonists or inverse agonists and/or modulators form part of the invention. Methodologies for preparing and screening such libraries are known to those of skill in the art. The test compound may optionally be covalently or non-covalently linked to a detectable label. Suitable detectable labels and techniques for attaching, using and detecting them will be clear to the skilled person, and include, but are not limited to, any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
[0183] Means of detecting such labels are well known to those of skill in the art. Thus, for example, radiolabels may be detected using photographic film or scintillation counters, fluorescent markers may be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
[0184] The test compound as used in any of the above screening methods is selected from the group comprising a polypeptide, a peptide, a small molecule, a natural product, a peptidomimetic, a nucleic acid, a lipid, lipopeptide, a carbohydrate, an antibody or any fragment derived thereof, such as Fab, Fab and F(ab)2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (dsFv) and fragments comprising either a VL or VH domain, a heavy chain antibody (hcAb), a single domain antibody (sdAb), a minibody, the variable domain derived from camelid heavy chain antibodies (VHH or Nanobody), the variable domain of the new antigen receptors derived from shark antibodies (VNAR), a protein scaffold including an alphabody, protein A, protein G, designed ankyrin-repeat domains (DARPins), fibronectin type III repeats, anticalins, knottins, engineered CH2 domains (nanoantibodies), as defined hereinbefore. In one preferred embodiment, high throughput screening methods involve providing a combinatorial chemical or peptide library containing a large number of potential therapeutic ligands. Such combinatorial libraries or compound libraries are then screened in one or more assays, as described herein, to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity. A compound library is a collection of stored chemicals usually used ultimately in high-throughput screening. A combinatorial library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical building blocks. Preparation and screening of combinatorial libraries are well known to those of skill in the art. The compounds thus identified can serve as conventional lead compounds or can themselves be used as potential or actual therapeutics.
[0185] It is to be understood that although particular embodiments, specific configurations as well as materials and/or molecules, have been discussed herein for methods, samples and biomarker products according to the disclosure, various changes or modifications in form and detail may be made without departing from the scope of this invention. The following examples are provided to better illustrate particular embodiments, and they should not be considered limiting the application. The application is limited only by the claims.
EXAMPLES
General Introduction
[0186] Nanobody exchange chromatography (NANEX) is described herein for the first time and is based on the principle of affinity-displacement chromatography, specifically developed herein for binding agents competing for the target protein binding in exchange chromatography, and using ISVD-containing displacer agents.
[0187] In general, due to the addition of this second competing Nb to the mixture/column where the first binding agent binds the target, the binding of the target to the first Nb will be disturbed and the target protein will release from the first protein binding agent or Nb, through competing binding for the second protein binding agent or Nb, resulting in elution of the protein of interest. Although one would expect, as shown for other antibodies such as monoclonal antibodies, that in cases where epitopes are largely overlapping competition may lead to a block of the first binding agent for the epitope of the second binding agent, the kinetic mechanism for the ISVD-driven displacement to the target was shown to be different. Moreover, we showed that an optimal kinetic ratio between said binders for trapping and stripping, as defined by the k.sub.off, offered a robust and elegant displacement and purification method. Moreover, this new technology allows for mild purification conditions yielding a high recovery and purity within a fast, single purification step, even when starting from complex mixtures. Moreover, the method is applicable to very small sample sizes due to the high affinity and specificity of the applied binding agents.
[0188] The Examples provide support for the development, application and optimization of the NANEX technology, wherein several aspects have been highlighted. As mentioned herein, the binding agents throughout the majority of the example relate to ISVDs or Nanobodies, which are depicted herein by CA numbering, relating to the sequence information for the specific Nb clones, as linked via the SEQ ID NOs provided herein. The Examples as given herein are not limiting and provide severable manners to enable the skilled person to apply the NANEX technology in a versatile manner.
[0189] As an overview, the Examples provide for a first proof of concept made by targeting a well-known and easily traceable target protein, Green fluorescent protein (GFP), wherein more specifically a subset of Nbs was generated for designing an optimal method. In particular, in Examples 1 and 2, based on the crystal structure of high (low picomolar) affinity Nb bound to GFP, a number of trapper/stripper pairing Nbs were designed by mutation of the paratopic residues, produced, purified and analysed by BLI to determine the kinetic constants. In Examples 1 to 6 these Nb binding agents targeting the same epitope on GFP with different kinetic constants were tested for their relative displacement potential in several combinations, which allows to conclude that binding pairs which target the same epitope of the target can be used for displacement, however with certain kinetic limitations, and mainly dictated by the relative difference in k.sub.off value. Another way to generate a suitable trapper/stripper pair relates to increasing the avidity of the stripper as compared to the target. This has been shown in Example 12, where the stripper is a bivalent ISVD and the trapper a monovalent ISVD targeting the EPEA tag fused to a GFP protein.
[0190] Besides using Nb pairs which compete for the same epitope, Nanobody binding pairs which compete for a target kinetically but only partially (or not largely) overlapping epitopes have been demonstrated to also allow displacement, such as in Example 15 for factor IX.
[0191] In addition to purely Nbs, a functional variant of an ISVD, such as functionalized forms can as well be used as trapper or stripper agent, as is the case and shown herein for the Megabodies targeting GFP, usable as a stripper, as shown in Example 9, 10, and 16 or even as a trapper, as shown in Example 24.
[0192] Further trapper/stripper pairs were developed herein to target commercial tags as shown in Examples 1-10 and 18 for GFP, Example 12 for EPEA, Example 19 for GST, Example 20 for SMT3, and Example 21 and 22 for mCherry. Besides designing and generating pairs based on structural information of the binder/target complex, the Examples 21 and 22 also demonstrate that more straightforward tools are available to obtain suitable pairs.
[0193] Moreover, target proteins do not require a tag for NANEX, but may also be recognized at native or specific endogenously displayed epitopes, as has been shown in Example 13 for Synaptojanin, Examples 14, 15, 16, and 23 and 24 for factor IX.
[0194] Another application has been demonstrated in the field of protein-protein interactions (PPI), since purification using NANEX also allows to identify and purify PPI complexes. This was shown for eGFP-GR (Glucocorticoid receptor) (Example 25) and eGFP-ARb (Androgen receptor) (Example 26) which were purified with a GFP trapper/stripper pair and revealed co-purification of the HSP proteins known to form a complex with these nuclear receptors.
[0195] With regards to the possibilities to design kits and products for applying NANEX, we demonstrated several ways of immobilizing the trapper, as to further apply the stripper in solution. For instance, in Examples 1 to 5, the trapper was immobilized using agarose beads, in Example 27 magnetic beads were used. Furthermore in for instance examples 6 to 10 the immobilization of trapper Nb was obtained by coupling to a resin and packing in a column. To miniaturize the system, in Example 11, a microcolumn was applied, and in Example 28, a microchip prototype has been tested.
[0196] Finally, the diversity of samples that may be used herein for purification is clear from the examples since for instance bacterial lysates (e.g. in Example 1 and further), yeast extracts (e.g. in Example 17, 27), human plasma (in Example 23 and 24), and HEK cell lysates (in Example 25, 26), all complex mixtures, provide for one-step purification options using NANEX. Moreover, where a second purification step is desired, a tandem purification using NANEX sequentially and/or using multiple trapper/stripper pairs is in place as well (e.g. Example 16).
Example 1. Purification of GFP Protein Spiked in a Bacterial Lysate by NANEX Chromatography, Using Nb CA15816 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nb CA12760 as a Stripper
[0197] To proof the concept that proteins can be purified by Nanobody exchange chromatography (NANEX), we selected two Nanobodies that bind substantially the same or largely overlapping epitope on GFP and used these Nanobodies to purify GFP protein according to
[0198] First, we selected a high affinity Nanobody against GFP following standard procedures (Pardon et al., 2014) to be used as a stripper. CA12760 was selected as a Nanobody that binds GFP proteins with low picomolar affinity. Bio-Layer Interferometry (BLI) assays identified the affinity (K.sub.D) to be 40 pM, k.sub.on 2.5610.sup.5 (M.sup.1.s.sup.1) and k.sub.off 0.03210.sup.3 (s.sup.1). To perform NANEX chromatography, we next designed a nanobody that binds substantially the same or largely overlapping epitope on GFP to be immobilized on a solid phase as the trapper by site directed mutagenesis. Maximal elution could be obtained when using
[0199] NANEX with an immobilized trapper Nanobody that has a lower affinity and/or higher off-rate compared to the stripper Nanobody that is used to competitively elute the target, which vice versa has a higher affinity and or lower off-rate for the target protein. Based on the structure of the GFPCA12760 protein complex (
[0200] BLI assays identified the affinity (K.sub.D) of CA15816 for the GFP epitope to be 2.7 nM, k.sub.on 8.3510.sup.5 (M.sup.1.s.sup.1) and k.sub.off 2.2510.sup.3 (s.sup.1). One mg (66.67 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (GE) following the supplier's recommendations. Ten mL of a bacterial lysate (equivalent to the cell pellet of 0.5 L of an E. coli culture grown in LB) was spiked with 2 mg of GFP. The spiked lysate was loaded on the CA15816 column using a syringe, washed twice with 10 mL (10 Column volumes (CV)) of buffer (100 mM Hepes pH 7.5, 150 mM NaCl). The column was then connected on the Akta pure FPLC system (GE) for elution using the stripper in 8 CV of elution buffer (100 mM Hepes pH 7.5, 150 mM NaCl, 66.67 M stripper Nb (1 mg/mL)) at a flow rate of 0.1 mL/min. The elution was collected in 500 l fractions and the major elution peak was analysed by SDS/PAGE gel (
[0201] The purification of GFP protein using CA15816 as an immobilized trapper on a HiTrap NHS-activated Sepharose HP column that was eluted from this column by CA12760 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (GFP fluorophore absorption). From the elution profile, we can conclude that the washing was sufficient for removing most of the impurities, and that the elution fractions 2 and 3 contained the Stripper Nb and GFP protein as detected in the main peak. The smaller peak at 280 nm represents the remaining sample (or GFP protein) that was washed off from the column with the regeneration buffer.
[0202] Nanobody exchange chromatography (NANEX) using binders for the same epitope requires that the immobilized Nanobody (trapper) has a higher off-rate and/or lower affinity, whereas the nanobody that is used to competitive elute the target (stripper) has a lower off-rate and/or higher affinity for the target protein, to result in optimal yield and purity. To proof this principle, we performed NANEX experiments with different trapper-stripper pairs targeting the same GFP epitope but vary in affinity and off-rate (k.sub.off) in Examples 2-8.
Example 2: Purification of GFP Protein Using Nb CA12760 as an Immobilized Trapper on NHS-Activated Agarose Beads and Nbs CA12760, CA15818, CA15816, CA15861 as Strippers, Respectively
[0203] In this Example, we show that high affinity trappers cannot conveniently be combined with lower affinity strippers.
[0204] This example describes the affinity purification of GFP using CA12760 (SEQ ID NO: 1) as the trapper, which is a Nanobody specifically binding GFP with low picomolar affinity. BLI assays identified the affinity (K.sub.D) to be 40 pM, k.sub.on 2.5610.sup.5 (M.sup.1.s.sup.1) and k.sub.off 0.03210.sup.3 (s.sup.1).
[0205] To identify the epitope and paratope of GFPCA12760 we solved the structure of this complex by X-ray crystallography (
TABLE-US-00001 TABLE 1 GFP-specific Nanobodies with distinct binding kinetics as measured in BLI. Kon (10.sup.5) Koff Half- Half-time KD KD Nanobody Mutations (M.sup.1 .Math. s.sup.1) (10.sup.3) (s.sup.1) time ratio (nM) ratio CA12760 Wt 2.56 0.032 5 h 1 0.04 CA15818 F103A 3.87 0.29 40 min 9 1.5 30 CA15816 TS4A VSSA 8.35 2.25 5.13 min 70 2.7 50 CA15861 T54A 28.85 45.8 15 s 1400 111 2000 V55A F103A
[0209] Half-time is defined in function of the k.sub.off (t.sub.1/2=ln2/k.sub.off), the half-time ratio is defined here relative to the wt Nb, as well as the K.sub.D ratio.
[0210] To purify GFP, we covalently immobilized 4 mg of the trapper Nb CA12760 on 500 l of NHS-Activated agarose beads (Thermo Fisher Scientific) following the supplier's recommendations. 200 g (7.69 nmol) of purified GFP was loaded on 50 l CA12760 Nb-coupled agarose beads in a final volume of 1 mL in 100 mM Hepes buffer pH7.5, 150 mM NaCl. To specifically elute GFP protein from this affinity matrix, we used CA12760, CA15818 (SEQ ID NO: 2), CA15816 (SEQ ID NO: 3), CA15861 (SEQ ID NO: 4) as strippers.
[0211] The purification of GFP using CA12760 as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as a stripper was performed in elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 53 M stripper Nb (800 g/mL)) and monitored by measuring absorbance at 488 nm (indicative of amount of GFP fluorescent protein) at 5 different time points (0, 15, 30, 60, 120 minutes) (
Example 3. Purification of GFP Using Nb CA15818 as an Immobilized Trapper on NHS-Activated Agarose Beads and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0212] In this Example, a medium affinity trapper was combined with high and low affinity strippers, respectively.
[0213] This example describes the affinity purification of GFP protein using CA15818 (see Example 2 and Table 1) as the trapper. To purify GFP, we covalently immobilized 4 mg of the trapper CA15818 on 500 l of NHS-Activated agarose beads (Thermo Fisher Scientific) following the supplier's recommendations. 200 g (7.69 nmol) of purified GFP was loaded on 50 l CA15818 Nb-coupled agarose beads in a final volume of 1 mL in 100 mM Hepes buffer pH7.5, 150 mM NaCl. To specifically elute the GFP from this affinity matrix, we used CA12760, CA15818, CA15816, CA15861 as the stripper (see Table 1).
[0214] The purification of GFP protein using Nb CA15818 as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as a stripper was performed in elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 53 M stripper Nb (800 g/mL)) and monitored by measuring absorbance at 488 nm at 5 different time points (0, 15, 30, 60, 120 minutes) (
Example 4. Purification of GFP Protein Using Nb CA15816 as an Immobilized Trapper on NHS-Activated Agarose Beads and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0215] In this example, we combined a low affinity trapper with high and low affinity strippers, respectively.
[0216] This example describes the affinity purification of GFP using CA15816 Nb as the trapper (See Example 2 and Table 1). To purify GFP, we immobilized covalently 4 mg of the trapper CA15816 Nb on 500 l of NHS-Activated agarose beads following the supplier's recommendations. 200 g (7.69 nmol) of purified GFP was loaded on 50 l CA15816 Nb-coupled agarose beads in a final volume of 1 mL 100 mM Hepes buffer pH7.5, 150 mM NaCl. To specifically elute GFP protein from this affinity matrix, we used CA12760, CA15818, CA15816, and CA15861 Nbs as stripper (see Example 2, Table 1). The purification of GFP using CA15816 Nb as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 Nbs as a stripper was performed in elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 53 M stripper Nb (800 g/mL)) and was monitored by measuring absorbance at 488 nm at 5 different time points (0, 15, 30, 60, 120 minutes) (
Example 5. Purification of GFP Protein Using Nb CA15861 as an Immobilized Trapper on NHS-Activated Agarose Beads and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0217] In this Example, we combined a low affinity trapper with higher affinity strippers, respectively.
[0218] This example describes the affinity purification of GFP using CA15861 Nb as the trapper (see Example 2 and Table 1). To purify GFP, we covalently immobilized 4 mg of the trapper CA15861 Nb on 500 l of NHS-Activated agarose beads following the supplier's recommendations. 200 g (7.69 nmol) of purified GFP protein was loaded on 50 l CA15861 Nb-coupled agarose beads in a final volume of 1 mL 100 mM Hepes buffer pH7.5, 150 mM NaCl. To specifically elute GFP from this affinity matrix, we used CA12760, CA15818, CA15816, and CA15861 Nbs as the strippers (see Example 2 and Table 1). The purification of GFP using CA15861 as an immobilized trapper on NHS-Activated agarose beads and CA12760, CA15818, CA15816, CA15861 as a stripper was performed in elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 53 M stripper Nb (800 g/mL)) and monitored by measuring absorbance at 488 nm at 5 different time points (0, 15, 30, 60, 120 minutes) (
Example 6. Purification of GFP Protein by Nanobody Exchange Chromatography, Using Nb CA12760 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0219] In this example, we combined a high affinity trapper with lower affinity strippers (analogous to Example 2 but using a trapper that is immobilized on beads that are contained in a prepacked column), for the affinity purification of GFP with CA12760 Nb (see Example 2 and Table 1) coupled to HiTrap NHS-activated Sepharose HP beads using a 1 mL column (1 mL CV), connected to an FPLC (AktaPure-GE) system. To specifically elute the GFP from this affinity matrix, we used CA12760, CA15818, CA15816, CA15861 as the strippers (see Example 2 and Table 1), respectively. 1 mg (66.67 nmol) of CA12760 was immobilized on HiTrap NHS-activated Sepharose HP beads, prepacked in a 1 mL column (GE) following the supplier's recommendations. 2 mg (76.92 nmol) of the GFP was loaded on the CA12760 nb-coupled column through the injection loop. 10 CV of 100 mM Hepes washing buffer pH7.5, 150 mM NaCl was passed over the column to remove unbound material. Elution was performed using 8 CV elution buffer (100 mM Hepes buffer pH7.5, 150 mM NaCl, 66.67 M stripper Nb (1 mg/mL)) at a flow rate of 0.1 mL/min.
[0220] The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
[0221] The purification of GFP protein using CA12760 as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA12760, CA15818, CA15816, CA15861 Nbs as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (GFP fluorophore absorption) (
Example 7. Purification of GFP Protein by Nanobody Exchange Chromatography, Using Nb CA15816 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0222] In this example, we combined a low affinity trapper with high and low affinity strippers (analogous as in Example 4 but using a trapper that is immobilized on beads that are contained in a prepacked column), for the affinity purification of GFP with CA15816 Nb (see Example 2, Table 1) coupled to an HiTrap NHS-activated Sepharose HP beads prepacked in a 1 mL column (GE), connected to an FPLC (AktaPure-GE) system. To specifically elute the GFP from this affinity matrix, we used CA12760, CA15818, CA15816, CA15861 as the strippers (see Example 2, Table 1), respectively. 1 mg (66.67 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP beads, prepacked in a 1 mL column (1 mL CV) (GE) following the supplier's recommendations. 2 mg (76.92 nmol) of the GFP protein was loaded on the CA15816 Nb-coupled column through the injection loop. 10 CV of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl) was passed over the column to remove unbound material, followed by 8 CV of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 66.67 M stripper (1 mg/mL)- at a flow rate of 0.1 mL/min. The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
[0223] The purification of GFP protein using CA15816 as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA12760, CA15818, CA15816, CA15861 Nbs as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (GFP fluorophore absorption) (
Example 8. Purification of GFP Protein by Nanobody Exchange Chromatography, Using Nb CA15861 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA12760, CA15818, CA15816, CA15861 as a Stripper
[0224] In this example, we combined a poor trapper with higher affinity strippers (analogous to Example 5 but using a trapper that is immobilized on beads that are contained in a prepacked column), for the affinity purification of GFP CA15861 Nb coupled to HiTrap NHS-activated Sepharose HP beads using a 1 mL column (see Example 2, Table 1), connected to an FPLC (AktaPure-GE) system. To specifically elute GFP from this affinity matrix, we used CA12760, CA15818, CA15816, and CA15861 Nbs as the strippers (Table 1), respectively. 1 mg (66.67 nmol) of CA15861 was immobilized on HiTrap NHS-activated Sepharose HP beads, prepacked in a 1 mL column (1 mL CV; GE) following the supplier's recommendations. 2 mg (76.92 nmol) of GFP was loaded on the CA15861 column through the injection loop. 10 CV of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl) was passed over the column to remove unbound material, followed by 8 CV of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 66.67 M stripper (1 mg/mL) at a flow rate of 0.1 m L/min. The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
Example 9. Purification of a GFP Protein Spiked in a Bacterial Lysate by NANEX Chromatography Using Nb CA15816 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Eluted with a CA15621 MegaBody Mb.SUB.CA12760Nb..SUP.cHopQ .as a Stripper
[0225] One major advantage of NANEX is that the stripper can be a functionalized or engineered Nanobody (e.g. a MegaBody, fluorescent labelled for imaging, biotin-coupled for detection) to elute the target in a functionalized complex. To validate these options, we purified GFP from a bacterial lysate by Nanobody exchange chromatography (NANEX) and eluted GFP as a GFPMegaBody complex. Example 9 describes the affinity purification of GFP protein spiked in a bacterial lysate using a HiTrap NHS-activated Sepharose HP column coupled with CA15816 Nb (see Table 1), connected to an FPLC (AktaPure-GE) system. To specifically elute GFP protein from this affinity matrix we used CA15621 Mb as the stripper. CA15621 is a MegaBody, or antigen-binding chimeric protein, as described herein, and with a fusion as disclosed in WO2019/086548A1, in which in particular the Mb.sub.CA12760Nb.sup.cHopQ is composed of a rigid fusion of the CA12760 GFP-specific Nb with the cHopQ scaffold.
[0226] In detail, the 58 kDa MegaBody described here is a chimeric polypeptide concatenated from parts of single-domain immunoglobulin and parts of cHopQ scaffold protein. Here, the immunoglobulin domain used is a GFP-binding Nanobody as depicted in SEQ ID NO: 1. The scaffold protein is an adhesin domain of Helicobacter pylori strain G27 (PDB: 5LP2, SEQ ID NO: 17) called HopQ (Javaheri et al, 2016). The N- and C-terminus of HopQ was connected to allow the creation of a circularly permutated variant of HopQ, called cHopQ, wherein a cleavage of the sequence was made somewhere else in its sequence. To design the Mb.sub.NbCA12760.sup.cHopQ construct, all parts were connected to each other from the amino (N-) to the carboxy (C-)terminus in the next given order by peptide bonds: -strand A of the anti-GFP-Nanobody (1-13 of SEQ ID NO: 1), a C-terminal part of HopQ (residues 192-414 of SEQ ID NO: 17), a short peptide linker connecting the C-terminus and the N-terminus of HopQ to produce a circular permutant cHopQ of the scaffold protein, an N-terminal part of HopQ (residues 14-186 of SEQ ID NO: 17), -strands B to G of the GFP-binding Nanobody (residues 16-126 of SEQ ID NO: 1), 6xHis tag.
[0227] For coupling, 1 mg (66.67 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 10 mL of a bacterial lysate (equivalent to the cell pellet of 0.5 L of an E. coli culture grown in LB) was spiked with 2 mg of GFP protein. Lysate was loaded using a syringe on the CA15816 Nb-coupled column, washed twice with 10 CV of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE), followed with 8 CV of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 68.18 M stripper (4.5 mg/mL)) at a flow rate of 0.1 mL/min. The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
Example 10. Purification of GFP Spiked in a Bacterial Lysate by Nanobody Exchange Chromatography, Using Nb CA15816 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Eluted with a CA15616 MegaBody MbCA12760NbYgik as a Stripper
[0228] Example 10 further describes the affinity purification of GFP protein spiked in a bacterial lysate using a HiTrap NHS-activated Sepharose HP column coupled with CA15816 Nb (see Table 1), connected to an FPLC (AktaPure-GE) system, and specifically eluted using CA15816 Mb as the stripper. CA15816 is a MegaBody, or antigen-binding chimeric protein, as described herein, and with a fusion as disclosed in WO2019/086548A1, in which in particular the Mb.sub.CA12760Nb.sup.Ygjk is composed of a rigid fusion of the CA12760 GFP-specific Nb with the Ygjk scaffold.
[0229] In detail, the 100 kDa Megabodies are chimeric polypeptides concatenated from parts of a single-domain immunoglobulin and parts of a scaffold protein linked by short polypeptide linkers. The immunoglobulin used is a GFP-binding Nanobody as depicted in SEQ ID NO: 1. The alternative scaffold protein used was YgjK, a 86 kDA periplasmic protein of E. coli (PDB 3W7S, SEQ ID NO: 32). All parts were connected to each other from the amino to the carboxy terminus in the next given order by peptide bonds: -strand A of the anti-GFP- Nanobody (residues 1-12 of SEQ ID NO: 1), a peptide linker of one or two amino acids with random composition, the C-terminal part of YgjK (residues 464-760 of SEQ ID NO: 32), a short peptide linker connecting the C-terminus and the N-terminus of YgjK to produce a circular permutant of the scaffold protein, the N-terminal part of YgjK (residues 1-461 of SEQ ID NO: 32), a peptide linker of one or two amino acids with random composition, -strands B to G of the anti-GFP-Nanobody (residues 17-126 of SEQ ID NO: 1), 6xHis tag.
[0230] For coupling, 1 mg (66.67 nmol) of CA15816 was immobilized on HiTrap NHS-activated Sepha rose HP column (1 mL CV; GE) following the supplier's recommendations. 10 mL of a bacterial lysate (equivalent to the cell pellet of 0.5 L of an E. coli culture grown in LB) was spiked with 2 mg of GFP. Lysate was loaded using a syringe on the CA15816 Nb-coupled column, washed twice with 10 CV) of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE), following 8 CV in elution buffer (100 mM Hepes pH7.5, 150 mM NaCl, 48.54 M (5 mg/mL) stripper) at a flow rate of The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
Example 11. Purification of GFP Protein by Nanobody Exchange Chromatography Using Nb CA15816 as an Immobilized Trapper on NHS-Activated Agarose Beads to Apply in a Custom-Made 75 L Micro-Column Using Nb CA12760 as a Stripper
[0231] This example describes the affinity purification of a GFP protein on an affinity micro-column, connected to an FPLC (AktaPure-GE) system. We covalently immobilized 4 mg of the trapper CA15816 Nb (see Table 1) on 500 l of NHS-Activated agarose beads. 75 l of agarose beads was packed into a custom-made micro-column using commercially available parts that can be connected to common laboratory equipment (
[0232] Comparable to the use of larger columns (see Example 7,
Example 12. Purification of a GFP-EPEA Protein by Nanobody Exchange Chromatography Using a CA4375 Synuclein 2-Specific Nb as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Eluted with CA4375 Nb as Monovalent and Bivalent Forms, Respectively as a Stripper
[0233] To proof that Nanobody exchange chromatography (NANEX) requires that the immobilized Nanobody (trapper) has a lower affinity and/or higher off-rate, whereas the Nanobody that is used to competitive elute the target has a higher affinity and or lower of rate for the target protein (stripper), to result in optimal yield and purity, we performed NANEX experiments with different trapper-stripper pairs that vary in affinity and off rate. Herein we also describe the EPEA-tag specific Nb as trapper and the same EPEA-specific Nb in monovalent and bivalent version as the stripper. This example describes the affinity purification of GFP-EPEA protein. CA4375 (SEQ ID NO: 7) is a nanobodies selected against human alpha-synuclein (UniProtKBP37840) that binds a C-terminal linear epitope (EPEA). CA4394 (SEQ ID NO: 8) is a bivalent format of CA4375 Nb selected against human alpha-synuclein (UniProtKBP37840) that binds a C-terminal linear epitope (EPEA).
[0234] BLI assays identified the affinity (K.sub.D) of CA4375 to be 60 nM, k.sub.on 6.1610.sup.5 (M.sup.1.s.sup.1) and k.sub.off 0.32410.sup.3 (s.sup.1). 1 mg (69.89 nmol) of CA4375 monovalent Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL CV; GE) following the supplier's recommendations. 10 mL of a bacterial lysate (0.5 L of culture) was spiked with 2 mg of GFP (76.92 nmol). Lysate was loaded using a syringe on the CA4375 Nb-coupled column, which was then washed twice with 10 CV of buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE) and followed by 8 CV elution buffer (25 mM HEPES pH 7.5, 150 mM NaCl, concentration stripper CA4375 69.93 M (1 mg/mL)) and for CA4394 33.57 M (0.95 mg/mL)) at a flow rate of 0.1 mL/min. The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
[0235] The purification of GFP-EPEA using CA4375 monovalent Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA4394 bivalent as a stripper was monitored by measuring absorbance at 280 nm and 488 nm (
[0236] In contrast, when the monovalent Nb was used as a stripper, we found that the monovalent Nb only allows to elute little amounts of GFP-EPEA protein. It thus appears that the multivalent stripper has a higher (apparent) affinity (due to avidity effects) and acts as a potent stripper.
Example 13. Purification of Recombinant Human Synaptojanin Protein by NANEX Using Nb CA13016 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Using CA13080 Synaptojanin-Specific Nb as a Stripper
[0237] Here, we further demonstrate that a lower affinity Synaptojanin-specific Nb can be used as a trapper in combination with unrelated higher affinity Synaptojanin-specific Nb that competes for the same epitope as a stripper to isolate Synaptojanin from cells or cell extracts. This example describes the NANEX chromatography purification of recombinant human Synaptojaninl (amino acid 528-873 of UniProtKB: O43426) in an E. coli cell extract by NANEX. CA13016 Nb (SEQ ID NO: 8) and CA13080 Nb (SEQ ID NO: 9) are Nanobodies selected against the human Synaptojanin1 (528-873).
[0238] BLI assays identified the affinity (K.sub.D) of CA13016 to be 1.06 M, k.sub.on 3.810.sup.4 (M.sup.1.s.sup.1) and K.sub.off 510.sup.2 (s.sup.1). BLI assays identified the affinity (K.sub.D) of CA13080 to be 3.2 nM, k.sub.on 1.810.sup.5 (M.sup.1.s.sup.1) and K.sub.off 410.sup.3 (s.sup.1). Although CA13016 Nb and CA13080 Nb have different CDRs, they are binding to the same epitope on the human Synaptojanin1 and are mutually exclusive. 1 mg (66.57 nmol) of CA13016 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL CV; GE) following the supplier's recommendations.
[0239] Recombinant human Synaptojanin1 (528-873) was expressed using a pET28a expression vector transformed into expression strain BL21(DE3)-T1.sup.R, cells were grown in TB media until OD.sub.600=0.6 and induced with 1 mM IPTG at 20 degrees over-night. Cells were collected by centrifugation and resuspended in 25 mM Hepes (pH7.5), 300 mM NaCl, 10% glycerol, 5 mM MgCl.sub.2, 1 mM DTT (supplemented with DNAse and protein inhibitors) before lysis using a cell-cracker. The crude extract was clarified by centrifugation and supernatant was collected and filtered (0.45 m filter). 10 mL of lysate (equivalent to the cell pellet of 0.6 L of an E. coli culture grown in LB) was loaded on HiTrap NHS-activated Sepharose HP column coated with CA13016 Nb using a syringe and the flow-through was collected. 10 mL of washing buffer using 25 mM Hepes (pH7.5), 300 mM NaCl, 10% glycerol, 5 mM MgCl2, 1 mM DTT (performed twice) was performed using a syringe and the collected. The affinity column was then connected to an FPLC (AktaPure-GE) system for elution.
[0240] Elution conditions (25 mM Hepes (pH7.5), 300 mM NaCl, 10% glycerol, 5 mM MgCl2, 1 mM DTT, Volume 1 mL, concentration stripper (CA13080) 66.97 M (1 mg/mL), flow rate 0.1 mL/min). After 8 mL (8 CV) the elution buffer is changed for 8 mL (8 CV) of a regeneration buffer (200 mM Glycin pH2.3).
[0241] The purification of recombinant human Synaptojanin1 (528-873) using CA13016 Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA13080 Nb as a stripper was monitored by measuring absorbance at 280 nm. The elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (
Example 14. Purification of Recombinant Human Coagulation Factor IXa by NANEX Using Nb CA11138 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Eluted with Nb CA10304 as a Stripper
[0242] To further proof the concept we performed a NANEX experiment with a recombinant human coagulation factor IXa specific trapper and eluted factor IXa with a higher affinity stripper. This example describes the Nanobody exchange chromatography of recombinant human coagulation factor IXa (light chain residues 134-191, heavy chain residues 227-461, Uniprot-numbering, UniProtKBP00740) expressed in E.coli. CA11138 (SEQ ID NO: 11) and CA10304 (SEQ ID NO: 12) are Nanobodies selected against the human coagulation factor IXa.
[0243] BLI assays identified the affinity (K.sub.D) of CA11138 to be 141 nM, k.sub.on 3.410.sup.4 (M.sup.1.s.sup.1) and k.sub.off 4.210.sup.3 (s.sup.1). BLI assays identified the affinity (K.sub.D) of CA10304 to be 46 nM, k.sub.on 8.810.sup.4 (M.sup.1.s.sup.1) and k.sub.off 3.510.sup.3 (s.sup.1).
[0244] CA11138 and CA10304 have different CDRs and they are only partially binding to the same epitope on the human coagulation factor IXa and are mutually exclusive. 1 mg (67.25 nmol) of CA11138 was immobilized on HiTrap NHS-activated Sepharose HP column (GE) following the supplier's recommendations. The human coagulation factor IXa was fluorescently labelled using Dylight-647 to follow the purification by measuring absorbance at 650 nm. 0.4 mg of the human coagulation factor IXa fluorescently labelled (Dylight-647) was loaded on the CA11138 column through the injection loop. 10 mL (10 CV) of buffer (20 mM Hepes pH7.5, 150 mM NaCl, 2.5 mM CaCl2) was passed over the column to wash off unbound material. Elution conditions (20 mM Hepes pH7.5, 150 mM NaCl, 2.5 mM CaCl2, Volume 1 mL, concentration CA10304 stripper 468.7 M (7 mg/mL), flow rate 0.1 m L/min). After 8 mL (8 CV) the elution buffer is changed for 8 ml (8 CV) of a regeneration buffer (200 mM Glycin pH2.3). The purification of the human coagulation factor IXa using CA11138 as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA10304 as a stripper was monitored by measuring absorbance at 280 nm and 650 nm. Elution peak was collected in 500 L fractions and analysed in SDS-PAGE gel (
Example 15. Purification of the Recombinant Human Coagulation Factor IXaCA10304 Complex by NANEX Using CA10502 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Eluted with CA10309 as a Stripper
[0245] To further proof that a sequential purification using a double NANEX is possible, we performed a NANEX experiment with the eluted recombinant human coagulation factor IXaCA10304 complex from Example 14 for another NANEX purification using a different pair of trapper and stripper that binds to a different epitope as compared to the binders of Example 14.
[0246] CA10502 (SEQ ID NO: 13) and CA10309 (SEQ ID NO: 14) are Nanobodies selected against the human coagulation factor IXa. BLI assays identified the affinity (K.sub.D) of CA10502 to be 74 nM, k.sub.on 7.010.sup.4 (M.sup.1.s.sup.1) and K.sub.off 4.010.sup.3 (s.sup.1). BLI assays identified the affinity (K.sub.D) of CA10309 to be 21 nM, k.sub.on 6.210.sup.4 (M.sup.1.s.sup.1) and K.sub.off 7.310.sup.4 (s.sup.1). CA10502 and CA10309 have different CDRs and are partially binding to the same epitope on the human coagulation factor IXa and are mutually exclusive.
[0247] 1 mg (73.33 nmol) of CA10502 was immobilized on HiTrap NHS-activated Sepharose HP column (GE) following the supplier's recommendations. The human coagulation factor IXa was fluorescently labelled using Dylight-647 to follow the purification by measuring absorbance at 650 nm. 2 mL of the eluted recombinant human coagulation factor IXa(Dylight-647)CA10304 complex from Example 14 was loaded on the CA10502 column through the injection loop. 10 mL (10 CV) of buffer (20 mM Hepes pH7.5, 150 mM NaCl, 2.5 mM CaCl2) was passed over the column to wash off unbound material.
[0248] Elution conditions (20 mM Hepes pH7.5, 150 mM NaCl, 2.5 mM CaCl2, Volume 1 mL, concentration CA10309 stripper 52.42 M (0.75 mg/mL), flow rate 0.1 mL/min). After 8 mL (8 CV) the elution buffer is changed for 8 mL (8 CV) of a regeneration buffer (200 mM Glycine pH2.3). The purification of the human coagulation factor IXaCA10304 complex using CA10502 as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA10309 as a stripper was monitored by measuring absorbance at 280 nm and 650 nm. Elution peak was collected in 500 l fractions and analysed in SDS/PAGE gel (Figure From the absorbance profile of the elution chromatogram and SDS-PAGE analysis of the eluted fractions, we can conclude that using a trapper Nb (CA10502) in combination with higher affinity stripper Nb (CA10309), washing was sufficient for removing most of the impurities and the excess of stripper Nb (CA10304 used in Example 14), elution fractions 2, 3 and 4 contained both strippers (CA10309 and CA10304) and the human coagulation factor IXa as detected in the main peak. The smaller peak at 280 nm and 650 nm after 10 CV of elution represents the remaining amount of sample on the column that was washed off with the regeneration buffer.
[0249] So, we can conclude from this that using a pair of Nbs with different affinities that bind a minimal or only partially overlapping epitope is capable of purifying the human coagulation factor IXa in complex with CA10304.
Example 16. Purification of the Recombinant Human Coagulation Factor IXa by Tandem Nanobody Exchange Chromatography Using CA11138 and CA10502 as Immobilized Trappers on HiTrap NHS-Activated Sepharose HP Columns and Eluted with CA10304 and CA14208 as Strippers
[0250] To proof the concept that proteins can be purified by Tandem Nanobody exchange chromatography (tandem-NANEX), we selected two Nanobody pairs that pa irwise compete for two different epitopes on the human coagulation factor IXa according to the scheme described in
[0251] In order to perform the tandem-NANEX we connected a first column (the CA11138 column used in Example 14) to a second column (the CA10502 column used in Example 15).
[0252] The first NANEX pair is composed of CA11138 as trapper1 and CA10304 as stripper1, the second NANEX pair is composed of CA10502 as trapper2 and CA14208 (SEQ ID NO: 15) as stripper2. CA14208 is a functionalized Nanobody derived from CA10309 crafted onto the YgjK scaffold to generate a Mega Body. The human coagulation factor IXa was fluorescently labelled using Dylight-647 to follow the purification by measuring absorbance at 650 nm.
[0253] 0.4 mg of the human coagulation factor IXa fluorescently labelled (Dylight-647) was injected on the columns. 5 mL (2.5 CV) of buffer (20 mM Hepes pH7.5, 150 mM NaCl, 2.5 mM CaCl2) was passed over the column to wash off unbound material. 200 M of stripper1 (CA10304) was injected from 1.5 mL loop pre-rinsed with buffer, followed by 5 mL (2.5 CV) of buffer. Then 24 M of Stripper2 (CA14208) was injected on the columns followed by 10 mL (5 CV) of buffer. Next 10 mL of regeneration buffer (200 mM Glycin pH2.3) is applied to remove all proteins from the columns. The tandem-NANEX was monitored by measuring absorbance at 280 nm and 650 nm. Elution peak was collected in 500 L fractions and analysed in SDS/PAGE gel (
Example 17. Purification of the Yeast 60S Ribosomal Subunit that Contains the RPP1A-GFP Fusion Protein from a Yeast Extract by NANEX Chromatography, Using Nb CA15816 as an Immobilized Trapper and Nb CA12760 as a Stripper
[0254] To proof that Nanobody exchange chromatography (NANEX) works fast and quantitatively if the immobilized Nanobody (trapper) has a lower affinity and/or higher off-rate, whereas the Nanobody that is used to competitive elute the target has a higher affinity and or lower off-rate for the target protein (stripper), to result in optimal yield and purity, we purified the Saccharomyces cerevisiae 60S acidic ribosomal protein P1-alpha (RPP1A, YDL081C, UniProtKB P05318) that contains GFP fused to its carboxy-terminal end from an Saccharomyces cerevisiae extract by NANEX. The yeast clone (reference GFP+35: G8, ThermoFisher Yeast GFP Clone Collection; Hugh et al., 2003) comes from a S. cerevisiae yeast strain collection expressing full-length ORFs containing an Aequorea victoria GFP (S65T) tag (Tsien, 1998) at the C-terminus end. The GFP fusion proteins are integrated into the yeast chromosome through homologous recombination and are expressed using endogenous promoters (Huh et al., 2003).
[0255] One mg (66.67 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (GE) following the supplier's recommendations. 20 mL of a clarified Yeast lysate (equivalent to the cell pellet of 6 L of a culture of yeast clone GFP+35: G8 grown in YPD) was loaded on the CA15816 column using a syringe, washed twice with 10 mL (10 column volumes (CV)) of buffer (100 mM Hepes pH 7.5, 150 mM NaCl). The column was then connected on the Akta pure FPLC system (GE) for elution using the stripper in 8 CV of elution buffer (100 mM Hepes pH 7.5, 150mM NaCl, 66.67 M stripper Nb CA12760 (1 mg/mL)) at a flow rate of 0.1 mL/min. The elution was collected in 100 L fractions and the major elution peak was analyzed by SDS/PAGE gel (
[0256] The purification of RPP1A-GFP using CA15816 as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA12760 as a stripper was monitored by measuring absorbance at 280 nm (protein absorption) and 488 nm (GFP fluorophore absorption) (
Example 18. Purification of GFP Using Nb CA16695 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP and Nb CA16047 as a Stripper
[0257] For NANEX, the stripper needs to disrupt the interaction between the trapper and the target to displace the trapper. This can be achieved for a (high affinity) stripper which binds the same or an overlapping epitope on the target as the trapper, but with a higher affinity or lower k.sub.off.
[0258] To further demonstrate that any stripper-trapper pair that competitively binds an epitope on the target can in principle be used for NANEX, we also identified a stripper-trapper pair (Nb CA16047, Nb CA16695) that competitively binds a different epitope on GFP compared to example 1 (Nb CA12760, Nb CA15816). This example describes the affinity purification of recombinant GFP using CA16695 (SEQ ID NO: 19) as a nanomolar trapper, and CA16047 (SEQ ID NO: 18) as a low nanomolar affinity stripper.
[0259] To identify the epitope and the paratope in the GFPCA16047 complex we solved the structure of this complex by X-ray crystallography (
TABLE-US-00002 Kon (10.sup.5) Koff Half Half KD KD Nb Mutation (M.sup.1 .Math. s.sup.1) (10.sup.3) (s.sup.1) time time ratio (nM) ratio CA16047 Wt 2.34 0.98 11.79 min 1 6.15 1 CA16695 Y119F 2.00 1.67 6.92 min 1.78 8.53 1.37
[0260] Based on the structure of GFPCA16047, Tyr119 of the stripper (CA16047) was mutated to Phe (Tyr119phe) to produce a trapper designated CA16695. [0261] BLI assays identified the affinity (K.sub.D) of CA16047 to be 6.15 nM, k.sub.on 2.310.sup.4 (M.sup.1.s.sup.1) and K.sub.off 9.810.sup.4 (s.sup.1) (
[0263] Next, we purified GFP by Nanobody exchange chromatography (NANEX) using CA16047 and Nb CA16695 as a stripper-trapper pair and eluted GFP as a GFP Nanobody complex. The affinity purification of GFP protein was performed using Nb CA16695 coupled to a HiTrap NHS-activated Sepharose HP column, connected to an FPLC (AktaPure-GE) system. To specifically elute GFP protein from this affinity matrix we used CA16047 Nb as the stripper.
[0264] For coupling, 1 mg (66.13 nmol) of CA16695 Nb was immobilized on a commercial HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 2 mg of GFP was loaded using a syringe on the CA16695 Nb-coupled column. The column was washed twice with 10 CVs of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected to an Akta system (GE). GFP was eluted with 8 CV of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl) containing 66.06 M of CA16047 stripper Nb (1 mg/mL) at a flow rate of 0.1 mL/min. The purification of a GFP using CA16695 Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA16047 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (GFP fluorophore absorption) (
Example 19. Purification of GST Protein Using Nb CA16240 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA16239 as a Stripper
[0265] Glutathione S-transferase (GST) is often used as a GST-tag to separate and purify proteins that contain the GST-fusion protein. This example describes the affinity purification of GST using CA16240 (SEQ ID NO: 21) as the trapper, which is a Nanobody specifically binding GST with low nanomolar affinity and CA16239 (SEQ ID NO: 20) as a low nanomolar affinity stripper.
[0266] To identify the epitope and paratope in the GSTCA16239 interaction we solved the structure of this complex by X-ray crystallography (
TABLE-US-00003 Kon (10.sup.5) Koff Half Half KD KD Nb Mutation (M.sup.1 .Math. s.sup.1) (10.sup.3) (s.sup.1) time time ratio (nM) ratio CA16239 Wt 7.20 3.09 224.27 s 1 4.86 1 CA16240 Y109A 5.12 251 2.67 s 84 659 135.6
[0267] Based on the structure GSTCA16239, one residue (Y109) of the stripper (CA16239) was mutated to Alanine (Y109A) to produce a trapper designated CA16240. [0268] BLI assays identified the affinity (K.sub.D) of CA16239 to be 4.9 nM, k.sub.on 7.210.sup.5 (M.sup.1.s.sup.1) and K.sub.off 3.110.sup.3 (s.sup.1) (
[0270] Next, we purified GST by Nanobody exchange chromatography (NANEX) using CA16239 and CA16240 as a stripper-trapper pair and eluted GST as a GSTNanobody complex. The affinity purification of GST protein was performed using Nb CA16240 coupled to a HiTrap NHS-activated Sepharose HP column c, connected to an FPLC (AktaPure-GE) system. To specifically elute GFP protein from this affinity matrix we used CA16239 Nb as the stripper.
[0271] For coupling, 5 mg (326.5 nmol) of CA16240 Nb was immobilized on a commercial HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 2 mg of GST protein was loaded using a syringe on the CA16240 Nb-coupled column, washed twice with 10 CV of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE), followed with 8 CVs of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl), containing 129.82 M of CA16239 stripper Nb (2 mg/mL) at a flow rate of 0.1 mL/min. The purification of a GST using CA16240 Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA16239 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) (
Example 20. Purification of SMT3 Protein Using Nb CA16687 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA15839 as a Stripper
[0272] Ubiquitin-like protein SMT3 (is the yeast SUMO protein, smt3) is often used as a smt3-tag to separate and purify proteins that contain the smt-3-fusion protein.
[0273] This example describes the affinity purification of SMT3 using CA16687 (SEQ ID NO: 24) as the trapper, which is a Nanobody specifically binding SMT3 with low nanomolar affinity and CA15839 (SEQ ID NO: 25) as a low nanomolar affinity stripper. To identify the epitope and paratope in the SMT3CA15839 interaction we solved the structure of this complex by X-ray crystallography (
[0274] Based on the structure of SMT3CA15839, we also identified one key residue (Asp50) in the paratope of the SMT3-specific Nb to be mutated aiming to decrease the affinity of CA15839 (
TABLE-US-00004 Kon (10.sup.5) Koff Half Half KD KD Nb Mutation (M.sup.1 .Math. s.sup.1) (10.sup.3) (s.sup.1) time time ratio (nM) ratio CA15839 Wt 3.18 2.12 5.45 min 1 6.67 1 CA16687 D50A 3.87 7.97 1.45 min 3.75 29 4.34
[0275] Based on the structure of SMT3CA15839, one residue (Asp50) of the stripper (CA15839) was mutated to Alanine (D50A) to produce a trapper designated CA16687. [0276] BLI assays identified the affinity (KD) of CA15839 to be 6.7 nM, kon 3.2105 (M.sup.1.s.sup.1) and K.sub.off 2.1103 (s.sup.1) (
[0278] Next, purified SMT3 by Nanobody exchange chromatography (NANEX) using CA15839 and CA16687 as a stripper-trapper pair and eluted SMT3 as a SMT3Nanobody complex. The affinity purification of SMT3 protein was performed using Nb CA16687 coupled to a HiTrap NHS-activated Sepharose HP column coupled with, connected to an FPLC (Akta Pure-GE) system. To specifically elute SMT3 protein from this affinity matrix we used CA15839 Nb as the stripper.
[0279] For coupling, 1 mg (69.58 nmol) of CA16687 Nb was immobilized on a HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 2 mg of SMT3 protein was loaded using a syringe on the CA16687 Nb-coupled column, washed twice with 10 CV of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE), followed with 8 CVs of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl), containing 138.73 M of CA15839 stripper Nb (2 mg/mL) at a flow rate of 0.1 mL/min. The purification of a SMT3 using CA16687 Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA15839 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) (
Example 21. Purification of an mCherry-Fusion Protein Using Nb CA16964 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nbs CA17302 as a Stripper
[0280] mCherry is a member of the mFruits family of monomeric red fluorescent proteins derived from DsRed of Discosoma sea anemones. Similar to GFP, mCherry is often used to tag proteins in the cell, so they can be studied using fluorescence spectroscopy and fluorescence microscopy. This example describes the affinity purification of an mCherry-fusion protein using Nb CA16964 (SEQ ID NO: 26) as the trapper, which is a Nanobody specifically binding mCherry with low nanomolar affinity and Nb CA17302 (SEQ ID NO: 27) as a low nanomolar affinity stripper.
[0281] Nbs CA16964 and CA17302 are two unrelated Nanobodies from a different sequence family that were generated by immunization of a llama with mCherry and selected by phage display against this antigen following standard procedures (Pardon, 2014). Epitope mapping using BLI indicated that CA17302 and CA16964 compete for an overlapping epitope on mCherry and bind this fluorescent protein in a mutually exclusive manner (
TABLE-US-00005 Nb Kon (10.sup.5) (M.sup.1 .Math. s.sup.1) Koff (10.sup.3) (s.sup.1) Half time Half time ratio KD (nM) KD ratio CA17302 6.19 1.02 11.32 min 1 1.69 1 CA16964 6.94 4.36 2.65 min 4.27 6.53 3.86 [0282] BLI assays identified the affinity (K.sub.D) of CA17302 to be 1.7 nM, k.sub.on 6.210.sup.5 (M.sup.1.s.sup.1) and K.sub.off 110.sup.3 (s.sup.1). (
[0284] Next, we purified FmIH_lectin_mCherry_his (SEQ ID NO: 29), a fusion protein containing mCherry, the FmIH lectin from an uropathogenic E. coli strain and a short His-Tag by Nanobody exchange chromatography (NANEX) using Nbs CA17302 and CA16964 as a stripper-trapper pair to elute an FmIH_lectin_mCherry_hisNanobody complex. The affinity purification was performed using Nb CA16964 coupled to HiTrap NHS-activated Sepharose HP, connected to an FPLC (Akta Pure-GE) system. To specifically elute the FmIH_lectin_mCherry_his fusion protein from this affinity matrix we used CA17302 Nb as the stripper.
[0285] For coupling, 1 mg (68 nmol) of CA16964 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 50 mL of lysate (from a 2 L bacterial culture of overexpressed recombinant FmIH_lectin_mCherry_his) was loaded using a syringe on the CA16964 Nb-coupled column, washed twice with 10 CVs of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl). The column was then connected on the Akta system (GE), followed with 8 CVs of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl), containing 65.5 M of CA17302 stripper Nb (1 mg/mL) at a flow rate of 0.1 mL/min. The purification of a FmIH_lectin_mCherry_his using CA16964 Nb as an immobilized trapper and CA17302 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) (
Example 22. Purification of an mCherry-Fusion Protein Using Nb CA17341 as an Immobilized Trapper on HiTrap NHS-Activated Sepharose HP Columns and Nb CA17302 as a Stripper
[0286] This example describes the affinity purification of the FmIH_lectin_mCherry_his fusion protein using Nb CA17341 (SEQ ID NO: 28) as the trapper, which is a Nanobody specifically binding mCherry with low nanomolar affinity and Nb CA17302 (SEQ ID NO: 27) as a low nanomolar affinity stripper. Nb CA17341 was obtained starting from Nb CA17302 by performing an alanine scan on the CDR3 of Nb CA17302. Mutating Ile101 to an alanine allowed us to convert a stripper to a trapper without any a priori structural information on the Nbantigen interactions. CA17341 was further characterized in BLI (
TABLE-US-00006 Kon (10.sup.5) Koff Half Half KD KD Nb Mutation (M.sup.1 .Math. s.sup.1) (10.sup.3) (s.sup.1) time time ratio (nM) ratio CA17902 Wt 6.19 1.02 11.32 min 1 1.69 1 CA17341 I101A 6.01 2.31 5 min 2.26 4.05 2.4 [0287] BLI assays identified the affinity (K.sub.D) of CA17302 to be 1.7 nM, k.sub.on 6.210.sup.5 (M.sup.1.s.sup.1) and K.sub.off 110.sup.3 (s.sup.1). (
[0289] Next, we purified the FmIH_lectin_mCherry_his fusion protein by Nanobody exchange chromatography (NANEX) using Nb CA17341 and Nb CA17302 as the stripper-trapper pair and eluted the target as a FmIH_lectin_mCherry_hisNanobody complex. The affinity purification was performed with Nb CA17341 immobilised on a HiTrap NHS-activated Sepharose HP column, that was connected to an FPLC (AktaPure-GE) system. To specifically elute the FmIH_lectin_mCherry_his fusion protein from this affinity matrix we used CA17302 Nb as the stripper.
[0290] For coupling, 1 mg (65.69 nmol) of CA17341 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 50 mL of a cell lysate (harvested from a 2 L culture of E. coli overexpressing the FmIH_lectin_mCherry_his fusion protein) was loaded on the CA16964 Nb-coupled column. The column was washed twice with 10 CVs of washing buffer (100 mM Hepes pH7.5, 150 mM NaCl) and connected on the Akta system (GE). The fusion protein was next eluted from this column with 8 CVs of elution buffer (100 mM Hepes pH7.5, 150 mM NaCl), containg 65.5 M of CA17302 stripper Nb (1 mg/mL) at a flow rate of 0.1 mL/min. The purification of a FmIH_lectin_mCherry_his using CA17341 Nb as an immobilized trapper on HiTrap NHS-activated Sepharose HP column and CA17302 as a stripper was monitored by measuring the absorbance at 280 nm (Protein absorption) and at 585 nm (mCherry absorption) (
Example 23: Purification of Native Human Coagulation Factor IX Using Nb CA11143 as an Immobilized Trapper on a HiTrap NHS-Activated Sepharose HP, and MegaBody CA16383 (an Engineered Antigen Binding Protein Derived from Nb CA14208) as the Stripper
[0291] The concept of Nanobody exchange chromatography (NANEX) is not restricted to the use of Nanobodies as strippers and or trappers, respectively. In fact, any pair of proteins that competes for the binding to the same epitope of the target can be used to purify this target following the principle of NANEX: antibodies, megabodies, darpins, synthetic binding proteins, . . . In this Example, we show that a Nanobody can be used in combination with a MegaBody to purify human coagulation factor IX following the principle of NANEX. A Mega Body is an engineered antigen binding protein that is obtained by grafting Nanobodies onto selected protein scaffolds to increase their molecular weight while retaining the full antigen binding specificity and affinity, as previously described. This example is similar to example 16 except that we used a MegaBody (CA16383) derived from Nb CA14208 as the stripper. In this way, we used NANEX to purify a native protein from its natural source (human blood) to purify native human coagulation factor IX from human plasma in complex with a MegaBody, ready for structural characterization by cryo-EM.
[0292] More specific, this example describes the affinity purification of human coagulation factor IX from human recovered plasma treated with ACD anti-coagulant using immobilized Nanobody CA11143 (SEQ ID NO: 31) as the trapper, and Mega Body CA16383 (SEQ ID NO: 30) as a stripper.
[0293] For coupling, 3.7 mg (250.97 nmol) of CA11143 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 30 mL of human recovered plasma treated with ACD anticoagulant (Tebu-Bio, SER-PLE200ML-ACD) was loaded on the CA11143 Nb-coupled column by recirculation for 120 minutes using a peristaltic pump. Next, the column was washed with 15 CVs of washing buffer (20 mM Hepes pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2) The column was then connected onto an Akta system (GE), and factor IX was eluted with 1 mL of buffer (20 mM Hepes pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2) containing 9.92 M of Mega Body CA16383 that was used as the stripper at a flow rate of 0.05 mL/min. The purification process was monitored by measuring the absorbance at 280 nm (Protein absorption) (
Example 24: Purification of Native Human Coagulation Factor IX Using MegaBody CA16388, as an Immobilized Trapper on a HiTrap NHS-Activated Sepharose HP, and Nb CA16383, a Functionalized Nanobody (MegaBody Mb.SUB.CA10309..SUP.YgjK.), as a Stripper
[0294] As shown under example 23, Nanobodies can be used as a trapper in combination with a MegaBody to strip targets from the functionalized resin. In example 24 we used a MegaBody as the trapper in combination with another MegaBody as the stripper to purify the human coagulation factor IX from human blood serum. To proof this principle, we performed NANEX experiments to purify native human coagulation factor IX from human plasma treated with ACD anti-coagulant usingMegaBody CA16388 as the trapper end MegaBody CA16383 as the stripper to purify human coagulation factor IX in complex with MegaBody CA16383 by NANEX.
[0295] For coupling, 1.1 mg (10.87 nmol) of MegaBody CA16388 was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. 30 mL of human recovered plasma treated with ACD anticoagulant (Tebu-Bio, SER-PLE200ML-ACD) was loaded on the CA16388 Nb-coupled column by recirculation for 60 minutes using a peristaltic pump the column was washed with 15 CVs of washing buffer (20 mM Hepes pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2). The washed column was then connected on the Akta system (GE), and factor IX was eluted with 1 mL of buffer (20 mM Hepes pH 8.0, 150 mM NaCl, 5 mM CaCl.sub.2) containing 9.92 M of Mega Body CA16383 stripper as the stripper at a flow rate of 0.05 mL/min. The purification process was monitored by measuring the absorbance at 280 nm (Protein absorption) (
Example 25. Purification of the Human GFP-Tagged Glucocorticoid Receptor (GFP-GR) in Complex with its Native Molecular Chaperones from a HEK293T Cell Lysate Using Nb CA15816 as an Immobilized Trapper on a HiTrap NHS-Activated Sepharose HP, and Nb CA12670 as a Stripper
[0296] As the NANEX technology does not require high salt concentrations or extreme pH conditions for elution and can be performed entirely under native conditions (pH, buffer composition, temperature, . . . ) this method is also applicable for the purification of (transient) protein-protein complexes from native sources. To proof this principle, we tagged the human glucocorticoid receptor (GR) with GFP, expressed this fusion protein in a human cell line and purified the receptor in complex with its molecular chaperones Hsp70 and Hsp90 (heat shock proteins). It is known from literature that, apo-GR is predominantly cytoplasmic and associated with heat shock proteins and immunophilins in the so-called foldosome in its resting state (Pratt et al., 1997). Accordingly, we purified the eGFP-tagged recombinant human glucocorticoid receptor (SEQ ID NO: 34) in complex with Hsp70 and Hsp90 from human HEK293T cells using CA15816 (SEQ ID NO: 3) as an immobilized trapper (medium-affinity trapper for GFP) on a HiTrap NHS-activated Sepharose HP column, and Nb CA12670 (SEQ ID: 1) as a high-affinity stripper for the GFP-tagged GR receptor in association with its molecular chaperones.
[0297] For coupling, 1 mg (66.955 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations. Recombinant human eGFP-6His-TEV-GR was expressed using a pcDNA3.1+N-eGFP vector transfected into human HEK239T cells grown in 15021 mm dishes (Nunclon Delta) using X-tremeGENE 9 DNA Transfection Reagent (XTG9-RO Roche) for transient expression. After transfection, HEK239T cells were grown for 48 h at 37 C., 5% CO.sub.2. Cells from 3 plates were collected by pipetting and centrifugation, washed with PBS and resuspended in 10 mL lysis buffer containing 10 mM Na-Phosphate pH8, 5 mM DTT, 0.1 mM EDTA, 10 mM Na.sub.2MoO.sub.4, 10% Glycerol (supplemented with protease inhibitors) before lysis using a Dounce homogenizer. The lysate was clarified by centrifugation and the supernatant was collected, filtered (0.45 m filter) and loaded onto a HiTrap NHS-activated Sepharose HP column coated with CA15816 Nb using a syringe. 10 CVs of washing buffer (50 mM Hepes pH7.5, 150 mM NaCl) were applied on the column using a syringe. The affinity column was then connected to an FPLC (AktaPure-GE) system and the foldosome was eluted with 1 mL containing 66.7 M CA15816 Nb stripper (1 mg/mL) in 50 mM Hepes pH7.5, 150 mM NaCl at a flowrate flow rate 0.1 mL/min. Regeneration of the column was obtained using 5 CVs of 200 mM Glycine buffer pH 2.3. The purification process was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (eGFP) (
Example 26. Purification of the Recombinant Human GFP-Tagged Androgen Receptor (GFP-ARb) in Complex with Molecular Chaperones from HEK293T Cells Lysate Using Nb CA15816 as an Immobilized Trapper on a HiTrap NHS-Activated Sepharose HP, and Nb CA12670 as a Stripper
[0298] As demonstrated in example 25, NANEX can also be used to purify (transient) protein complexes. To further substantiate this principle, we also purified the human androgen receptor from HEK293T cells in complex with its molecular chaperones Hsp70 and Hsp90 and immunophilins in the so-called foldosome (Pratt et al., 1997).
[0299] This example describes the NANEX purification of the eGFP-tagged recombinant human androgen receptor (SEQ ID NO: 35) in complex with Hsp70 and Hsp90 from human HEK293T cells lysate using CA15816 (SEQ ID NO: 3) as an immobilized trapper (medium-affinity trapper for GFP), and Nb CA12670 (SEQ ID: 1) as a stripper (high-affinity stripper for GFP).
[0300] For coupling, 1 mg (66.955 nmol) of CA15816 Nb was immobilized on HiTrap NHS-activated Sepharose HP column (1 mL; GE) following the supplier's recommendations.
[0301] Recombinant human eGFP-6His-TEV-AR was expressed using a pcDNA3.1+N-eGFP vector transfected into human HEK239T cells. Cells were transfected in 15021 mm dishes (Nunclon Delta) using X-tremeGENE 9 DNA Transfection Reagent (XTG9-RO Roche) with a ratio 3:1 L/g DNA. After transfection, HEK239T cells were grown for 48 h at 37 C. and 5% CO.sub.2. Cells from 3 plates were collected by pipetting and centrifugation, washed with PBS and resuspended in 10 mL lysis buffer 10 mM Hepes 7.5, 2.5 mM DTT, 1 mM EDTA, 20 mM Na.sub.2MoO.sub.4, 10% Glycerol (supplemented with protease inhibitors) before lysis using a Dounce homogenizer. The lysate was clarified by centrifugation and the supernatant was collected, filtered (0.45 m filter) and loaded on a HiTrap NHS-activated Sepharose HP column coated with CA15816 Nb using a syringe. Next, the column was washed with 10 CVs of washing buffer (10 mM Hepes 7.5, 2.5 mM DTT, 1 mM EDTA, 20 mM Na.sub.2MoO.sub.4, 10% Glycerol) using a syringe. The affinity column was then connected to an FPLC (AktaPure-GE) system for elution with 1 mL of elution buffer containing 66.7 M CA15816 Nb stripper (1 mg/mL) in 10 mM Hepes 7.5, 2.5 mM DTT, 1 mM EDTA, 20 mM Na.sub.2MoO.sub.4, 10% Glycerol at a flowrate flow rate 0.1 mL/min for 6 m L (6 CVs). Regeneration of the column was obtained by 5 CVs of 200 mM Glycine buffer pH 2.3. The purification process was monitored by measuring the absorbance at 280 nm (Protein absorption) and 488 nm (eGFP absorption) (
Example 27. High-Throughput Nanobody Exchange Chromatography (NANEX) Purification of Diverse GFP-Tagged Fusion Proteins from Yeast (S. cerevisae) Cell Lysates Using Nb CA15816 as an Immobilized Trapper on Magnetic, Tosyl-Activated Dynabeads, and Nb CA12760 as a Stripper
[0302] Nanobody exchange chromatography (NANEX) is not limited to the purification of proteins on beads packed in columns to mix, and separate solid phases from liquid phases. In example 27 we use magnetic beads in combination with a magnet to mix and exchange solids and liquids in an automated high-throughput setup to purify 12 different proteins in parallel on a KingFisher Flex (ThermoFisher) instrument in standard 96-well plates.
[0303] For this experiment, a set of 12 yeast clones was chosen from the yeast GFP clone collection (Huh et al., 2003). Each clone is expressing a different protein as a fusion with GFP and can therefore be purified by NANEX using as a trapper Nb CA15816 and Nb CA12760 as the stripper.
[0304] The 96 well format can be used to grow small cultures (1 mL) of yeast cells and offers the possibility to transform, transfect, induce or lyse different cell lines in parallel. This enables fast and high-throughput processes for downstream applications such as protein expression, protein purification, ELISAs, functional assays.
[0305] To proof the feasibility of this principle, we performed a NANEX experiment to purify 12 different yeast proteins, expressed in 1 mL cultures, lysed, and purified in parallel in standard 96 well plates. As the solid support, we used tosyl-activated Dynabeads and coated them with Nb CA15816 (SEQ ID: 3) as a trapper. The purification process was performed in 96-well plates on a KingFisher Flex (ThermoFisher) instrument, including the elution step using Nb CA12760 (SEQ ID: 1) as a stripper.
[0306] Given that these clones are not overexpressed but produced at their physiological expression levels, we were able to select house-keeping yeast proteins that are expressed at high levels but also proteins that are expressed at low levels in living cells (
[0307] A selected set of 12 clones expressing GFP-tagged proteins at different levels (
Example 28. Purification of GFP by Nanobody Exchange Chromatography Using Nb CA15816 as an Immobilized Trapper on Magnetic NHS-Activated Agarose Beads Packed in a Sub-Microliter (<1 L) Microfluidic Column Using Nb CA12760 as a Stripper
[0308] High-throughput applications in proteomics and single cell research (amongst others) require protein purification methods that require small devices (downscaling) to separate proteins from small samples. Example 28 illustrates how we designed a microfluidic chip for downscaling our NANEX technology to sub-microliter column volumes (<1 L) and decreasing the amount of (immobilized) trapper and the amount of stripper required to purify proteins of interest from small samples.
[0309] For the purification of GFP on a -fluidics device, we covalently immobilized the trapper Nb CA15816 (see example 1) on 50 l of commercial magnetic NHS-Activated agarose beads (30 m diameter, Cube Biotech) following the supplier's recommendations. 0.7 l of these agarose beads was packed into the small chamber (<1 L) of a custom-made microfluidic chip detailed in
[0310] This CA15816 Nb-coupled microfluidic column (0.7 l CV) was first washed with 50 l (70 CVs) of washing buffer (PBS) at a flow rate of 10 L/min. Then, 40 l of a sample containing the GFP (25 mM Hepes pH7.4, 150 mM NaCl, GFP (0.12 mg/mL)) was injected at 10 L/min. Next, 90 l of washing buffer (PBS) was passed over the column at 10 L/min to remove unbound material. Next, the affinity-trapped GFP was eluted from the -fluidic device by applying 52 l (74 CV) of elution buffer containing the stripper (25 mM HEPES pH7.4, 150 mM NaCl, 26 g stripper Nb CA12760 (0.5 mg/mL)). After washing with 80 l washing buffer, regeneration of the column was obtained by injecting 50 l of the glycine buffer (200 mM glycine buffer pH2.3 at 10 L/min). The trapping of GFP on the -column using Nb CA15816, the stripping of GFP by Nb CA12760 from the -column and the regeneration of the -column with glycine was monitored using an inverted fluorescence microscope (Olympus IX71 model IX71S1F-3) (
Nanobody Expression and Purification
[0311] Nanobodies containing a C-terminal His6-tag followed by the EPEA-tag were routinely expressed in and purified from the periplasm of E.coli strain WK6 (Pardon et al., 2014).
[0312] Sequence Listing
TABLE-US-00007 >SEQIDNO:1: CA12760GFP-Nb207 (includingC-terminal6xHis+EPEAtag) >SEQIDNO:2: CA15818GFP-NbF103A (mutatedresidueinboldunderlined; C-term.6xHis+EPEA) QVQLVESGGGLVQAGGSLRLSCAASGRTFSTAAMGWFRQAP GKERDFVAGIYWTVGSTYYADSAKGRFTISRDNAKNTVYLQ MDSLKPEDTAVYYCAARRRGATLAPTRANEYDYWGQGTQVT VSSHHHHHHEPEA >SEQIDNO:3: CA15816GFP-NbT54A/V55A (mutatedresidueinboldunderlined; C-term.6xHis+EPEA) QVQLVESGGGLVQAGGSLRLSCAASGRTFSTAAMGWFRQAP GKERDFVAGIYWAAGSTYYADSAKGRFTISRDNAKNTVYLQ MDSLKPEDTAVYYCAARRRGFTLAPTRANEYDYWGQGTQVT VSSHHHHHHEPEA >SEQIDNO:4: CA15861GFP-NbT54A/V55A/F103A (mutatedresidueinboldunderlined; C-term.6xHis+EPEA) QVQLVESGGGLVQAGGSLRLSCAASGRTFSTAAMGWFRQAP GKERDFVAGIYWAAGSTYYADSAKGRFTISRDNAKNTVYLQ MDSLKPEDTAVYYCAARRRGATLAPTRANEYDYWGQGTQVT VSSHHHHHHEPEA [0313] SEQ ID NO: 5: CA15621 Mb.sub.Nb207.sup.cHopQ (C-term. 6xHis) [0314] SEQ ID NO: 6: CA15616 Mb.sub.Nb207.sup.YgjK (C-term. 6xHis) [0315] SEQ ID NO: 7: CA4375, EPEA-NbSyn2 (C-term. 6xHis) [0316] SEQ ID NO: 8: CA4394, bivalent EPEA-NbSyn2 EPEA (C-term. 6xHis) [0317] SEQ ID NO: 9: CA13016 Synaptojanin-specific Nb (trapper; C-term. 6xHis+EPEA) [0318] SEQ ID NO: 10: CA13080 Synaptojanin-specific Nb (Stripper; C-term. 6xHis+EPEA) [0319] SEQ ID NO: 11: CA11138 FIXa-specific Nb (Trapped; C-term. 6xHis+EPEA) [0320] SEQ ID NO: 12: CA10304 FIXa-specific Nb (Stripped; C-term. 6xHis+EPEA) [0321] SEQ ID NO: 13: CA10502 FIXa-specific Nb (Trapper2; C-term. 6xHis+EPEA) [0322] SEQ ID NO: 14: CA10309 FIXa-specific Nb (Stripper2; C-term. 6xHis+EPEA) [0323] SEQ ID NO: 15: CA14208 FIXa-specific MegaBody Mb.sub.NbFIXa.sup.cHopQ (Stripper2; C-term. 6xHis+EPEA) [0324] SEQ ID NO: 16: GFP protein [0325] SEQ ID NO: 17: Helicobacter pylori strain G27 HopQ adhesin domain protein (PDB 5LP2) [0326] SEQ ID NO: 18: CA16047 second GFP Nanobody stripper (including C-terminal 6xHis+EPEA tag) [0327] SEQ ID NO: 19: CA16695 second GFP Nanobody trapper (Y119F) (including C-terminal 6xHis+EPEA tag) [0328] SEQ ID NO: 20: CA16239 GST Nanobody stripper (including C-terminal 6xHis+EPEA tag) [0329] SEQ ID NO: 21: CA16240 GST Nanobody trapper (Y109A) (including C-terminal 6xHis+EPEA tag) [0330] SEQ ID NO: 22: GST (Glutathione 5-transferase) [0331] SEQ ID NO: 23: CA15839 SMT3 Nanobody stripper (including C-terminal 6xHis+EPEA tag) [0332] SEQ ID NO: 24: CA16687 SMT3 Nanobody trapper (D50A) (including C-terminal 6xHis+EPEA tag) [0333] SEQ ID NO: 25: SMT3 (YDR510W) [0334] SEQ ID NO: 26: CA16964 mCherry Nanobody trapper (including C-terminal 6xHis+EPEA tag) [0335] SEQ ID NO: 27: CA17302 mCherry Nanobody stripper (including C-terminal 6xHis+EPEA tag) [0336] SEQ ID NO: 28: CA17341 mCherry Nanobody trapper (CA17302 mutant 1103A) (including C-terminal 6xHis+EPEA tag) [0337] SEQ ID NO: 29: mCherry (FmIH_lectin_mCherry_his) (CA17337) [0338] SEQ ID NO: 30 CA16383 FIX functionalized Nanobody stripper (MegaBody Mb.sub.CA10309.sup.YgjK, including C-terminal 6xHis+EPEA tag) [0339] SEQ ID NO: 31: CA11143 FIX Nanobody trapper (including C-terminal 6xHis+EPEA tag) [0340] SEQ ID NO: 32: E. coli Ygjk protein (PDB 3WFS) [0341] SEQ ID NO: 33: CA16388 FIX functionalized Nanobody trapper (MegaBody Mb.sub.CA11143.sup.YgjK, including C-terminal 6xHis+EPEA tag) [0342] SEQ ID NO: 34 CA16607 eGFP-tagged human recombinant glucocorticoid receptor P04150 (eGFP-6His-TEV-GR) [0343] SEQ ID NO: 35: CA16976 eGFP-tagged human recombinant androgen receptor P10275 (eGFP-6His-TEV-ARb)
Aspects of the disclosure
[0344] A method for purification of a target protein comprising the steps of: [0345] mixing a first protein binding agent specifically binding an epitope of a target protein with a sample containing said target protein, [0346] adding to said mix of a) a second protein binding agent, recognizing the same or largely overlapping epitope of said target protein as the first binding agent, to displace the first binding agent from the target protein by specifically binding the target protein, and [0347] collecting the eluting second protein binding agent in complex with the target protein,
wherein the second protein binding agent comprises an immunoglobulin single variable domain (ISVD) or an active fragment thereof that specifically binds the epitope, and
wherein the rate constant of dissociation (k.sub.off value) of the second protein binding agent is lower as compared to the k.sub.off value of the first binding agent.
[0348] Said method as described herein, wherein the second protein binding agent has an equal or higher affinity for the epitope, as compared to the first protein binding agent.
[0349] Said method as described herein, wherein the K.sub.D value for the epitope of the target protein is in the range of 1 M to 1 nM for the first protein binding agent and in the range of 1 nM to 1 pM for the second protein binding agent.
[0350] Said method as described herein, wherein the K.sub.D value of the first protein binding agent is 200-5000-fold higher as compared to the K.sub.D value of the second protein binding agent.
[0351] Said method as any of the methods described herein, wherein the first protein binding agent is immobilized, and the second protein binding agent is in solution.
[0352] Said method as any of the methods described herein, wherein the second protein binding agent comprises a functional moiety or a detectable label.
[0353] Said method as any of the methods described herein, wherein the sample is a biological sample, a complex mixture, a cellular sample, or an in vitro sample.
[0354] Said method as any of the methods described herein, wherein the epitope of the target protein comprises a tag, preferably wherein said tag is selected from the group of GFP, GST, SUMO, Ubiquitin, and EPEA.
[0355] Said method as any of the methods described herein, wherein the epitope of the target protein comprises a specific epitope present on a native or endogenous protein.
[0356] Said method as any of the methods described herein, wherein the epitope of the target protein comprises a protein binding site on a scaffold protein domain of a MegaBody, preferably said scaffold protein domain comprising HopQ or Ygjk.
[0357] Said method as any of the methods described herein, wherein the first protein binding agent is a mutant of the second protein binding agent, with a lower affinity as compared to the second protein binding agent.
[0358] Said method as any of the methods described herein, wherein the first protein binding agent comprises an ISVD or an active fragment thereof specifically binding the epitope.
[0359] Said method as any of the methods described herein, wherein the ISVD comprises 4 Framework regions (FR) and 3 complementary determining regions (CDR) according to the format of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
[0360] Said method of any of the methods described herein, wherein the second protein binding agent is a multivalent form of the first protein binding agent.
[0361] Said method of any of the methods described herein, wherein the second protein binding agent is an antigen-binding chimeric protein, in particular a MegaBody, comprising an ISVD antigen-binding domain specifically binding the epitope and a scaffold protein, preferably a scaffold protein comprising HopQ, Ygjk, or derivatives thereof.
[0362] A kit comprising the first and second protein binding agent of the method of any of the methods described herein.
[0363] Sad kit, wherein the first protein binding agent is immobilized on a surface.
[0364] The kit as described herein , comprising a first and second protein binding agent selected from the group of protein depicted in SEQ ID NO: 1 to 6, or a sequence with at least 70% amino acid identity thereof, wherein the first and second binding agent specifically bind an epitope of GFP.
[0365] The method for purification of a target protein, as any of the methods described herein , further comprising the steps of: repeating the steps of the method as any of the methods described herein, using a 3.sup.rd and 4.sup.th protein binding agent instead of the 1.sup.st and 2.sup.nd protein binding agents, respectively, wherein said 3.sup.rd and 4.sup.th binding agent specifically bind a different epitope of said target protein as compared to the epitope for the 1.sup.st and 2.sup.nd binding agent, and
wherein the 4.sup.th protein binding agent has a rate constant of dissociation (k.sub.off value) that is lower as compared to the k.sub.off value of the 3.sup.rd protein binding agent.
[0366] A protein complex comprising the second protein binding agent of said method as described herein, or the 4.sup.th protein binding agent of the method described herein, and the target protein.
[0367] Said protein complex, wherein the target protein comprises a tag selected from the group of GFP, GST, SUMO, Ubiquitin, and EPEA.
[0368] Said protein complex, which is crystalline.
[0369] Use of any of said protein complexes, for structural analysis, structure-based drug design, mass-spectrometry analysis, or proteomics.
[0370] A three-dimensional structural representation at atomic resolution of the protein complex as described herein, with a resolution corresponding to 0.1 to 3 .
[0371] A crystal comprising the protein complex as described herein, comprising GFP as target protein and GFP-specific Nanobody as second protein binding agent, wherein GFP is depicted in SEQ ID NO: 16 or a sequence with at least 90% identity thereof, and GFP-specific Nanobody is depicted in SEQ ID NO: 1, or a sequence with at least 90% identity thereof, further characterized in that the crystal is in the space group P212121, with the following crystal lattice constants: a=74.497 5%, b=103.450 5%, c=209.774 5%, =90, =90, =90.
[0372] A binding site, consisting of a subset of atomic coordinates, present in the crystal described herein, wherein said binding site consists of the amino acid residues: Pro89, Glu90, Glu111, Lys113, Phe114, Glu115, and Glyl16 of the GFP protein as depicted in SEQ ID NO: 16.
REFERENCES
[0373] Abdiche et al. (2017). Antibodies Targeting Closely Adjacent or Minimally Overlapping Epitopes Can Displace One Another. PLOS ONE, doi:10.1371/journal.pone.0169535. [0374] Aliprandi et al. (2010). The availability of a recombinant anti-SNAP antibody in VHH format amplifies the application flexibility of SNAP-tagged proteins. J Biomed Biotechnol, ID 658954.
[0375] Caljon et al. (2015). Description of a Nanobody-based Competitive Immunoassay to Detect Tsetse Fly Exposure. PLOS Neglected Tropical Diseases. doi:10.1371/journal.pntd.0003456. [0376] Capture Select. http://www.captureselect.com. [0377] Gtzke et al. (2019). The ALFA-tag is a highly versatile tool for nanobody-based bioscience applications Nat.comms. 10:4403. [0378] Huh W, Falvo J V, Gerke L C, Carroll A S, Howson R W, Weissman J S, and O'Shea E K (2003) Global Analysis of Protein Localization in Budding Yeast Nature 425:686-691. [0379] Javaheri, et al. (2016). Helicobacter pylori adhesin HopQ engages in a virulence-enhancing interaction with human CEACAMs. Nature Microbiology 2, 16189. [0380] Kimple et al. (2015). Overview of Affinity Tags for Protein Purification. Curr Protoc Protein Sci.73: Unit9.9. doi:10.1002/0471140864.ps0909s73. [0381] Klooster, et al. (2007). Improved anti-IgG and HAS affinity ligands: Clinical application of VHH antibodies technology. J Immunol Meth, 324:1-12. [0382] Pabst et al. (2016). Camelid VHH affinity ligands enable separation of closely related biopharmaceuticals. Biotechnol. J. 2016, 11. [0383] Pardon, et al. (2014). A general protocol for the generation of Nanobodies for structural biology. Nature Protocols. 9: 674-693. [0384] Pratt, W. B. et al. Endocr Rev 18, 306-360 (1997). [0385] Rothbauer et al. (2008). A versatile nanotrap for biochemical and functional studies with fluorescent fusion proteins. Mol Cel Proteomics. 7:282-289. [0386] Tsien R Y (1998) The Green Fluorescent Protein. Annu Rev Biochem 67:509-544. [0387] Verheesen et al. (2003). Beneficial properties of single-domain antibody fragments for application in immunoaffinity purification and immuno-perfusion chromatography. Biochim Biophys Acta, 1624:21-28.