Bacterial endotoxin test for the determination of endotoxins
10585097 ยท 2020-03-10
Assignee
- Forschungszentrum Borstel Leibniz Lungerzentrum (Borstel, DE)
- Hoffmann-La Roche Inc. (Little Falls, NJ, US)
Inventors
- Christian Alexander (Borstel, DE)
- Sven Deutschmann (Weilheim, DE)
- Pierre Lang (Blotzheim, FR)
- Friedrich Von Wintzingerode (Penzberg, DE)
- Ulrich Zaehringer (Ahrensburg, DE)
Cpc classification
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
Abstract
Herein is reported a method for determining bacterial endotoxin at low concentrations in a sample of an antibody (that has been produced using bacterial cells) comprising the following steps in the following order: i) adding magnesium ions to the sample, ii) diluting the sample, iii) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, and iv) determining bacterial endotoxin in the sample using a bacterial endotoxin test, particularly the limulus amoebocyte lysate assay.
Claims
1. A method for preparation of a sample, wherein the sample comprises an antibody, for a limulus amoebocyte lysate (LAL) assay, wherein the method comprises the following steps in the following order: (a) adding magnesium ions, (b) diluting the sample, and (c) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, wherein the antibody is a monoclonal therapeutic antibody.
2. A method for determining bacterial endotoxin in a sample comprising an antibody exhibiting the LER effect, wherein the method comprises the following steps in the following order: (a) adding magnesium ions to the sample, (b) diluting the sample, (c) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, and (d) determining bacterial endotoxin in the sample by using a LAL assay.
3. The method of claim 1, wherein the antibody is formulated with polysorbate 80.
4. The method of claim 1, wherein the antibody is formulated with a citrate buffer.
5. The method of claim 1, wherein the antibody is formulated with 25 mM sodium citrate buffer and 700 mg/l polysorbate 80 and has a pH value of 6.5.
6. The method of claim 1, wherein the antibody is the anti-CD20 antibody rituximab.
7. The method of claim 1, wherein in step (a) magnesium ions are added to a final concentration of 2.5 to 75 mM.
8. The method of claim 1, wherein in step (b) the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer pH 6.0-9.0.
9. The method of claim 1, wherein in step (b) the sample is diluted at a ratio of 1:10.
10. The method of claim 1, wherein during dialysis in step (c) the sample has a pH-value of 6.0-8.0.
11. The method of claim 1, wherein in step (c) the dialysis takes 24 hours at room temperature.
12. The method of claim 1, wherein for the dialysis in step (c) a membrane with a molecular-weight cut-off of 10 kDa is used.
13. The method of claim 1, wherein for the dialysis in step (c) a cellulose acetate membrane is used.
14. The method of claim 1, wherein for the dialysis in step (c) the aqueous solution is changed twice.
15. The method of claim 1, further comprising the step of producing a low endotoxin recovery (LER) positive control by spiking a known amount of endotoxin into an aliquot of the sample and shaking the endotoxin spiked aliquot of the sample for 60 min to 2 hours.
16. A method for rendering a sample comprising an antibody reactive to factor C in a LAL enzymatic cascade, comprising the steps of: (a) adding magnesium ions to the sample, (b) diluting the sample, and (c) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, wherein the antibody is a monoclonal therapeutic antibody.
17. The method of claim 2, wherein the antibody is a therapeutic antibody.
18. The method of claim 2, wherein the antibody is formulated with polysorbate 80.
19. The method of claim 2, wherein the antibody is formulated with a citrate buffer.
20. The method of claim 2, wherein the antibody is formulated with 25 mM sodium citrate buffer and 700 mg/l polysorbate 80 and has a pH value of 6.5.
21. The method of claim 2, wherein the antibody is the anti-CD20 antibody rituximab.
22. The method of claim 2, wherein in step (a) magnesium ions are added to a final concentration of 25 to 75 mM.
23. The method of claim 2, wherein in step (b) the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer pH 6.0-9.0.
24. The method of claim 2, wherein in step (b) the sample is diluted at a ratio of 1:10.
25. The method of claim 2, wherein during dialysis in step (c) the sample has a pH-value of 6.0-8.0.
26. The method of claim 2, wherein in step (c) the dialysis takes 24 hours at room temperature.
27. The method of claim 2, wherein for the dialysis in step (c) a membrane with a molecular-weight cut-off of 10 kDa is used.
28. The method of claim 2, wherein for the dialysis in step (c) a cellulose acetate membrane is used.
29. The method of claim 2, wherein for the dialysis in step (c) the aqueous solution is changed twice.
30. A method for rendering a sample comprising an antibody reactive to factor C in a LAL enzymatic cascade, comprising the steps of: (a) adding magnesium ions to the sample, (b) diluting the sample, (c) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, and (d) determining bacterial endotoxin in the sample by using a LAL assay, wherein the antibody is a monoclonal therapeutic antibody.
31. The method according to claim 1, wherein said magnesium ions are MgCl.sub.2.
32. The method according to claim 2, wherein said magnesium ions are MgCl.sub.2.
33. The method according to claim 8, the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer 6.0-8.0.
34. The method according to claim 16, wherein said magnesium ions are MgCl.sub.2.
35. The method according to claim 23, wherein the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer pH 6.0-8.0.
36. The method according to claim 30, wherein said magnesium ions are MgCl.sub.2.
37. A method for preparation of a sample, Wherein the sample comprises an antibody, for a limulus amoebocyte lysate (LAL) assay, wherein the method comprises the following steps in the following order: (a) adding magnesium ions, (b) diluting the sample, (c) dialyzing the sample having a pH-value of 5.7-8.0 against an endotoxin-free aqueous solution, and (d) determining bacterial endotoxin in the sample by using a LAL assay, wherein the antibody is a therapeutic antibody.
38. The method of claim 37, wherein the antibody is formulated with polysorbate 80.
39. The method of claim 37, wherein the antibody is formulated with a citrate buffer.
40. The method of claim 37, wherein the antibody is formulated with 25 mM sodium citrate buffer and 700 mg/l polysorbate 80 and has a pH value of 6.5.
41. The method of claim 37, wherein the antibody is the anti-CD20 antibody rituximab.
42. The method of claim 37, wherein in step (a) magnesium ions are added to a final concentration of 25 to 75 mM.
43. The method of claim 37, wherein in step (b) the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer pH 6.0-9.0.
44. The method of claim 37, wherein in step (b) the sample is diluted at a ratio of 1:10.
45. The method of claim 37, wherein during dialysis in step (c) the sample has a pH-value of 6.0-8.0.
46. The method of claim 37, wherein in step (c) the dialysis takes 24 hours at room temperature.
47. The method of claim 37, wherein for the dialysis in step (c) a membrane with a molecular-weight cut-off of 10 kDa is used.
48. The method of claim 37, wherein for the dialysis in step (c) a cellulose acetate membrane is used.
49. The method of claim 37, wherein for the dialysis in step (c) the aqueous solution is changed twice.
50. The method of claim 37, further comprising the step of producing a low endotoxin recovery (LER) positive control by spiking a known amount of endotoxin into an aliquot of the sample and shaking the endotoxin spiked aliquot of the sample for 60 min to 2 hours.
51. The method according to claim 37, wherein said magnesium ions are MgCl.sub.2.
52. The method according to claim 43, the pH-value of the sample is adjusted by diluting the sample with 10-50 mM Tris/HCl buffer 6.0-8.0.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17) The following Examples are provided to aid the understanding of the present invention, the true scope of which is set forth in the appended claims. It is understood that modifications can be made in the procedures set forth without departing from the spirit of the invention.
Example 1: Technical Equipment and Reagents
(18) 1. Technical Equipment
(19) 1.1 Microplate Reader System (Herein Also Designated as Reader)
(20) Infinite 200 PRO, Multimode Microplate Reader; Tecan, Switzerland/Tecan Deutschland GmbH, Germany, P/N: 30050303. Magellan V. 7.1 Software Costar Cell Culture Plates, 96 Wells, Fisher Scientific, P/N: 07-200-89.
1.2 Shaker System and Glass Vials Multi Reax; Heidolph, Germany, P/N: 545-10000-00. 1.5 ml Screw Neck Glass Vials (N8); Macherey-Nagel GmbH & Co. KG, Germany, P/N: 702004 (Qty. of 100). N 8 PP screw cap, black, closed top; Macherey-Nagel GmbH & Co. KG, Germany, P/N: 70250 (Qty. of 100). 4 ml Screw Neck Glass Vials (N13); Macherey-Nagel GmbH & Co. KG, Germany, P/N: 702962 (Qty. of 100). N 13 PP screw cap, black, closed top; Macherey-Nagel GmbH & Co. KG, Germany, P/N: 702051 (Qty. of 100).
1.3 Dialysis Equipment SpinDIALYZER, chamber volume 1000 l; Harvard Apparatus, U.S.A., P/N 740314 (Qty. of 1) and 740306 (Qty. of 5), local distributor: Hugo Sachs Elektronik Harvard Apparatus, GmbH, Germany, P/N SP1 74-0306 (Qty. of 5). Remark: Use of Lot No: 032613. The dialyzer is a simple single-sided device for dialysis of biological samples. A broad range of dialyzer sizes are available to accommodate sample volumes ranging from 20 l to 5 ml. The catalogue Nb. for 1 ml (as used herein) is 74-0314. The MWCO of the membrane ranges from 100 to 300,000 Da. The entire unit is constructed of PTFE, a virtually unreactive material. Fast SpinDIALYZER, chamber volume 1000 l, Harvard Apparatus, U.S.A., P/N 740510 (Qty. of 1) or 740504 (Qty. of 5), Remark: Two-sided membrane system, top plus bottom membrane. The dialyzer is a reusable sample chamber made of PTFE for high sample recovery and has been redesigned to provide larger membrane surface areas for an even faster dialysis rate. The Ultra-Fast Dialyzers are of 50 l to 1500 l volume and have been used here with 1000 l. The catalogue Nb. for 1 ml (as used herein) is 74-0412. Cellulose acetate membranes, 500 Da MWCO, Harvard Apparatus, U.S.A., P/N: SP1 7425-CA500, local distributor: Hugo Sachs Elektronik Harvard Apparatus GmbH, Germany, P/N: SP1 7425-CA500. Cellulose acetate membranes, 10 kDa MWCO, Harvard Apparatus, U.S.A., P/N: SP1 7425-CA10K, local distributor: Hugo Sachs Elektronik Harvard Apparatus GmbH, Germany, P/N: SP1 7425-CA10K. Remark: Tested in addition to the standard 500 Da MWCO membranes in LER investigations on Rituximab as well as in the LER experiments on NeoRecormon. Cellulose acetate membranes, 25 kDa MWCO, Harvard Apparatus, U.S.A., P/N:SP1 7425-CA25K, local distributor: Hugo Sachs Elektronik Harvard Apparatus GmbH, Germany, P/N: SP1 7425-CA25K. Remark: Tested in addition to the standard 500 Da MWCO membranes in LER investigations on Rituximab as well as in the LER experiments on NeoRecormon. Aqua B. Braun, sterile pyrogen-free water, 1 l, B. Braun Melsungen AG, Germany, P/N: 14090586. Crystallizing Dishes, 900 ml, OMNILAB, Germany, P/N: 5144008. (Remark: Use for rinsing of dialysis membranes) DURAN Beakers, tall form, 2000 ml, OMNILAB, Germany, P/N: 5013163. DURAN Beakers, tall form, 250 ml, OMNILAB, Germany, P/N: 5013136.
1.4 Routine Laboratory Equipments Autoclaving System (Remark: Use for sterilisation of dialyses chambers) epT.I.P.S. LoRetention-Reloads, PCR clean, 0.5-10 l, Eppendorf, Germany, P/N: 0030072.057 epT.I.P.S. LoRetention-Reloads, PCR clean, 2-200 l, Eppendorf, Germany, P/N: 0030072.022 epT.I.P.S. LoRetention-Reloads, PCR clean, 50-1000 l, Eppendorf, Germany, P/N: 0030072.030 Stripettes, Individual, 5 ml, Paper/Plastic Wrap, Fisher Scientific, P/N: 10420201.
2. Reagents
2.1 Kinetic Chromogenic LAL Assays and LAL-Associated Reagents Kinetic-QCL Kit; Lonza, Switzerland, P/N: 50-650U or 50-650H (i.e. Lonza kit). CHROMOLAL von Associates of Cape Cod (AAC) Inc., USA, P/N: C0031-5 (i.e. ACC kit). Endotoxin E. coli O55:B5 for K-QCL; Lonza, Switzerland, P/N: E50-643. Endotoxin E. coli O55:B5, 2.5 mg/vial; Lonza, Switzerland, P/N: N185. LAL Reagent Water100 ml; Lonza, Switzerland, P/N: W50-100. MgCl.sub.2, 10 mM solution for use with LAL, 30 ml vial; Lonza, Switzerland, P/N: S50-641. Magnesium chloride hexahydrate for analysis EMSURE ACS, ISO, Reag. Ph. Eur., 250 g; Merck, Germany, P/N: 1.05833.0250. Tris buffer, 50 mM solution for use with LAL, 30 ml vial; Lonza, Switzerland, P/N: S50-642.
2.2 Protein Reagents Albumin bovine Fraction V, very low endotoxin, fatty acid free, 25 g; Serva, Germany, P/N: 47299.04. Albumin, human serum, fraction V, high purity; 1 g; Merck, Germany, P/N: 126658-1GM.
3. Tested Pharmaceuticals
(21) For the herein described Examples, Rituximab (which comprises) and NeoRecormon (which comprises epoetin-beta) were used. In addition, the respective placebos of Rituximab and NeoRecormon were also applied in the herein described methods.
(22) The placebo of the respective sample is identical to the sample except for the absence of the active therapeutic ingredient, i.e. rituximab placebo does not contain rituximab but all other component of the formulation.
Example 2: Methods of the Invention for Overcoming the LER Effect
Example 2.1: Protocol for Overcoming the LER Effect
(23) In this Example rituximab and rituximab placebo were used as sample. However, as discussed below, the herein described protocol is useful for overcoming the LER in all typical formulations of pharmaceutical antibodies.
(24) Materials Used for this Example
(25) Membranes: 10 kDa cellulose acetate (CA) membranes from Harvard Apparatus, U.S.A., P/N:SP1 7425-CA10K
(26) Dialyzer: FastSpinDIALYZER, chamber volume 1000 l, Harvard Apparatus, U.S.A., P/N 740510 (Qty. of 1) or 740504 (Qty. of 5)
(27) Sample Vials: 1.5 ml Screw Neck Glass Vials (N8); Macherey-Nagel GmbH & Co. KG, Germany, P/N: 702004 N 8 PP screw cap, black, closed top; Macherey-Nagel GmbH & Co. KG, Germany, P/N: 70250
(28) Crystallizing Dishes: 900 ml, Duran, VWR Germany, P/N: 216-1817
(29) MgCl.sub.2 Stock Solution: 1M MgCl.sub.2 dissolved in water (Magnesium chloride hexahydrate for analysis EMSURE ACS, ISO, Reag. Ph. Eur., 250 g; Merck, Germany, P/N: 1.05833.0250) Tris-Buffer, 50 mM solution for use with LAL (i.e. endotoxin-free), 30 ml vial; Lonza, Switzerland, P/N: S50-642
(30) Samples: rituximab placebo and LAL water
Step by Step Protocol:
Step 1: Preparation of the Samples 1rituximab placebo 900 l+100 l LAL water 1rituximab placebo 900 l+100 l CSE conc. 50 EU/ml=final conc. 5.0 EU/ml 1LAL water 1000 l 1LAL water 900 l+100 l CSE conc. 50 EU/ml=final conc. 5.0 EU/ml Shake the samples 60 min at RT (room temperature) [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm)],
Step 2: Washing of Dialysis Membrane Use ten 10 kDa cellulose acetate (CA) membranes and put them into the crystallizing dish with 300 ml Aqua Braun (i.e. distilled water of the manufacturer B. Braun, Melsungen) Shake them for 1 h (Shaker SG 20. IDL GmbH, Germany or equivalent, 50 to 300 rpm, preferably 100 rpm) Transfer the membranes into an new crystallizing dish with fresh Aqua Braun (also 300 ml) Shake them for 1 h (Shaker SG 20. IDL GmbH, Germany or equivalent, 50 to 300 rpm, preferably 100 rpm)
Step 3: Addition of MgCl.sub.2 to a Final MgCl.sub.2 Concentration of about 50 mM MgCl.sub.2 Add 50 l of the 1M MgCl.sub.2 stock solution to the samples of step 1 Shake them 1 min. [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] Incubate the samples for 60 min at room temperature Shake them 1 min. [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Dilution Take one of the samples of step 3 and dilute it 1:10 with buffer, pH 7 (i.e. 50 mM Tris/HCl buffer pH 7) 895 l 50 mM Tris-buffer+105 l sample Perform it twice for a repeat determination (i.e. determination in duplicates): 2rituximab placebo 1:10 with Tris-buffer 2rituximab placebo 5.0 EU/ml 1:10 with Tris-buffer 2LAL water 1:10 with Tris-buffer 2LAL water 5.0 EU/ml 1:10 with Tris-buffer
Step 5: Dialysis Shake all diluted samples for 1 min [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature], Transfer into the FastSpinDIALYZER Put one dialyzer per beaker (i.e. DURAN baker, tall form, 2000 ml, OMNILAB, Germany, P/N: 5013163) on a magnetic stirrer plate. Adjust the frequency of the stirrer to be high (i.e. fast spin). A high frequency of the stirrer means 50-300 rpm, preferably 200-300 rpm. The stirrer is a heat-sterilized (4 hours at 250 C.) magnetic stirrer having a length of about 40 mm and a diameter of about 14 mm.
(31) Fill the beaker with 200 ml Aqua Braun Dialyze 24 h and exchange the Aqua Braun after 2 h and 4 h at room temperature (212 C.) After dialysis transfer the sample into new 1.5 ml screw vials
Step 6: Shaking Shake the samples for 20 min. [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 7: Preparation of the LER Positive Control (i.e. the Positive LER Control) and of Further Water Controls Prepare the LER positive control 1 h before the dialysis ends 1. rituximab placebo 900 l+100 l LAL water 2. rituximab placebo 900 l+100 l CSE conc. 50 EU/ml=final conc. 5.0 EU/ml 3. LAL water 1000 l 4. LAL water 900 l+100 l CSE conc. 50 EU/ml=final conc. 5.0 EU/ml Shake 1 h [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] Dilute samples 1:10 (sample:LAL water) with LAL water Shake [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] for 1 min
Step 8: LAL Assay Prepare the standard and start the LAL assay according to the instructions of the manufacturer (Kinetic-QCL assay; Lonza)
Results and Discussion
(32) As can be seen in
(33) It has been found that Mg.sup.2+ is the divalent cation of choice to restore LAL reactivity in formulations containing chelating buffers (such as sodium citrate) and showing the LER effect.
(34) In order to remove the chelating buffer (e.g. the Sodium citrate buffer), a second step (after addition of Mg.sup.2+) is to perform dialysis. The spinDIALYZER of Harvard is the preferred equipment for the dialysis.
(35) The detergent (e.g. polysorbate 80) represents the second reason for the LER effect. In general, the presence of detergents (such as polysorbate 80) in a biological sample leads to micelle formation in case the critical micellar concentration (CMC) of the detergent (usually in the M range) is reached. Micelles may inhibit the LPS-mediated activation of factor C, a serine protease representing the first enzyme in the LAL-cascade reaction (Nakamura (1988a) J. Biochem. 103: 370-374). In monoclonal antibody preparations, the undiluted sample is usually above the CMC in order to obtain a functional solubilisation of the antibody. In the products which were investigated here, the CMC of the detergents indeed exceeded their CMC (polysorbate 80: 700 mg/l (50 fold excess)) leading to the assumption that polysorbate 80 is present in form of micelles. In the above described protocol the concentration of the detergent is reduced by dilution so that the concentration of the detergent is near/drops below the CMC value (polysorbate 80: 14 mg/l or 10.6 M). Dilution of the detergent to near-CMC concentrations may eliminate the micellar compartmentalization, and therefore, render the CSE molecules spiked accessible for the LAL enzymes.
(36) Accordingly, the problem of the LER effect, (e.g. in the event sodium citrate and polysorbate 80 are used for the formulation of a pharmaceutical product) can now be considered as being solved. In conclusion, herewith provided is a safe, robust and reproducible testing method for pharmaceutical products.
(37) In summary, in rituximab and rituximab placebo the above described protocol surprisingly overcomes the LER effect. By contrast, the same protocol could not reveal satisfactory results for NeoRecormon (which does not comprise an antibody but epoetin-beta) indicating that the herein provided methods are particularly useful for antibody formulations, preferably for formulations with monoclonal antibodies, citrate buffer and polysorbate 80.
Example 2.2: Modified Protocol (1) for Overcoming the LER Effect
(38) In this Example a modified protocol has been used which nevertheless overcomes the LER effect. The most important changes compared to Example 2.1 are as follows: 1. In Example 2.2 the Spin Dialyzer has been used. In contrast, in Example 2.1 the FastSpinDIALYZER is used which has more efficient dialysis chambers and increases the efficiency of the dialysis (the membranes are on both sides of the cylinder). 2. In Example 2.2 the MWCO of the dialysis membrane is 500 Da. In contrast, in Example 2.1 the MWCO of the dialysis membrane is 10 kDa. 3. In Example 2.2 the dilution is 1:10 with endotoxin-free water. In contrast, in Example 2.1 the dilution 1:10 with Tris-buffer pH7 (i.e. Tris/HCL buffer pH7). By diluting the sample with endotoxin-free water at a ratio of 1:10 the pH value of the sample is adjusted to about pH 6.0. 4. In Example 2.2 the dialysis time is 4 h. In contrast, in Example 2.1 the dialysis time is 24 h.
(39) In this Example rituximab and rituximab placebo were used as sample. However, for the same reasons as discussed with respect to Example 2.1, this protocol is useful for overcoming the LER in all typical antibody formulations.
(40) In particular, the protocol used in Example 2.2 is detailed as follows.
(41) Protocol Overview
(42) Step 1: Setting up the LER effect (see also below LER positive control): Rituximab and rituximab placebo samples were spiked with 5 EU/ml or 0.5 EU/ml (CSE; Lonza, E. coli 0055:B5) and the mixture was shaken for 60 min at room temperature at maximum speed [Shaker: Heidolph Multi Reax, high speed (2,037 rpm)] to obtain a positive LER-effect sample. Step 2: Adding MgCl.sub.2: Before dialysis, add 2 M MgCl.sub.2 stock solution so that the final conc. is about 50 mM MgCl.sub.2; 1 min shaking as in step 1. Step 3: 1:10 Dilution [one sample without dilution (undiluted) as reference]; shaking for 1 min as in step 1. Step 4: Dialysis for 4 h using a 500 Da membrane (30 min pre-incubated with 0.2% BSA; optionally but not mandatory), exchange of water after 2 h once. Transferring of the solution from the dialysis chamber into a glass vial and shaking as in step 1 for 20 min at RT (room temperature, i.e. 212 C.). Step 5: kinetic LAL-assay measurement.
Detailed Protocol
Step 1: Preparation of the Samples Preparation antibody solution (rituximab) for 50 mM MgCl.sub.2: Fill 1 tube with 877.5 l rituximab+97.5 l CSE (stock solution of 50 (5) EU CSE/ml.fwdarw.5 (0.5) EU/ml final concentration). Unspiked control: 877.5 l rituximab placebo+97.5 l water Unspiked water control: 975 l water (for blank subtraction) used vials: clear flat bottom small opening 1.5 ml Macherey & Nagel, Ref. Nr. 70213 1 h shaking on Heidolph Multi Reax, high speed (2,037 rpm) at room temperature.
Step 2: Addition of MgCl.sub.2 to a Final Concentration of 50 mM MgCl.sub.2 Stock solution 1M MgCl.sub.2.6H.sub.2O: add 50 l of a 1M MgCl.sub.2-stock solution to the spiked sample as well as to the unspiked sample (blank).
Step 3: Dilution Sample rituximab with 50 mM MgCl.sub.2: prepare a 1:10 dilution by adding 900 l endotoxin-free water (i.e. LAL water)+100 l sample Water control is treated the same with endotoxin-free water (i.e. LAL water) instead of rituximab: dilute 1:10
Step 4: Dialysis 1 min shaking before dialysis [i.e. in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]. Put samples into the 1 ml dialyzer chambers (Harvard Spin Dialyzer) to which a membrane with MWCO 500 Da (optionally, 30 min pre-incubated with 0.2% BSA) is fixed. Dialyze 4 h against 1 l Aqua Braun (i.e. sterile, pyrogen free water; as supplied by B. Braun, Melsungen) at 24 C.; change water after 2 h. Changing water has been tempered also to 24 C. The Spin Dialyzers are distributed (depending on the number of dialysis chambers) over multiple 21 beakers filled with 1 l Aqua Braun under stirring (magnetic Teflon stirrer). There are at most 5 Dialyzer in one 21 beaker.
Step 5: Preparation of the LER Positive Control
(43) Also in this Example a LER positive control is used in the LAL assay. This LER positive control can be prepared at any time, provided that it is ready if the LAL assay starts. Advantageously, the LER positive control is prepared 1 h before the end of 4 h dialysis, so that all samples are ready for testing at the same time. For preparing the LER positive control the following protocol is used: rituximab 900 l+100 l CSE.fwdarw.final conc. CSE: 5.0 EU/ml. Shaking in a Heidolph Multi Reax, high speed (2,037 rpm) at RT for 1 h. Only under these conditions the max. LER effect (<1% recovery rate) will be obtained. In parallel prepare the following blanks: Water with 5.0 EU/ml CSE Water with 5.0 EU/ml CSE; diluted 1:10 (0.5 EU/ml).
Step 6: LAL Assay Start test after all samples are prepared. From all samples two aliquots of 100 l are used for repeat determination (2, i.e. determination in duplicates) in a plate which is incubated 10 min at 37 C. in the Tecan Reader. Add 100 l LAL Reagent (Kinetic-QCL Assay; Lonza) to each sample in a well-defined sequence (according to the read-out of the machine).
Results and Discussion:
(44) The protocol described in Example 2.1 resulted in best reproducible recovery rates (also with respect to the water controls). However, the protocol described in Example 2.2 resulted in a good CSE recovery-rate ranging from 50 to 95% for both CSE concentrations spiked (see
Reference Example 1: Time Dependency of the LER Effect
(45) In the prior art it is assumed that the LER effect appears immediately after spiking of the sample with a defined amount of CSE (C. Platco, 2014, Low lipopolysaccharide recovery versus low endotoxin recovery in common biological product matrices. American Pharmaceutical Review, Sep. 1, 2014, pp. 1-6). Therefore, first the samples were shaked after LPS spiking for a rather short time of about 2-10 min at room temperature. However, this kind of spiking turned out to be inefficient and some experiments indicated that the masking effect of the material spiked has not yet reached its maximum during this short time interval (<10 min). It was found that the mechanism of spiking is one of the fundamental processes in analyzing the LER effect in a correct way (see, e.g.,
(46) In particular, it was analyzed how long shaking has to be carried out [max. frequency (i.e. vortexing) in a Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature in (21 C.2 C.) a 1.5 ml clear glass, crimp neck, flat bottom vessel], in order to achieve the maximum LER effect. Therefore, rituximab samples were spiked with CSE in a vial, so as to obtain 0.5 and 5.0 EU/ml (vials by Macherey-Nagel, 1.5 ml). After spiking, the samples were shaked for 60 min, 30 min, 10 min, 5 min, or 2 sec, respectively. Afterwards, 1:10 dilutions were prepared by mixing 900 l endotoxin-free water (i.e. LAL water) with 100 l sample. After dilution, the samples were again shaked for 1 min. Subsequently, the samples were tested in the LAL assay in duplicates. In particular, 100 l of each sample was applied onto a plate and incubated in the reader for 10 min at 37 C. Then, 100 l chromogen was added to each sample and the measurement was carried out. In this experiment, all solutions had room temperature. As can be seen in
(47) From this result it was concluded that spiking needs time to mask the LPS molecules into the detergent micelles. The positive LER effect is complete when about 100% masking or <0.5% recovery rates of CSE are obtained. This process requires a minimum of 1 h during shaking at room temperature [e.g., shaker: Heidolph Multi Reax, high speed (2,037 rpm) for 1 h at room temperature in a 1.5 to 5 ml clear glass, crimp neck, flat bottom] or alternatively storage at 4 C. for a longer time period >24 h. The resulting positive LER control is shown in all graphical plots as one bar in the graphical presentations at the right side of the diagram.
Reference Example 2: Influence of Human Serum Albumin (HAS) and Different MgCl2 Concentrations on the Recovery Rate
(48) In order to determine the effect of HSA and different MgCl.sub.2 concentrations on the recovery rate of endotoxin spiked rituximab samples, the following experiment has been performed. In addition, in this experiment the influence of dialysis on the recovery rate has been analyzed. More specifically, rituximab spiked samples were shaken for 60 min in order to obtain the positive LER effect. Prior to the dialysis, 10-75 mM MgCl.sub.2 were added, subsequently, a dilution was performed. No BSA-blocked membrane was used. After the dialysis, 0.01 g/ml HSA is either added or not added. Subsequently, shaking for 20 min is performed. In addition, some samples were not dialyzed at all. In particular, the different samples which have been tested in the LAL assay are shown in
(49) The samples have been prepared in a 1.5 ml screw neck vial by Macherey-Nagel.
(50) Step 1: Preparation of the Samples
(51) Preparation of spiked rituximab for 10 mM MgCl.sub.2: 897 l rituximab+99.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab for 50 mM MgCl.sub.2: 889 l rituximab+98.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab for 75 mM MgCl.sub.2: 883 l rituximab+98.1 l CSE so that 5.0 EU/ml are obtained Preparation of spiked water for 10 mM MgCl.sub.2: 897 l water+99.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked water for 50 mM MgCl.sub.2: 889 l water+98.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked water for 75 mM MgCl.sub.2: 883 l water+98.1 l CSE so that 5.0 EU/ml are obtained Shake for 60 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 2: Addition of MgCl.sub.2 A 4 M MgCl.sub.2 stock solution (i.e. 511.437 mg MgCl.sub.2.6H2O in 0.629 ml water) was used. For 10 mM MgCl.sub.2 2.5 l of the 4 M solution are added to the spiked sample. For 50 mM MgCl.sub.2 12.5 l of the 4 M solution are added to the spiked sample. For 75 mM MgCl.sub.2 19 l of the 4 M solution are added to the spiked sample. Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 3: Dilution Dilutions at a ratio of 1:10 were prepared as follows: Preparation rituximab 1:10: always 900 l LAL water+100 l sample The water was not diluted 1:10 since there are not enough dialyzers available. Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Dialysis The samples were put into a 1 mL dialyzer. A 500 Da membrane. However, the membrane was washed in LAL water. Dialysis was performed against 1 L Aqua Braun at 24 C. for 4 h, and after 2 h the water was changed. The new water also had a temperature of 24 C. The dialyzers were located in three 2 L beakers and rotated since there was a long stirrer (i.e. stir bar) in each beaker. There are always 4 dialyzers in each beaker.
Step 5: Addition of HSA after Dialysis After the dialysis, the samples were portioned. For the preparation of HSA-samples 396 l of each sample were added to a separate vial. For the preparation of samples without HSA 400 l were added to a separate vial. To obtain a HSA concentration of 0.01 g/ml, 4 l of a 1 g/ml solution were added to the 396 l samples The HSA stock solution was newly prepared. Shake for 20 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 6: Preparation of the LER Positive Control The LER positive control is prepared 1 h before the end of the 4 h dialysis so that it is ready at the same time as the other samples. rituximab 900 l+100 l CSE of different CSE stock solutions so that 5.0 EU/ml are obtained] shaken at room temperature for 1 h [Heidolph Multi Reax shaker, high speed (2,037 rpm)]
Step 7: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen were applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(52) The results are shown in
Reference Example 3: 4 Hours Incubation Time after Addition of MgCl2
(53) In this experiment rituximab samples were shaken for 60 min in order to achieve the positive LER effect. After addition of MgCl.sub.2 the undiluted samples were incubated for 4 h at room temperature). After this incubation, the samples were shaked for 2 min. The different samples which have been tested in the LAL assay are shown in
Step 1: Preparation of the Samples Preparation of spiked rituximab/water for 10 mM MgCl.sub.2: 897 l rituximab/water+99.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab/water for 50 mM MgCl.sub.2: 889 l rituximab/water+98.8 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab/water for 75 mM MgCl.sub.2: 883 l rituximab/water+98.1 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab/water for 100 mM MgCl.sub.2: 877 l rituximab/water+97.5 l CSE so that 5.0 EU/ml are obtained Preparation of spiked rituximab/water for 150 mM MgCl.sub.2: 866 l rituximab/water+96.3 l CSE so that 5.0 EU/ml are obtained Shake for 60 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 2: Addition of MgCl.sub.2 A 4 M MgCl.sub.2 stock solution (i.e. 534.661 mg MgCl.sub.2.6H.sub.2O in 0.657 ml water) was used. For 10 mM MgCl.sub.2 2.5 l of the 4M solution are added to the spiked sample. For 50 mM MgCl.sub.2 12.5 l of the 4M solution are added to the spiked sample. For 75 mM MgCl.sub.2 19 l of the 4M solution are added to the spiked sample. For 100 mM MgCl.sub.2 25 l of the 4M solution are added to the spiked sample. For 150 mM MgCl.sub.2 37 l of the 4M solution are added to the spiked sample. Shake for 1 min [high speed (2,037 rpm) at room temperature]
Step 3: Dilution Dilutions at a ratio of 1:10 were prepared: 900 l LAL water+100 l sample (i.e. rituximab sample or water sample) Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Preparation of the LER Positive Control rituximab 900 l+100 l CSE so that 5.0 EU/ml are obtained Another LER positive control was prepared by mixing 900 l rituximab+100 l CSE so that 5.0 EU/ml are obtained; and subsequently diluting the sample 1:10 with endotoxin-free water
Step 5: Shaking All samples as well as the LER positive controls were shaken at room temperature for 1 h [Heidolph Multi Reax shaker, high speed (2,037 rpm)]
Step 6: LAL Assay 100 l of each sample were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen was applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(54) The result of this experiment is shown in
Reference Example 4: Comparison of 2 and 4 Hours Incubation Time after Addition of MgCl2
(55) The rituximab samples were shaken for 60 min in order to achieve the positive LER effect. After addition of MgCl.sub.2 the undiluted samples were incubated for 2 or 4 h, then 1:10 diluted and measured in the LAL assay. The different samples which have been tested in the LAL assay are shown in
Step 1: Preparation of the Samples Preparation of rituximab/water for 10 mM MgCl.sub.2: 897 l rituximab/water+99.8 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained. Preparation of rituximab/water for 50 mM MgCl.sub.2: 889 l rituximab/water+98.8 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained. Preparation of rituximab/water for 75 mM MgCl.sub.2: 883 l rituximab/water+98.1 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained.
Step 2: Preparation of Two LER Positive Controls rituximab 900 l+100 l CSE so that 0.5 and 5.0 EU/ml are obtained. Dilution of one of the LER positive controls at a ratio of 1:10 with endotoxin-free water.
Step 3: Shaking All samples as well as the LER positive control are shaken for 1 h: [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Addition of MgCl.sub.2 A 4 M MgCl.sub.2 stock solution was used. For 10 mM MgCl.sub.2 2.5 l of the 4M solution are added to the spiked sample For 50 mM MgCl.sub.2 12.5 l of the 4M solution are added to spiked sample For 75 mM MgCl.sub.2 19 l of the 4M solution are added to spiked sample Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 5: Incubation Time The (undiluted) samples (as well as the LER positive controls) are portioned. One half of each sample (about 500 l) was incubated for 2 h and the other half was incubated for 4 h, respectively.
Step 6: Dilution Shake for 2 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] Dilutions at a ratio of 1:10 were prepared: 900 l LAL water+100 l sample (i.e. rituximab sample or water sample). Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 7: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen were applied to each sample. Starting the measurement in the reader
Results and Discussion:
(56) The results are shown in
Reference Example 5: Comparison of 2 Hours Incubation Time after Addition of Different Amounts of MgCl2 with No Incubation Time after Addition of Different Amounts of MgCl2
(57) The rituximab samples were shaken for 60 min in order to achieve the positive LER effect. After addition of MgCl.sub.2 the undiluted samples were either not incubated or incubated for 2 h. Then 1:10 diluted and measured in the LAL assay. The different samples which have been tested in the LAL assay are shown in
Reference Example 5.1: No Incubation Time after Addition of MgCl2
(58) In this experiment, no incubation was performed after addition of MgCl.sub.2 to the samples.
(59) The samples have been prepared in a 1.5 ml screw neck vial by Macherey-Nagel.
(60) Step 1: Preparation of the Samples
(61) Preparation of rituximab/water for 10 mM MgCl.sub.2: 897 l rituximab/water+99.8 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained Preparation of rituximab/water for 25 mM MgCl.sub.2: 895 l rituximab/water+99.4 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained. Preparation of rituximab/water for 50 mM MgCl.sub.2: 889 l rituximab/water+98.8 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained.
Step 2: Preparation of Two LER Positive Controls rituximab 900 l+100 l CSE so that 0.5 and 5.0 EU/ml are obtained. Dilution of one of the LER positive controls at a ratio of 1:10 with endotoxin-free water
Step 3: Shaking All samples as well as the LER positive control were shaken (i.e. vortexed) for 60 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Addition of MgCl.sub.2 A 4 M MgCl.sub.2 stock solution was used. For 10 mM MgCl.sub.2 2.5 l of the 4M solution are added to the spiked sample For 25 mM MgCl.sub.2 6.25 l of the 4M solution are added to spiked sample For 50 mM MgCl.sub.2 12.5 l of the 4M solution are added to spiked sample Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 5: Dilution Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] Dilutions at a ratio of 1:10 were prepared. Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 6: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen were applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(62) The results are shown in
Reference Example 5.2: Incubation of 2 h after Addition of MgCl2
(63) In this experiment, the samples were incubated for 2 h after addition of MgCl.sub.2. Steps 1 to 4 were performed as described above under Reference Example 4.1. However, after addition of MgCl.sub.2 the undiluted samples were incubated for 2 h at room temperature (21 C.)). After the incubation, the following steps 5 and 6 were performed. The different samples which have been tested in the LAL assay are shown in
(64) Step 5: Dilution
(65) Shake for 2 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] Dilutions at a ratio of 1:10 were prepared: 900 l LAL water+100 l sample (i.e. rituximab sample or water sample) Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 6: Preparation of Two LER Positive Controls rituximab 900 l+100 l CSE so that 0.5 and 5.0 EU/ml are obtained. Dilution of one of the LER positive controls at a ratio of 1:10 with endotoxin-free water
Step 7: Shaking All samples as well as the LER positive control were shaken for 1 h [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 8: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen were applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(66) The results of Reference Example 4.1 are shown in
Reference Example 6: Comparison of Different Dilutions with Rituximab and Rituximab Placebo Samples
(67) After spiking, rituximab and rituximab placebo samples were shaken for 60 min in order to achieve the positive LER effect. After addition of MgCl.sub.2 the undiluted samples were shaked for 1 h and diluted at a ratio of 1:2, 1:5, 1:10 or 1:20 Afterwards the LAL assay was performed. The different samples which have been tested in the LAL assay are shown in
(68) In particular, the following experiment has been performed:
(69) Step 1: Preparation of the Samples
(70) Preparation of rituximab/rituximab placebo/water for 25 mM MgCl.sub.2: 895 l rituximab/rituximab placebo/water+99.4 l of different CSE stock solutions so that 0.5 and 5.0 EU/ml are obtained.
Step 2: Preparation of Three LER Positive Controls rituximab placebo 450 l+50 l CSE so that 0.5 und 5.0 EU/ml are obtained (first LER positive control). rituximab 450 l+50 l CSE so that 0.5 und 5.0 EU/ml are obtained (second LER positive control). rituximab 450 l+50 l CSE so that 0.5 und 5.0 EU/ml are obtained. Afterwards, this sample was diluted at a ratio of 1:10 (third LER positive control).
Step 3: Shaking All samples as well as the LER positive controls were shaken (i.e. vortexed) for 60 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 4: Addition of MgCl.sub.2 A 4 M MgCl.sub.2 stock solution was used. For 25 mM MgCl.sub.2 6.25 l of the 4M solution are added to spiked sample Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 5: Dilution The samples were diluted as follows: Dilution at a ratio of 1:5: 400 l water+100 l sample Dilution at a ratio of 1:10: 450 l water+50 l sample Dilution at a ratio of 1:20: 475 l water+25 l sample One of the three LER positive controls was diluted at a ratio of 1:10. The water without MgCl.sub.2 was not diluted. Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 6: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen was applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(71) The results are shown in
Reference Example 7: Influence of Incubation Time Before Addition of MgCl2 on the Recovery Rate in Rituximab and Rituximab Placebo Samples
(72) In the following experiment it was tested whether incubation times before addition of MgCl.sub.2 have an influence on the recovery rate of rituximab and rituximab placebo samples. In particular, rituximab and rituximab placebo samples were shaken for 60 min in order to achieve the positive LER effect. Then the samples were incubated at 4 C. for 0 h to 3 days. Afterwards, MgCl.sub.2 was added to a concentration of 50 mM and the samples were diluted. Then, dialysis was performed with a dialysis membrane which was not BSA-blocked. The different samples which have been tested in the LAL assay are shown in
(73) The samples have been prepared in a 1.5 ml screw neck vial by Macherey-Nagel.
(74) Step 1: Preparation of the Samples
(75) Preparation rituximab/rituximab placebo/water for 50 mM MgCl.sub.2: 5,346 l rituximab/rituximab placebo/water+596 l of different CSE stock solutions so that 0.5 or 5.0 EU/ml were obtained. Vortex for 60 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature] For the further procedure 1 ml of each sample was transferred into new vials
Step 2: Incubation Time The samples were put into the refrigerator at 4 C. for 0 h, 4 h, 1 day, 3 days, or 7 days. After the incubation time of 1 day, 3 days or 7 days the samples were shaked for 2 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]. After 0 h and 4 h incubation time the samples were not shaked.
Step 3: Addition of MgCl.sub.2 A 5 M MgCl.sub.2 stock solution (i.e. 0.9055 g MgCl.sub.2 in 0.891 ml water) was used For 50 mM MgCl.sub.210 l of the 5 M solution were added to the spiked samples Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature
Step 4: Dilution Dilutions at a ratio of 1:10 were prepared: 900 l LAL water+100 l sample (i.e. rituximab sample, rituximab placebo sample or water sample) The water without MgCl.sub.2 was not diluted. Shake for 1 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature
Step 5: Dialysis The samples were added into a 1 ml dialyzer. Dialysis was performed against 1 l Aqua Braun at 24 C. for 4 h, and after 2 h the water was changed. The new water also had a temperature of 24 C. A 500 Da membrane was used which has not been incubated with BSA before. The dialyzers were located in three 2 l beakers and rotated since there was a long stirrer (i.e. stir bar) in each beaker. After dialysis the samples have been transferred into new 1.5 ml vials.
Step 6: Shaking Shake for 20 min [Heidolph Multi Reax shaker, high speed (2,037 rpm) at room temperature]
Step 7: Preparation of the LER Positive Control The LER control was prepared 1 h before the end of the 4 h dialysis so that it is ready at the same time as the other samples. rituximab or rituximab placebo 900 l+100 l CSE to obtain 5.0 EU/mL CSE Shake at room temperature for 1 h [Heidolph Multi Reax shaker, high speed (2,037 rpm)]
Step 8: LAL Assay 100 l of each samples were applied onto a plate in double determination Incubation in the reader at 37 C. for 10 min. 100 l chromogen were applied to each sample. Starting the measurement in the reader.
Results and Discussion:
(76) The results are shown in
Reference Example 8: The Protocol of the State of the Art (LAL Assay) and Modifications Thereof Cannot Overcome the LER Effect in Rituximab or Rituximab Placebo
(77) In this Example it was determined whether the commonly known LAL assay is able to detect endotoxins in rituximab and rituximab placebo preparations. Therefore, the following materials have been used:
(78) [rituximab 002]: Lonza CSE+Lonza reagent (i.e. Lonza kit)
(79) [rituximab 004]: ACC CSE or Lonza CSE, respectively+ACC reagent (i.e. ACC kit)
(80) [rituximab 005]: Lonza CSE+ACC reagent (i.e. ACC kit)
(81) The LAL assays have been precisely been performed as described by the manufacturer.
(82) As can be seen from
(83) In a similar experiment (i.e. [rituximab 004]) rituximab was pipetted into the wells of a microtiter plate and spiked with Lonza CSE and ACC CSE to a final concentration of 0.5 EU/ml or 5.0 EU/ml. Subsequently, dilutions with water as shown in
(84) In further experiments, the effect of pH adjustment on the LAL assay was analyzed. In particular, in one experiment [rituximab 005] rituximab was pipetted into a microtiter plate and Lonza CSE spiking was performed in the plate. Subsequently, the dilutions with water or the pH adjustment as indicated in
(85) Also dialysis alone does not result in a satisfactory recovery rate. More specifically, in a further experiment, rituximab was spiked with CSE to result in a final concentration of 0.5 and 5.0 EU/ml (i.e. 900 l rituximab solution was mixed with 100 l CSE). Subsequently, the samples were dialysed in a 1 ml Spin Dialyser (in 1 ml Teflon chambers) for 4 hours at 4 C. with one change of water after 2 h. The dialysis membrane had a MWCO of 100 Da. Then, dilutions as shown in
Reference Example 9: Hold Time Studies
(86) To identify and monitor the LER effect, endotoxin contents have been monitored over time in an endotoxin hold time study. Therefore, an undiluted sample of various buffers has been spiked with endotoxin and stored over time (up to 28 days). Acceptable endotoxin values recovered in the PPC after spiking with the appropriate sample mixture are defined to be in the range of 50-200% of the theoretical spike value (100%). The LER effect is indicated by a significant loss of endotoxins over time. In particular, an adverse trend of endotoxin values <50% of the theoretical spike value are indicative for the LER effect.
(87) Several formulation buffer components were studied in an endotoxin hold time study (for results see the following table).
(88) TABLE-US-00001 TABLE 1 Hold time studies endotoxin endotoxin recovery [EU/ml] at time spike start excipient [EU/ml] (T.sub.0) day 7 day 14 day 21 day 28 ,-trehalose 5 4.85 4.65 3.48 4.32 4.51 NaH.sub.2PO.sub.4 5 5.27 4.64 3.3 3.4 3.37 Na.sub.2HPO.sub.4 5 5.99 5.72 5.07 5.63 5.06 Polysorbate 20 5 4.04 4.03 4.23 3.94 4.16 Polysorbate 20 + 5 0.13 0.18 n.d. n.d. n.d. Na.sub.2HPO.sub.4 Polysorbate 20 + 5 0.37 0.77 n.d. n.d. n.d. NaH.sub.2PO.sub.4 Na.sub.2HPO.sub.4 + 5 5.12 4.64 n.d. n.d. n.d. NaH.sub.2PO.sub.4 Polysorbate 20 + 5 0.91 <0.1 n.d. n.d. n.d. Na.sub.2HPO.sub.4 + NaH.sub.2PO.sub.4 sodium citrate- 5 5.2 4.7 4 3.72 4.28 dihydrate Polysorbate 80 5 3.25 3.15 3.27 3.05 3.17 NaCl 5 5.76 5.72 5.45 4.74 6.49 Na citrate + 5 1.33 0.16 n.d. n.d. n.d. polysorbate 80 + NaCl Na citrate + 5 0.8 <0.1 n.d. n.d. n.d. polysorbate 80 polysorbate 80 + 5 2.94 2.45 n.d. n.d. n.d. NaCl Urea 5 5.14 6.21 5.66 5.28 5.29 L-Leu 5 5.72 5.61 5.87 5.01 5.88 L-Ile 5 5.70 5.82 6.24 5.17 6.17 L-Thr 5 5.54 5.65 5.66 4.76 5.88 L-Glu 5 5.28 5.03 5.50 4.43 4.24 L-Phe 5 5.49 5.50 5.96 4.98 6.34 Gly 5 4.64 4.57 4.75 4.27 5.00 n.d. = not determined
(89) As can be seen from the above table, the buffers comprising polysorbate 20 and Na.sub.2HPO.sub.4; polysorbate 20 and NaH.sub.2PO.sub.4; Polysorbate 20, Na.sub.2HPO.sub.4.sup.+ and NaH.sub.2PO.sub.4; Na citrate, polysorbate 80 and NaCl; Na citrate and polysorbate 80; as well as polysorbate 80 and NaCl exhibit a LER effect.
Reference Example 10: Influence of Buffer and Detergent on the LER Effect
(90) In several experiments the effect of citrate and/or polysorbate 80 on the LER effect was analyzed. In particular, in one experiment rituximab and 25 mM sodium citrate buffer were used as samples. Before spiking, the pH was adjusted to pH 7. Subsequently, CSE spiking was performed in the plate, and the samples were diluted with water. As can be seen from
(91) In another experiment 25 mM sodium citrate buffer, polysorbate 80 and a combination of both were used as samples. In particular, the concentrations as present in Rituximab were used (i.e. polysorbate 80: 0.7 mg/ml; sodium citrate: 9 mg/ml). These buffer systems were spiked with 0.5 and 5.0 EU/ml of Lonza CSE or with Cape cod CSE (except of sodium citrate, which was spiked with Lonza only, as ACC spiking of sodium citrate buffer was already performed in experiment described above and shown in
(92) These results have been verified by another experiment wherein several different dilutions were tested. In particular, samples comprising either 25 mM sodium citrate buffer (pH 6.5), 700 mg/L polysorbate 80 or both (i.e. the formulation of rituximab) were prepared. These preparations as well as water controls were spiked with Lonza CSE to a final concentration of 0.5 or 5.0 EU/ml. All samples were shaken for 1 hour at room temperature in the vortex machine [shaker: Heidolph Multi Reax, high speed (2,037 rpm) in a 1.5 clear glass, crimp neck, flat bottom vessel Subsequently, the dilutions as indicated in
(93) In these samples, also with high dilution, the recovery rate is only 5-10%. Accordingly, this experiment demonstrates how a positive LER effect can be obtained. This result is pioneering in the field of endotoxin determination, as it allows for testing of several means and methods for their ability to overcome the LER effect.
(94) When analyzing the effect of buffer and detergent separately, the effect of the buffer on the LER effect was more pronounced in both NeoRecormon and Rituximab (see, e.g.
Reference Example 11: Standard Physical and Biochemical Methods do not Recover Endotoxins Masked by the LER Effect
(95) In order to overcome the LER effect (in the buffers identified as having the LER effect in Reference Example 9), different physical and biochemical methods were tested:
(96) Freezing of endotoxin spiked samples at 30 C. This study is based on the initial finding that LER is more pronounced at room temperature as compared to 2-8 C. Result: freezing of endotoxin spiked samples does not overcome LER.
(97) Heating of endotoxin spiked samples for 30 minutes at 70 C. This study was conducted because heating has shown to overcome endotoxin masking effects for some products (Dawson, 2005, LAL update. 22:1-6). Result: Heat treatment of endotoxin spiked samples does not overcome LER.
(98) Dilution of endotoxin spiked samples to maximum valid dilution (MVD). This study was conducted since sample dilution is the standard method to overcome LAL inhibition. Result: As can be seen from
(99) Use of Endo Trap Columns for endotoxin spiked samples. These columns serve to remove endotoxins from solutions via affinity chromatography. A test was carried out with an aqueous endotoxin solution. Result: Endotoxins could not be recovered from the column.
Reference Example 12: Removal of Detergents by Dialysis
(100) Several dialysis chambers and membranes (including different sizes of the molecular weight cut-off, MWCO) available on the market have been tested as detailed below.
(101) Suitable membranes for dialysis chambers are commercially available are, e.g., cellulose acetate (MWCO 100 to 300,000 Da), regenerated cellulose (MWCO 1,000 to 50,000 Da), or cellulose ester (MWCO of 100 to 500 Da). Herein cellulose acetate and cellulose ester are preferred, cellulose acetate is most preferred.
(102) The test samples (i.e. rituximab) were diluted prior to the dialysis, this way approaching the CMC and creating increasing levels of monomers of the detergent which were expected to diffuse through the dialysis membrane. Investigations on the recovery rate of the CSE spiked revealed that in case of rituximab the regenerated cellulose was not so efficient as compared to the cellulose acetate. In a series of experiments with rituximab it was identified that the MWCO is preferably 10 kDa. This size is preferred because this size is thought to i) speed up the dialysis process and ii) allow also higher oligomeric aggregates (but not micelles) of the detergent to pass through the membrane, in case the hydrophobic character of the cellulose acetate (acetyl esters on the glucose polymers) will not inhibit such kind of transportation process.
(103) The experiment to determine the optimum for dialysis has been performed to mimic the situation in NeoRecormon. As outlined earlier, buffer and detergent were those compounds in the sample formulation which mostly influenced the LER effect. In order to mimic the formulation of NeoRecormon a defined amount of phosphate buffer in a total volume of 0.5 ml (2.7 mg) in the presence of 0.1 mg/ml poysorbate 20 was prepared and subjected to dialysis (in a spin dialyzer). In
(104) In
Reference Example 13: Influence of MgCl2 on the LER Effect
(105) It has been found that the LER effect could be reduced by addition of MgCl.sub.2 to the sample (see, e.g.,
(106) In particular, samples comprising either 25 mM sodium citrate buffer, pH 6.5 (i.e. sodium citrate buffer, pH 6.5), 0.7 mg/ml polysorbate 80, or both (with pH 6.5, i.e. the formulation of rituximab) were prepared. These preparations as well as water controls were spiked with Lonza CSE to a final concentration of 0.5 or 5.0 EU/ml. All samples were shaken for 1 hour at room temperature [shaker: Heidolph Multi Reax, high speed (2,037 rpm) in a 1.5 clear glass, crimp neck, flat bottom vessel]. Then, MgCl.sub.2 to reach a concentration of 10 mM, 25 mM, 50 mM or 75 mM was added to the samples. Subsequently, the dilutions as indicated in
Reference Example 14: Effects of Mechanical Treatments on the LER Effect
(107) It was tested whether mechanical treatments (such as shaking and ultrasonification) are useful for dispersing the micelles, and thus for reducing the LER effect.
(108) In particular, endotoxin-free water (i.e. LAL water) and rituximab were spiked with Lonza CSE to achieve a final concentration of 0.5 and 5.0 EU/ml. Then, the samples were either sonicated for 1 hour or shaked for 1 hour [i.e. vortexed in the Heidolph Multi Reax shaker at high speed (2,037 rpm) at room temperature in a 1.5 ml clear glass, crimp neck, flat bottom vessels]. Then 1:10 (sample:water) dilutions were prepared with endotoxin-free water. Subsequently, the diluted samples were dialyzed by using a 12-16 kD membrane (which, before dialysis, had been incubated in 0.2% BSA for 30 min). The dialysis took place in two 2 l beakers for 4 hours. The external dialysate was 1 l Aqua Braun and the water was changed after 2 hours of dialysis. After dialysis MgCl.sub.2 was added to some of the samples (as indicated in
(109) The present invention refers to the following nucleotide and amino acid sequences:
(110) TABLE-US-00002 SEQIDNO:1:Rituximabheavychain, aminoacidsequence QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGA IYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARST YYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K SEQIDNO:2:Rituximablightchain, aminoacidsequence QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYAT SNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGG TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGEC