AGENTS AND METHODS FOR TREATING TAUOPATHIES
20230226016 · 2023-07-20
Inventors
- David S. Eisenberg (Los Angeles, CA)
- Paul M. Seidler (Los Angeles, CA)
- Patrick G. Harran (Santa Monica, CA, US)
- Darsheed Mustafa (Los Angeles, CA, US)
- Melinda Balbirnie (Los Angeles, CA, US)
- Anton EI Khoury (Sherman Oaks, CA, US)
- Kevin A. Murray (Los Angeles, CA, US)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
A61K47/6923
HUMAN NECESSITIES
International classification
A61K47/69
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
Abstract
Disclosed are agents that include a flavanol (e.g., epigallocatechin-3-gallate) or a flavanol analog, a linker coupled to the flavanol or the flavanol analog, and a carrier (e.g., iron oxide nanoparticle) coupled to the linker. The disclosed agents can be used in methods for destabilizing a tau amyloid fibril, and for treating a tauopathy (e.g., Alzheimer's disease, progressive supranuclear palsy) in a subject.
Claims
1. An agent comprising a flavanol or a flavanol analog, a linker coupled to the flavanol or the flavanol analog, and a carrier coupled to the linker.
2. The agent of claim 1, wherein the flavanol or the flavanol analog comprises a compound selected from Table J.
3. The agent of claim 2, wherein the linker comprises a compound selected from Table L.
4. The agent of any one of claims 1 to 3, wherein the carrier comprises a nanoparticle.
5. The agent of claim 4, wherein the nanoparticle is an iron oxide nanoparticle (IONP).
6. The agent of claim 5, wherein the IONP is selected from Table N.
7. The agent of any one of claims 1 to 6, wherein the carrier comprises a coating that comprises polyethylene glycol (PEG), dextran, starch, chitosan, lipid, citrate, polyaniline, meso-2,3-dimercaptosuccinic acid, poly(maleic anhydride-alt-1-octadecene), polyacrylamide, phosphonate, silica, or a protein or a peptide segment having a sequence that is recognized by membrane-embedded proteins in the brain endothelium for conveying the agent across the blood-brain barrier.
8. The agent of claim 7, wherein the coating comprises dextran, and wherein the dextran comprises dextran-20 kDa, dextran-40 kDa, carboxy dextran, or cross-linked dextran-20 kDa.
9. The agent of claim 7, wherein the coating comprises PEG, optionally wherein the carrier is coupled to the linker via said PEG.
10. The agent of any one of claims 1 to 9, wherein the nanoparticle has a hydrodynamic particle size that is at least 4 nanometers and at most 150 nanometers as measured by dynamic light scattering.
11. The agent of any one of claims 1 to 10, wherein the agent further comprises an anti-amyloid antibody coupled to the carrier, or alternatively coupling to the carrier a peptide segment that targets the agent to an amyloid protein of interest, and potentially interferes with aggregation of the said amyloid by capping the target fibril as an additional mode of amyloid inhibition.
12. The agent of any one of claims 1 to 11, wherein the agent destabilizes a tau amyloid fibril when in contact with said tau amyloid fibril.
13. The agent of any one of claims 1 to 12, wherein the agent is permeable across the blood-brain barrier.
14. A composition for treating a tauopathy, wherein the composition comprises the agent of any one of claims 1 to 13.
15. The composition of claim 14, wherein the composition is effective in treating Alzheimer's disease.
16. A method of preparing the agent of any one of claims 1 to 13, wherein the method comprises reacting the flavanol or the flavanol analog with propargyl bromide, thereby forming a propargylated compound.
17. The method of claim 16, further comprising reacting the propargylated compound with an amino azide and tris((1-benzyl-4-triazolyl)methyl)amine, thereby forming a conjugate of the flavanol or the flavanol analog with a linker.
18. The method of claim 17, further comprising reacting the conjugate with the carrier, thereby covalently attaching the two to each other, to form the agent.
19. A method of treating a tauopathy in a subject, comprising administering to the subject an agent of any one of claims 1 to 13 or the composition of claim 14 or 15.
20. The method of claim 19, wherein said administering is intravenous.
21. The method of claim 19 or 20, wherein said tauopathy comprises Alzheimer's disease.
22. The method of any one of claims 19 to 21, wherein said tauopathy comprises progressive supranuclear palsy or chronic traumatic encephalopathy or other tauopathy.
23. A method of destabilizing a tau amyloid fibril, comprising contacting the tau amyloid fibril with the agent of any one of claims 1 to 13.
24. The method of claim 23, wherein the tau amyloid fibril comprises a paired helical filament.
25. The method of claim 24, wherein the agent dis-aggregates the paired helical filament.
26. The method of claim 23, wherein the agent disrupts ion pairing of lysine at position 340 of tau with respect to SEQ ID NO: 1 by forming at least one hydrogen bond with said lysine.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION OF THE INVENTION
[0038] The disclosed methods relate, at least in part, to structure-based design of a novel class of drugs for Alzheimer's Disease and other tauopathies.
[0039] In the context of Alzheimer's disease, amyloid aggregates of tau are recognized as a cause of the disease. If tau amyloid could be disaggregated, there are strong reasons to believe that the progression of Alzheimer's disease could be halted. Some challenges to developing such a drug are first, to get the drug across the blood-brain-barrier and into neurons where tan aggregates residue, and then to break down the tan aggregates.
[0040] The structure-based design disclosed herein achieves both steps by coupling a natural product amyloid disaggregator, EGCG, via a synthetic linker to iron-oxide nanoparticles that cross the blood-brain-barrier and enter cells. EGCG is a flavonoid in green tea known to somehow disaggregate amyloid, but it has poor drug-like properties and has failed efficacy in clinical trials. The designed construct, alternatively referred to as an agent in this disclosure, links in some embodiments a modified EGCG (or a flavanol or a flavanol analog) with improved in vivo stability to iron oxide nanoparticles that cross the blood-brain-barrier. This design has been enabled by a cryo-electron microscopic determination of the structure of EGCG bound to tau amyloid fibrils. This structure reveals how EGCG binds to and weakens the non-covalent bonds holding tau molecules into the fibril. From the structure one can deduce the moiety of EGCG that is available for linkage to the nanoparticle. The disclosed designs include the linker itself, the linkage site on EGCG (or a flavanol or a flavanol analog), and the nanoparticle.
[0041] EGCG lacks optimal properties for convenient therapeutic use, and has been limited by low brain permeability, poor metabolic stability and significant off-target protein binding. Based on the structure of EGCG bound to fibrils of AD-tau (Seidler P M et al., bioRxiv 2020), we disclose here the design and synthesis of linker-conjugated analogs of EGCG that, when coupled with nanoparticles that are known to cross the blood-brain-barrier and enter cells, retain inhibitory activity towards Alzheimer's tau. Our disclosed EGCG-linker analog conjugates offer a means to improving the drug-like properties of EGCG by reducing binding to metabolic and other off-target globular proteins (
[0042] Our data show that the D-ring of EGCG is amenable to site-specific derivatization for linker conjugation with and subsequent conjugation with the nanoparticle carrier Ferumoxytol. Our design was informed by the cryo-electron microscopic structure of EGCG bound to AD-tau amyloid fibrils (
[0043] We describe here methodology to couple EGCG (or a flavanol or a flavanol analog) with nanoparticles to create an amyloid-specific and metabolically stabilized entity owing to nanoparticle fusion. The EGCG binding sites in globular proteins that account for off-target binding are well studied and reside inside of deep, solvent-excluded pockets that bear no resemblance to the AD-Tau EGCG binding cleft (
[0044] Our approach is to make covalent EGCG-nanoparticle conjugates that exhibit functional binding to AD-tau and restricted binding to off-target globular proteins by virtue of steric clashes between the fused nanoparticle carrier and buried active sites in off-target globular proteins.
[0045] The disclosure, among other things, describes the mechanism of amyloid fibril reversibility that is exerted by the natural product EGCG, as discovered by the disclosed structural study of tau amyloid fibrils that were purified from the brain of an AD patient, complexed with EGCG. From this structure, rules were distilled to guide the discovery and design of small molecules that reverse amyloid fibrils of tau from AD by inducing (a) electrostatic repulsions between layered protein sheets of the AD tau fibril, and (b) physical destabilization of the AD tau fibril by targeting a cryptic inhibitor binding site that resides in the most common tau fibril polymorph in AD patients (see Examples 1 through 6).
[0046] Based on these data, this disclosure (1) delineates moieties of EGCG that are either (a) important for target engagement with AD brain-derived tau fibrils, or (b) dispensable, and hence subjectable to derivatization (
[0047] The disclosed designed constructs (i.e., agents) are amenable to inexpensive production. EGCG is a non-toxic natural product. Iron oxide nanoparticles have been approved by the FDA for several applications, and are non-toxic.
Definitions
[0048] As used in the description, the words “a” and “an” can mean one or more than one. As used in the claims in conjunction with the word “comprising,” the words “a” and “an” can mean one or more than one. As used in the description, “another” can mean at least a second or more.
[0049] The term “treating” includes curing, relieving, or ameliorating to any extent a symptom of an illness or medical condition or preventing further worsening of such a symptom. For example, treating Alzheimer's disease includes making the Alzheimer's disease less severe.
[0050] The phrase “pharmaceutically-acceptable carrier” as used herein means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material. Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the subject. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin: (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol: (12) esters, such as ethyl oleate and ethyl laurate: (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid: (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
[0051] The term “subject” refers to a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
Agents and Compositions
[0052] In some aspects, the present disclosure provides agents that are effective in disaggregating a tau amyloid fibril or that can be used to treat a tauopathy. The agents, in various embodiments, can destabilize a tau amyloid fibril when in contact with the tau amyloid fibril. In some embodiments, the agents are permeable across the blood-brain barrier.
[0053] Such disclosed agents include a flavanol or a flavanol analog, a linker coupled to the flavanol or the flavanol analog, and a carrier coupled to the linker. The flavanol or the flavanol analog can be epigallocatechin-3-gallate (EGCG), a structure of which is depicted in
[0054] In some embodiments, the carrier includes a nanoparticle, such as an iron oxide nanoparticle (IONP). An IONP can further be coated through suitable means, such as those described in Arami H. et al., In vivo delivery, pharmacokinetics, biodistribution and toxicity of iron oxide nanoparticles, Chem Soc Rev. 44(23): 8576-8607 (2015). As an example, the coating may include polyethylene glycol (PEG), dextran (e.g., dextran-20 kDa, dextran-40 kDa, carboxy dextran, or cross-linked dextran-20 kDa), starch, chitosan, lipid, citrate, polyaniline, meso-2,3-dimercaptosuccinic acid, poly(maleic anhydride-alt-1-octadecene), polyacrylamide, phosphonate, or silica. The carrier can be coupled to the linker via the coating, for example via PEG. In some embodiments, the agent can also include an anti-amyloid antibody coupled to the carrier.
[0055] The present disclosure also provides compositions for treating a tauopathy. The compositions, in various embodiments, include the agents described above and in the rest of this disclosure. Such compositions can be effective in treating tauopathies, such as Alzheimer's disease.
[0056] The composition may comprise a carrier (e.g., a pharmaceutically-acceptable carrier, for any of the disclosed embodiments). The pharmaceutical compositions disclosed herein may be delivered by any suitable route of administration (e.g., oral, intravenous), and can be supplied in various forms (e.g., powders, ointments, drops, liquids, gels, tablets, capsules, pills, or creams).
[0057] Below, Table J provides, with further references to other tables or parts of this disclosure, some examples of flavanols or flavanol analogs that can be a part of the described agents. Similarly, Table L provides some examples of linkers, and Table N provides some examples of iron oxide nanoparticles (an example of a carrier).
TABLE-US-00001 TABLE J Examples of flavanols or flavanol analogs Compounds listed in Table A of Example 1 Compounds listed in Table B of Example 1 Compounds 5a, 5b, 5c, 5d, 5e described in Example 5 (which also include a conjugated linker) Compounds listed in the x-axis of FIG. 11 Compounds listed in Table C of Example 6 Compounds listed in Table D of Example 6 Compounds listed in Table E of Example 6 Compounds listed in Table F of Example 6 Compounds listed in Table G of Example 6
TABLE-US-00002 TABLE L Examples of linkers Compounds 4a, 4b, 4c, 4d, 4e described in Example 5 (in pre-conjugated form) Compounds listed in Table H of Example 6 (shown as conjugated to flavanols or flavanol analogs)
TABLE-US-00003 TABLE N Examples of iron oxide nanoparticles (a type of carrier) Polyglucose sorbitol carboxymethylether-coated iron oxide (ferumoxytol) (e.g., ferumoxytol AMI-7228) Carboxydextran-coated iron oxide (ferucarbotran) (e.g., ferucarbotran SHU555A, ferucarbotran SHU555C) Dextran-coated iron oxide (ferumoxtran) (e.g., ferumoxtran-10 AMI-227) Dextran-coated iron oxide (ferumoxide) (e.g., ferumoxide AMI-24) Feruglose NC100150
Methods of Destabilizing a Tau Amyloid Fibril and of Treating a Tauopathy
[0058] In some aspects, the present disclosure provides methods for treating a tauopathy in a subject. Such methods include administering to the subject an effective amount of a composition disclosed in the “Agents and Compositions” section as well as the rest of this disclosure. The administration of the compositions can be intravenous. The treated tauopathy, in some embodiments, includes Alzheimer?s disease and/or progressive supranuclear palsy.
[0059] The selected dosage level, as can be determined by a medical practitioner, will depend upon a variety of factors including the activity of the particular agent employed, the route of administration, the time of administration, the rate of excretion or metabolism of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compound employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0060] The present disclosure also provides methods for destabilizing a tau amyloid fibril. Such methods include contacting the tau amyloid fibril with an agent disclosed in the “Agents and Compositions” section as well as the rest of this disclosure. The tau amyloid fibril may include a paired helical filament, and the used agent can dis-aggregate that paired helical filament, for example by disrupting ion pairing of lysine at position 340 of tau with respect to SEQ ID NO: 1 by forming at least one hydrogen bond with said lysine.
TABLE-US-00004 >SEQ ID NO: 1 MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQ TPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIP EGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADG KTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSG YSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQT APVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSK DNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEI VYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
EXAMPLES
Example 1: CryoEM Reveals how the Small Molecule EGCG Binds to Alzheimer's Brain-Derived Tau Fibrils and Initiates Fibril Disaggregation
[0061] EGCG, the most abundant flavanol in green tea, is one of the few natural compounds known to inhibit amyloid fibril formation of proteins associated with neurodegeneration, and to disaggregate amyloid fibrils. Little is known of the mechanism of molecular action of EGCG, or how it or other small molecules interact with amyloid fibrils. Here we present a 3.9 Å resolution cryoEM structure that reveals the site of EGCG binding to Alzheimer's disease (AD) brain-derived tau fibrils. The structure suggests that EGCG disaggregates fibrils by wedging into a cleft that forms between the two tau protofilaments, and by causing charge repulsions between tau layers of the fibril. In support of this, we observe separation of the protofilaments that EGCG wedges between, and accompanying displacement of the adjacent pi-helix domain. We find that EGCG inhibits pathogenic seeding by human brain extracts from 15 donors with AD, and 7 with progressive supranuclear palsy (PSP). In short, our structure suggests a mechanism for the disaggregation of amyloid fibrils by EGCG, and defines a pharmacophore-like cleft in the AD tau fibril.
Introduction
[0062] Single-particle cryoEM has delivered spectacular structures of protein amyloid fibrils.sup.1-5, including several of Alzheimer's associated tau purified from pathogenic human brain tissues.sup.6-10. These structures offer the opportunity to learn atomic-level details of how small molecules inhibit and disaggregate amyloid fibrils. Epigallocatechin gallate (EGCG), a small molecule natural product in green tea, inhibits aggregation of amyloid proteins, and disaggregates fibrils into smaller units, despite their great stability..sup.11-15 To illuminate the action of EGCG on tau fibrils, we determined the single-particle cryoEM structure of the AD-associated brain-derived paired-helical filament (PHF) polymorph of tau in complex with EGCG.
[0063] Aggregated tau forms fibrillar structures that propagate and cause neurodegeneration by prion-like seeding..sup.16-17 Single-particle cryoEM structures of brain-purified tau from donors with AD show that pathological tau fibrils, like other amyloids, involve combinations of homo- and heteromeric steric zippers with rich p character, strong shape complementarity and tightly interdigitated sidechains.sup.7,9. The structures formed by amyloid fibrils are particularly stable owing to steric zipper interactions, and an extensive network of polarized hydrogen bonds (H-bonds) that forms along the fibril axis..sup.18,19 The binding enthalpies of the resulting amyloid fibril structures rival that of crystalline ice..sup.20 These features give rise to the extreme stability that is characteristic of pathogenic amyloid fibrils, which can withstand heating to boiling temperatures, and resist solubilization in detergents such as sarkosyl. The tremendous stability of pathogenic amyloid explains its ability to seed new fibrils and to evade degradation by cellular machinery; and at the same time, presents the question of how amyloid fibrils can be disaggregated.
[0064] Chaperones function as high molecular weight homo- and heteromeric assemblies that use chemical energy to disaggregate yeast prions and certain amyloid fibrils..sup.21,22 Amyloid disaggregation is an attractive potential therapeutic mechanism of action, and the efficacy of chaperone-mediated disaggregation can be tuned by protein engineering to target pathological aggregates..sup.23,21 Remarkably EGCG, a small molecule natural product, is also reported to inhibit at least 14 different amyloids, in part by disaggregating amyloid fibrils, and also by blocking the aggregation of protein monomers..sup.11-13,15,25
[0065] Despite its potent in vitro anti-amyloid activity. EGCG is not a proven clinical therapeutic. Its lack of clinical efficacy stems from poor drug-like properties, which include limited bioavailability and lack of specificity. In addition, EGCG is known to interact with numerous biomolecules, often with differing ligand poses.sup.26-30, and has been described as a pan-assay interfering compound..sup.31 Thus it is not surprising that EGCG is reported to modulate the activity of dozens of different disease-related pathways and proteins.sup.32. Despite EGCG's limitations as a clinical agent, we sought to understand how EGCG interacts with, and inhibits the AD tau amyloid fibril polymorph. The EGCG binding site we discovered on the AD tau fibril is quite unlike EGCG binding sites in globular proteins, and constitutes a tau amyloid pharmacophore that can possibly be exploited to create and discover alternative AD small-molecule inhibitors with improved drug-like properties.
Selection of a Small Molecule Inhibitor for Structure Determination
[0066] To identify small molecules that interfere with seeding by AD tau fibrils, we screened a panel of 9 compounds that are reported to bind to various amyloids. We found 3 compounds that blocked the ability of tau fibrils purified from AD brain to seed new fibrils in tau biosensor cells (
[0067] EGCG disaggregates tau by stoichiometric binding to fibrils Biochemical and electron microscope studies indicate that EGCG, the best small molecule inhibitor of seeding that we identified (
[0068] We observed no shift in the lag time of tau aggregation, suggesting that EGCG has no inhibitory effect on the tau-K18+ monomer. However, fibrils formed in the presence of EGCG were metastable insomuch as the ThT signal abruptly fell after reaching a plateau at 10 hr (
[0069] To prepare specimens of AD brain-derived tau fibrils for structural studies, we examined negatively stained EM grids of purified tau fibrils from the frontal cortex of AD donor 1 (
CryoEM Structure of AD Tau Fibril Bound to EGCG
[0070] We carried out helical reconstruction of EGCG-treated tau fibrils purified from AD brain donor 1 using unbiased 3D classifications of manually picked particles with a cylindrical reference having an outer diameter of 250 pixels (266 Å). Only the tau PHF polymorph was seen in our 3D reconstructions suggesting that the other known AD tau fibril polymorph, straight filaments, were either particularly sensitive to treatment with EGCG, or too few to observe. It is noteworthy that straight filaments are a minor species in the AD brain..sup.7,9 As shown in
[0071] In addition to patches of conserved density, we observed two new peaks highlighted by yellow-filled arrows in
[0072] Modeling EGCG into the electron density of the 3.9 Å resolution map revealed a single inhibitor pose shown in
Validation of the EGCG Binding Cleft
[0073] The model of EGCG bound to the AD brain-derived tau fibril shown in
[0074] We tested the ability of EGCG to disrupt fibrils of PHFE2, which harbors the putative EGCG binding cleft. The results, shown in
Identification of Alternative Disaggregator of Tau Improved Drug-Like Properties Based on the AD-Tau Pharmacophore
[0075] An alternative route to a clinically promising inhibitor is to discover surrogate brain-penetrating small molecule disaggregators of AD-tau with drug-like properties that are better than EGCG. Towards that end, we screened a carefully curated subset of small molecule by in silico docking using the AD-tau pharmacophore that is defined by the EGCG binding cavity. To increase the chances of identifying small molecule surrogates that are more amenable for clinical translation, we carried out in silico docking using compound libraries that derived from (1) a subset of compounds from LOPAC (Library of Pharmacologically Active Compounds) that were pre-filtered on the basis of having predicted brain-penetration, and (2) ChemBridge CNS-set, a library containing drug-like compounds that have increased probability of brain-penetration and oral bioavailability. Docking was carried using AutoDock for both FDA-approved compounds from LOPAC, and the CNS-set library. For the LOPAC library of FDA-approved compounds, docking was also carried out with RosettaDock, which yielded a slightly different ranking of top-scoring compounds. The 25 best-scoring compounds each docking experiment are shown below. It is possible that any of these could compounds that are discovered based on the reported AD-tau pharmacophore could serve as valuable lead compounds, given their established drug-like properties and predicted activity as disaggregators of AD-tau.
TABLE-US-00005 TABLE A FDA-approved FDA-approved hit compounds hit compounds Rank (RosettaDock) (AutoDock) 1 Docarpamine Ergotamine 2 Gliquidone BMS-201038, Lomitapide 3 Arteflene Dihydroergotamine nasal 4 Naratriptan Temoporfin 5 Fudosteine Tasosartan 6 Lanoconazole Candesartan 7 Nizatidine Everolimus 8 Acetohexamide Dihydroergocristine 9 Phytonadione Dutasteride 10 Sarecycline Amlexanox 11 Tubocurarine Teniposide 12 Phentermine Saprisartan 13 Levobupivacaine Ingenol mebutate 14 Isoetharine MK-8228, Letermovir 15 Prolixin decanoate Eltrombopag 16 Sulfamethazine Conivaptan 17 Isosorbide Mononitrate Irbesartan 18 Travoprost Fenquizone 19 Natamycin Cyclothiazide 20 Phenylbutazone Suvorexant 21 Agrimophol Raltegravir 22 Trimetrexate Ajmalicine 23 Sodium cromoglycate Dihydroergotamine 24 Imipramine Idarubicin 25 Zolmitriptan Daunorubicin
TABLE-US-00006 TABLE B Rank CNS-set hit compounds (AutoDock) 1 10,12-dimethyl-10,12-dihydro-7H,11H-benzo[de]imidazo[4′,5′:5,6]benzimidazo [2,1-a]isoquinoline-7,11-dione 2 2-(7-phenyl[1,2,4]triazolo[1,5-a]pyrimidin-2-yl)-1H-isoindole-1,3(2H)-dione 3 6-chloro-3-[5-(3-fluorophenyl)-1,3,4-oxadiazol-2-yl]-2H-chromen-2-one 4 4-(4-fluorophenyl)-2-methyl-5-oxo-N-2-pyridinyl-1,4,5,6,7,8-hexahydro-3- quinolinecarboxamide 5 4-(3-methoxyphenyl)-2-methyl-5-oxo-N-2-pyridinyl-1,4,5,6,7,8-hexahydro-3- quinolinecarboxamide 6 2-methyl-4-(2-methylphenyl)-N-(6-methyl-2-pyridinyl)-5-oxo-1,4,5,6,7,8- hexahydro-3-quinolinecarboxamide 7 9-(1,3-benzodioxol-5-yl)-3,3,6,6-tetramethyl-3,4,6,7,9,10-hexahydro-1,8(2H,5H)- acridinedione 8 2-methyl-N-(6-methyl-2-pyridinyl)-5-oxo-4-(3-pyridinyl)-1,4,5,6,7,8-hexahydro- 3-quinolinecarboxamide 9 N-(tert-butyl)-N-(difluoromethyl)-4-methylbenzenesulfonamide 10 6-bromo-3-(3,4-dihydro-2(1H)-isoquinolinylcarbonyl)-2H-chromen-2-one 11 N-mesityl-2-(3-oxoindeno[1,2,3-de]phthalazin-2(3H)-yl)acetamide 12 1-(3-chlorophenyl)-3-(3,5-dimethylphenyl)tetrahydro-1H-thieno[3,4-d]imidazol- 2(3H)-one 5,5-dioxide 13 N-(4-methyl-2-pyridinyl)-2-[(5-methyl-5H-[1,2,4]triazino[5,6-b]indol-3-yl)thio] acetamide 14 2-methyl-4-(4-methylphenyl)-N-(4-methyl-2-pyridinyl)-5-oxo-1,4,5,6,7,8- hexahydro-3-quinolinecarboxamide 15 2-methyl-5-oxo-N-2-pyridinyl-4-(2-thienyl)-1,4,5,6,7,8-hexahydro-3- quinolinecarboxamide 16 N-(6-methyl-2-pyridinyl)-2-oxo-2H-chromene-3-carboxamide 17 N-[3-(trifluoromethyl)phenyl]-10H-phenothiazine-10-carboxamide 18 2-phenyl-4,5,6,7-tetrahydro-8H-cyclopenta[d]pyrazolo[1,5-a]pyrimidin-8-one 19 N-[5-(3-methyl-4-oxo-3,4-dihydro-1-phthalazinyl)-2-(1-piperidinyl)phenyl] acetamide 20 5,14-dioxo-5,14-dihydrobenzo[5,6]indolo[1,2-b]isoquinoline-13-carbonitrile 21 N-(2-methoxy-5-methylphenyl)-2-(2-oxobenzo[cd]indol-1(2H)-yl)acetamide 22 3-(1H-benzimidazol-1-yl)-1-(2,4-dimethylphenyl)-2,5-pyrrolidinedione 23 3-(2,3-dihydro-1,4-benzodioxin-2-yl)-6-phenyl-7H-[1,2,4]triazolo[3,4-b][1,3,4] thiadiazine 24 2-[3-(3-methylphenyl)-1,2,4-oxadiazol-5-yl]-N-(3-pyridinylmethyl)benzamide 25 N-(2-methoxyphenyl)-3-oxo-3H-benzo[f]chromene-2-carboxamide
Discussion
[0076] The EGCG inhibitor binding cleft on the tau PHF is quite unlike binding sites of small molecules on globular and membrane proteins.sup.26-30. Firstly, it is not a single site, but rather is a contiguous column that is created by thousands of stacked inhibitor binding clefts. Secondly, each of these many clefts bristles with charged and polar sidechains, ready to form hydrogen bonds with some of the 11 hydrogen-bond acceptors, and 8 hydrogen-bond donors on EGCG.
[0077] Our Wedge-Charge-Neutralization hypothesis is shown in
[0078] EGCG binding at the protofilament junction also destabilizes the tau PHF by forcing apart the two protofilaments that form the dimer interface (
[0079] In summary, the structure of EGCG bound to AD brain-derived tau fibrils illustrates how an exceptionally rich H-bonding molecule that nestles between protofilaments of amyloid fibrils can weaken interactions that otherwise stabilize fibrils. In addition, the structure defines what might be termed a pathogenic amyloid pharmacophore. Previous suggestions of how small molecules interact with, and inhibit fibrils have been mainly limited to computational docking. The structure of the pharmacophore of the AD brain-derived tau PHF opens the door to informed screening and the design of small molecules with drug-like properties.
Example 2: Experimental Methods for Example 1
Recombinant Protein Expression and Purification
[0080] Human Tau tau-K18+(residues Q244-E380 of 4R tau) was expressed in a pNG2 vector in BL21-Gold E. coli cells grown in LB to an OD600=0.8. Cells were induced with 0.5 mM IPTG for 3 hours at 37° C. and lysed by sonication in 20 mM MES buffer (pH 6.8) with 1 mM EDTA, 1 mM MgCl.sub.2, 1 mM DTT and HALT protease inhibitor before addition of NaCl 500 mM final concentration. Lysate was boiled for 20 minutes and the clarified by centrifugation at 15,000 rpm for 15 minutes and dialyzed to 20 mM MES buffer (pH 6.8) with 50 mM NaCl and 5 mM DTT. Dialyzed lysate was purified on a 5 ml HighTrap SP ion exchange column and eluted over a gradient of NaCl from 50 to 550 mM. Protein was polished on a HiLoad 16/600 Superdex 75 pg in 10 mM Tris (pH 7.6) with 100 mM NaCl and 1 mM DTT, and concentrated to ˜20-60 mg/ml by ultrafiltration using a 3 kDa cutoff.
Preparation of Crude and Purified Brain-Derived Tau Seeds
[0081] Tissue for neuropathologically confirmed tauopathy cases from brain regions indicated in the figure legend were fresh-frozen, and extracted without freeze-thaw. A brief description of the characteristics of each donor is provided in Table 1. Tissue was cut into a 0.2-0.3 g section on a block of dry ice, and then manually homogenized in a 15 ml disposable tube in 1 ml of 50 mM Tris, pH 7.4 with 150 mM NaCl containing 1×HALT protease inhibitor. Samples were then aliquoted to PCR tubes and sonicated in a cuphorn bath for 120 min under 30% power at 4° C. in a recirculating ice water bath, according to reference.sup.37. For purification of PHFs and SFs from AD brain tissue, extractions were performed according to the previously published protocol without any modifications.sup.9.
CryoEM Data Collection and 3D Reconstruction
[0082] AD brain purified tau fibrils were applied to negatively glow-discharged Quantifoil 1.2/1.3 electron microscope grids (2.6 μl for 1 min), and subsequently plunge-frozen in liquid ethane on a Vitrobot Mark IV (FEI). Data were collected on a Titan Krios (FEI) microscope equipped with a Gatan Quantum LS/K2 Summit direct electron detection camera (operated with 300 kV acceleration voltage and slit width of 20 eV). Counting mode movies were collected on a Gatan K2 Summit direct electron detector with a nominal physical pixel size of 1.07 Å per pixel with a dose per frame 1.26 e-/Å2. A total of 30 frames with a frame rate of 5 Hz were taken for each movie, resulting in a final dose 38 e-/Å2 per image. Automated data collection was driven by the Leginon automation software package..sup.38
[0083] Data were processed as described by Boyer et al..sup.1 Briefly. CTF estimation was performed using CTFFIND 4.1.8.sup.39, and Unblur.sup.40 was used to correct beam-induced motion. Particle picking was performed manually using EMAN2 e2helixboxer.py.sup.41, and particles were extracted and classified in RELION.sup.42 using the 90% overlap scheme. Particles were extracted using a 686-pixel box size for 2D classifications and a first series of 3D classifications. Typically, we performed Class3D jobs with K=3 and manual control of the tau_fudge factor and healpix to reach a resolution of ˜5-6 Å to select for particles that contributed to the highest resolution class. The deposited maps and atomic coordinates derived from the subset of particles of 3D classification with a 686-pixel box size, re-extracted using a 432-pixel box. Two subsequent rounds of 3D classification were carried out for the 432-pixel box, followed by a single K=1 Class3D job. We performed the map-map Fourier shell correlation (FSC) with a generous, soft-edged solvent mask and high-resolution noise substitution in RELION PostProcess, resulting in a resolution estimate of 3.9 Å with a 0.5 FSC cutoff.
Atomic Model Building
[0084] The highest resolution structure of an AD-brain derived tau PHF (PDB 6HRE) was used as a starting model for atomic model building. Coordinates were docked in the 3.9 Å electron density map as a rigid body, and minor fitting was performed in COOT.sup.43. EGCG was modeled into the electron density by first rigid body docking from molecule KDH 911 of PDB 4AWM and subsequent real space refinement. Fibril layers were modeled to maintain local contacts between chains in the fibril during structure refinement. We performed automated structure refinement using phenix.real_space_refine.sup.44.
Inhibitor Screening in Tau Biosensor Cells
[0085] HEK293 cell lines stably expressing tau-K18 P301 S-eYFP were engineered by Marc Diamond's lab at UTSW.sup.17 and used without further characterization or authentication. Cells were maintained in DMEM (Life Technologies, cat. 11965092) supplemented with 10% (vol/vol) FBS (Life Technologies, cat. A3160401), 1% penicillin/streptomycin (Life Technologies, cat. 15140122), and 1% Glutamax (Life Technologies, cat. 35050061) at 37° C., 5% CO2 in a humidified incubator. Fibrils and patient-derived seeds were incubated for 16 hours with indicated inhibitor to yield a final inhibitor concentration of 10 μM (on the biosensor cells), except for IC50 determinations, which instead used adjustments to achieve the final indicated inhibitor concentration. Note that the IUPAC name of the chalcone inhibitor used is 3-(4-methylphenyl)-1-(3-nitrophenyl)-prop-2-en-1-one. For seeding, inhibitor-treated seeds were sonicated in a cuphorn water bath for 3 minutes, and then mixed with 1 volume of Lipofectamine 3000 (Life Technologies, cat. 11668027) prepared by diluting 1 μl of Lipofectamine in 19 μl of OptiMEM. After twenty minutes, 10 μl of fibrils were added to 90 μl of tau biosensor cells. The number of seeded aggregates was determined by imaging the entire well of a 96-well plate in triplicate using a Celigo Image Cytometer (Nexcelom) in the YFP channel. Aggregates were counted using ImageJ.sup.45 by subtracting the background fluorescence from unseeded cells and then counting the number of peaks with fluorescence above background using the built-in Particle Analyzer. The number of aggregates was normalized to the confluence of each well, and dose-response plots were generated by calculating the average and standard deviations from triplicate measurements. For high quality images, cells were photographed on a ZEISS Axio Observer D1 fluorescence microscope using the YFP fluorescence channel.
ThT Aggregation Kinetics Assay
[0086] Concentrated tau-K18+ was diluted into PBS buffer (pH 7.4) to a final concentration of 20 μM with an equimolar ratio of indicated small molecule inhibitor. Proteins were shaken in solutions containing 40 μM ThT, 0.225 mg/ml heparin (Sigma cat. H3393), and 1 mM DTT in a 96-well plate with a plastic bead to enhance agitation. ThT fluorescence was measured with excitation and emission wavelengths of 440 and 480 nm, and averaged curves were generated from triplicate measurements as indicated in the figure legend. Error bars show the standard deviation of replicates measurements. For endpoint ThT
Peptide Fibril Formation and ThT Measurements
[0087] PHFE2 peptide was disaggregated in water to a concentration of 120 mg/ml (80 mM), and the concentrated peptide stock was subsequently diluted to 100 mg/ml (66 mM) by addition of water and 10×PBS (to a final concentration of 1×PBS). Fibrils were grown at 37° C. in an orbital shaker with shaking at 350 rpm for 3-4 weeks. Solutions were removed from shaking and heat upon appearance of fibrils, confirmed by negative stain EM. For ThT experiments, fibrils were diluted to 30 mM in PBS, and ThT was added to a final concentration of 40 μM. EGCG was added from a concentrated stock to a final concentration of 5 mM where indicated. ThT measurements were carried out as described above, except readings were taken from a 384-well plate with a volume of 35 μl.
REFERENCES FOR EXAMPLES 1 AND 2
[0088] 1. Boyer, D. R. et al. Structures of fibrils formed by α-synuclein hereditary disease mutant H50Q reveal new polymorphs. Nature Structural & Molecular Biology 26, 1044-1052, doi:10.1038/s41594-019-0322-y (2019). [0089] 2. Gallagher-Jones, M. et al. Sub-ångström cryo-EM structure of a prion protofibril reveals a polar clasp. Nature structural & molecular biology 25, 131-134, doi:10.1038/s41594-017-0018-0 (2018). [0090] 3. Guerrero-Ferreira, R. et al. Two new polymorphic structures of alpha-synuclein solved by cryo-electron microscopy. bioRxiv, 654582, doi:10.1101/654582 (2019). [0091] 4. Iadanza, M. G. et al. The structure of a β2-microglobulin fibril suggests a molecular basis for its amyloid polymorphism. Nature Communications 9, 4517, doi:10.1038/s41467-018-06761-6 (2018). [0092] 5. Li, B. et al. Cryo-EM of full-length α-synuclein reveals fibril polymorphs with a common structural kernel. Nature communications 9, 3609-3609, doi:10.1038/s41467-018-05971-2 (2018). [0093] 6. Falcon, B. et al. Structures of filaments from Pick's disease reveal a novel tau protein fold. Nature 561, 137-140, doi:10.1038/s41586-018-0454-y (2018). [0094] 7. Falcon, B. et al. Tau filaments from multiple cases of sporadic and inherited Alzheimer's disease adopt a common fold. Acta neuropathologica 136, 699-708, doi:10.1007/s00401-018-1914-z (2018). [0095] 8. Falcon, B. et al. Novel tau filament fold in chronic traumatic encephalopathy encloses hydrophobic molecules. Nature 568, 420-423, doi:10.1038/s41586-019-1026-5 (2019). [0096] 9. Fitzpatrick, A. W. P. et al. Cryo-EM structures of tau filaments from Alzheimer's disease. Nature 547, 185-190, doi:10.1038/nature23002 (2017). [0097] 10. Kollmer, M. et al. Cryo-EM structure and polymorphism of A amyloid fibrils purified from Alzheimer's brain tissue. Nature Communications 10, 4760, doi:10.1038/s41467-019-12683-8 (2019). [0098] 11. Andrich, K. & Bieschke, J. The Effect of (−)-Epigallo-catechin-(3)-gallate on Amyloidogenic Proteins Suggests a Common Mechanism. Adv Exp Med Biol 863, 139-161, doi:10.1007/978-3-319-18365-7_7 (2015). [0099] 12. Bieschke, J. et al. EGCG remodels mature α-synuclein and amyloid-O fibrils and reduces cellular toxicity. Proceedings of the National Academy of Sciences 107, 7710-7715, doi:10.1073/pnas.0910723107 (2010). [0100] 13. Chirita, C., Necula, M. & Kuret, J. Ligand-Dependent Inhibition and Reversal of Tau Filament Formation. Biochemistry 43, 2879-2887, doi:10.1021/bi036094h (2004). [0101] 14. Kocisko, D. A. et al. New Inhibitors of Scrapie-Associated Prion Protein Formation in a Library of 2,000 Drugs and Natural Products. Journal of Virology 77, 10288, doi:10.1128/JVI.77.19.10288-10294.2003 (2003). [0102] 15. Townsend. D. et al. Epigallocatechin-3-gallate remodels apolipoprotein A-I amyloid fibrils into soluble oligomers in the presence of heparin. The Journal of biological chemistry 293, 12877-12893, doi:10.1074/jbc.RA 118.002038 (2018). [0103] 16. Clavaguera, F. et al. Brain homogenates from human tauopathies induce tau inclusions in mouse brain. Proceedings of the National Academy of Sciences of the United States of America 110, 9535-9540, doi:10.1073/pnas.1301175110 (2013). [0104] 17. Sanders, David W. et al. Distinct Tau Prion Strains Propagate in Cells and Mice and Define Different Tauopathies. Neuron 82, 1271-1288, doi:http://dx.doi.org/10.1016/j.neuron.2014.04.047 (2014). [0105] 18. Eisenberg, D. & Jucker, M. The amyloid state of proteins in human diseases. Cell 148, 1188-1203, doi:10.1016/j.cell.2012.02.022 (2012). [0106] 19. Wiltzius, J. J. W. et al. Molecular mechanisms for protein-encoded inheritance. Nat Struct Mol Biol 16, 973-978, doi:http://www.nature.com/nsmb/journal/v16/n9/suppinfo/nsmb.1643_S1.html (2009). [0107] 20. Tsemekhman, K., Goldschmidt, L., Eisenberg, D. & Baker, D. Cooperative hydrogen bonding in amyloid formation. Protein science: a publication of the Protein Society 16, 761-764, doi:10.1110/ps.062609607 (2007). [0108] 21. Michalska, K. et al. Structure of Calcarisporiella thermophila Hsp104 Disaggregase that Antagonizes Diverse Proteotoxic Misfolding Events. Structure 27, 449-463.c447, doi:https://doi.org/10.1016/j.str.2018.11.001 (2019). [0109] 22. Shorter, J. & Lindquist, S. Hsp104, Hsp70 and Hsp40 interplay regulates formation, growth and elimination of Sup35 prions. The EMBO Journal 27, 2712-2724, doi:10.1038/emboj.2008.194 (2008). [0110] 23. Jackrel, M. E. & Shorter, J. Reversing deleterious protein aggregation with re-engineered protein disaggregases. Cell Cycle 13, 1379-1383, doi:10.4161/cc.28709 (2014). [0111] 24. Tariq, A. et al. Mining Disaggregase Sequence Space to Safely Counter TDP-43, FUS, and & #x3b1; —Synuclein Proteotoxicity. Cell Reports 28, 2080-2095.c2086, doi:10.1016/j.celrep.2019.07.069 (2019). [0112] 25. Eisele, Y. S. et al Targeting protein aggregation for the treatment of degenerative diseases. Nature reviews. Drug discovery 14, 759-780, doi:10.1038/nrd4593 (2015). [0113] 26. Kowalinski, E. et al. Structural analysis of specific metal chelating inhibitor binding to the endonuclease domain of influenza pH IN 1 (2009) polymerase. PLoS Pathog 8, e100283l-e1002831, doi:10.1371/joumal.ppat.1002831 (2012). [0114] 27. Miyata, M. et al. The Crystal Structure of the Green Tea Polyphenol (−)-Epigallocatechin Gallate-Transthyretin Complex Reveals a Novel Binding Site Distinct from the Thyroxine Binding Site. Biochemistry 49, 6104-6114, doi:10.1021/bi1004409 (2010). [0115] 28. Robertson, 1. M., Li, M. X. & Sykes, B. D. Solution structure of human cardiac troponin C in complex with the green tea polyphenol, (−)-epigallocatechin 3-gallate. The Journal of biological chemistry 284, 23012-23023, doi:10.1074/jbc.M109.021352 (2009). [0116] 29. Skrzypczak-Jankun, E., Zhou, K. & Jankun, J. Inhibition of lipoxygenase by (−)-epigallocatechin gallate: X-ray analysis at 2.1 Å reveals degradation of EGCG and shows soybean LOX-3 complex with EGC instead. Int J Mol Med 12, 415-420 (2003). [0117] 30. Urusova, D. V. et al. Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1. Cancer Prev Res (Phila) 4, 1366-1377, doi:10.1158/1940-6207.CAPR-11-0301 (2011). [0118] 31. Baell, J. B. Feeling Nature's PAINS: Natural Products, Natural Product Drugs, and Pan Assay Interference Compounds (PAINS). Journal of Natural Products 79, 616-628, doi:10.1021/acs.jnatprod.5b00947 (2016). [0119] 32. Negri, A., Naponelli, V., Rizzi, F. & Bettuzzi, S. Molecular Targets of Epigallocatechin-Gallate (EGCG): A Special Focus on Signal Transduction and Cancer. Nutrients 10, 1936, doi:10.3390/nu10121936 (2018). [0120] 33. Seidler, P. M. et al. Structure-based inhibitors halt prion-like seeding by Alzheimer's disease- and tauopathy-derived brain tissue samples. Journal of Biological Chemistry, doi:10.1074/jbc.RA 119.009688 (2019). [0121] 34. Arakhamia, T. et al. Posttranslational Modifications Mediate the Structural Diversity of Tauopathy Strains. Cell, doi:10.1016/j.cell.2020.01.027. [0122] 35. Boyer, D. R. & Eisenberg, D. S. A structure-based model for the electrostatic interaction of the N-terminus of protein tau with the fibril core of Alzheimer's Disease filaments. bioRxiv, 484279, doi:10.1101/484279 (2018). [0123] 36. Röder, C. et al. Atomic structure of PI3-kinase SH3 amyloid fibrils by cryo-electron microscopy. Nature Communications 10, 3754, doi:10.1038/s41467-019-11320-8 (2019). [0124] 37. Kaufman, S. K., Del Tredici, K., Thomas, T. L., Braak, H. & Diamond, M. I. Tau seeding activity begins in the transentorhinal/entorhinal regions and anticipates phospho-tau pathology in Alzheimer's disease and PART. Acta Neuropathologica 136, 57-67, doi:10.1007/s00401-018-1855-6 (2018). [0125] 38. Carragher, B. et al. Leginon: An Automated System for Acquisition of Images from Vitreous Ice Specimens. J Struct Biol 132, 33-45, doi:https://doi.org/10.1006/jsbi.2000.4314 (2000). [0126] 39. Rohou, A. & Grigorieff, N. CTFFIND4: Fast and accurate defocus estimation from electron micrographs. J Struct Biol 192, 216-221, doi:10.1016/j.jsb.2015.08.008 (2015). [0127] 40. Grant, T. & Grigorieff, N. Measuring the optimal exposure for single particle cryo-EM using a 2.6 Å reconstruction of rotavirus VP6. eLife 4, e06980-e06980, doi:10.7554/eLife.06980 (2015). [0128] 41. Tang, G. et al. EMAN2: An extensible image processing suite for electron microscopy. J Struct Biol 157, 38-46, doi:https://doi.org/10.1016/j.jsb.2006.05.009 (2007). [0129] 42. Scheres, S. H. W. RELION: Implementation of a Bayesian approach to cryo-EM structure determination. J Struct Biol 180, 519-530, doi:https://doi.org/10.1016/j.jsb.2012.09.006 (2012). [0130] 43. Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. Features and development of Coot. Acta Crystallographica Section D 66, 486-501, doi:doi:10.1107/S0907444910007493 (2010). [0131] 44. Afonine, P. V. et al. Real-space refinement in PHENIX for cryo-EM and crystallography. Acta Crystallographica Section D 74, 531-544, doi:doi:10.1107/S2059798318006551 (2018). [0132] 45. Schneider. C. A. R., W. S. & Eliceiri, K. W. NIH Image to ImageJ: 25 years of image analysis. Nature methods 9, 671-675 (2012).
Example 3: Tables for Examples 1 and 2
[0133]
TABLE-US-00007 TABLE 1 Description of brain tissue donor characteristics. Brain Age at Neuropath Bank Sex death Diagnosis Brain Region MAYO AD1 M 68 AD Middle frontal UCLA AD2 F 78 AD Frontal cortex AD3 M 71 AD Frontal cortex AD4 F 62 AD Hippocampus AD5 F 91 AD Hippocampus AD6 M 75 AD Cerebellum UCSF AD7 F 58 AD Inferior temporal gyrus AD8 F 69 AD Inferior temporal gyrus AD9 M 70 AD Inferior temporal gyrus AD10 F 65 AD Inferior temporal gyrus AD11 M 72 AD Inferior temporal gyrus AD12 M 77 AD Inferior temporal gyrus AD13 M 66 AD Inferior temporal gyrus AD14 F 64 AD Inferior temporal gyrus AD15 M 68 AD Inferior temporal gyrus UCSF PSP1 F 76 PSP Inferior frontal gyrus PSP2 F 78 PSP Inferior frontal gyrus PSP3 F 72 PSP Inferior frontal gyrus PSP4 F 69 PSP Inferior frontal gyrus PSP5 M 71 PSP Inferior frontal gyrus PSP6 F 70 PSP Inferior frontal gyrus PSP7 F 71 PSP Inferior frontal gyrus
[0134] In Table 1, for donors with multiple brain regions assayed, subsequent cells with sex, age and diagnosis are left blank and are the same as those given in the nearest row above.
TABLE-US-00008 TABLE 2 Cryo-EM data collection, refinement, and validation statistics. Tau Paired helical filament from Alzheimer's disease Name brain complexed with EGCG PDB ID PDB ID 6W9B EMDB ID EMD-21581 Data collection Magnification ×130,000 Defocus range (um) 1.8-2.25 Voltage (kV) 300 Camera K2 Summit (Quantum LS) Frame exposure time (s) 0.2 # movie frames 30 Total electron dose (e−/Å.sup.2) 37.8 Pixel size (Å) 1.07 Reconstruction Box size (pixel) 432 Inter-box distance (Å) 43.2 # micrograph collected 6,988 # segments extracted 137,008 # segments after Class2D N/A # segments after Class3D 19,995 Resolution (Å) 3.9 Map sharpening B-factor (Å.sup.2) 0 Helical rise (Å) 2.41 Helical twist (°) 179.49 Point Group C.sub.1 Atomic model # non-hydrogen atoms 2480 # protein residues 304 R.m.s.d. bonds (Å) R.m.s.d. angles (°) Molprobity clashscore, all atoms 11.1 Molprobity score 2.1 Poor rotamers (%) 0 Ramachandran outliers (%) 0 Ramachandran allowed (%) 9.0 Ramachandran favored (%) 91.0 Cβ deviations > 0.25 Å (%) 0 Bad bonds (%) 0 Bad angles (%) 0
Example 4: Improved Lead Compounds
[0135] Additional supporting evidence that the pharmacophore that is defined by EGCG can be used to discover tau inhibitor molecules that have improved drug-like properties is provided in
Example 5: Catalytic Synthesis of PEGylated EGCG Conjugates that Disaggregate Alzheimer's Tau
[0136] The naturally occurring flavonoid (−)-epigallocatechin gallate (EGCG) is a potent disaggregant of tau fibrils. Guided by the recent cryo-electron microscopy (cryoEM) structure of EGCG bound to fibrils of tau derived from an Alzheimer's brain donor, we report methods to site-specifically modify the EGCG D-ring with aminoPEGylated linkers. The resultant molecules inhibit tau fibril seeding in Alzheimer's brain extracts. Formulations of aminoPEGylated EGCG conjugated to the (quasi)-brain-penetrant nanoparticle Ferumoxytol inhibit seeding by AD-tau with linker length affecting activity. The protecting group free catalytic cycloaddition of amino azides to mono propargylated EGCG described here provides a blueprint for access to stable nanoparticulate forms of EGCG potentially useful as therapeutics to eliminate Alzheimer's-related tau tangles.
[0137] Alzheimer's disease (AD) is the 6.sup.th leading cause of death in the United States and 7.sup.th in the world. Personal and economic burdens associated with this most common type of dementia are enormous. Approximately 6.8 million Americans currently suffer from the disease. By 2050, its annual costs to the healthcare system are anticipated to reach $1.1 trillion..sup.2 Despite decades of research and numerous attempts at treatment, much is still unknown about the etiology of Alzheimer's. Two main markers have been identified: plaques of aggregated β-amyloid and neurofibrillary tangles of tau. However, the precise cause of cognitive decline and effective drug targets have been elusive. Early focus on β-amyloid led to clinical trials of multiple therapeutic candidates with limited success..sup.3 Those failed trials called into question the hypothesis that amyloid plaques play a decisive role in cognitive decline. Recent advances in imaging.sup.4 showed tau tangles to be the best predictors of Alzheimer's progression as well as the species responsible for driving brain atrophy. Oligomeric and fibrillar tau appear to be promising targets for therapeutics.
[0138] The polyphenolic flavanoid (−)-epigallocatechin gallate (EGCG) inhibits aggregation of proteins involved in neurogenerative amyloidoses including huntingtin, amyloid-β and α-synuclein..sup.5 Wobst et al.sup.6 reported EGCG blocks the fibrillization of tan by sequestering unfolded protein monomers. Recently, cryoEM was used to determine the binding site for EGCG on fibrils of tau deriving from the brain tissue of a donor with AD..sup.7 Relative to the apo AD-tau fibril, the bound form contains EGCG wedged into an interfacial cleft (
[0139] The structure of EGCG bound to AD tau indicated positions on the small molecule that might serve as anchor points for nanoparticle conjugation, wherein the ability to bind tau fibrils would be retained. Despite numerous reports of therapeutic potential for EGCG, the compound is prone to auto-oxidation, has poor pharmacokinetics and is largely excluded from the brain when administered systemically. Stable conjugation to brain penetrant nanoparticles was seen as potential means to offset those limitations..sup.8 We selected Ferumoxytol as a nanoparticle carrier. Ferumoxytol exhibits moderate brain penetration, with penetration increasing coincident with pathologies that alter the neurovascular unit.
[0140] As best modeled (
[0141] Wang and co-workers had reported that a sodium salt of EGCG reacted with propargyl bromide in DMF at 80° C. to afford predominately A-ring mono-ether 2, along with lesser amounts of further propargylated compounds..sup.9 We repeated this reaction and found spectroscopic data for the major etherification product was inconsistent with structure 2. HMBC spectra showed a correlation between the propargylic methylene protons (OCH.sub.2, 4.76 ppm) and C-4″ (137.0 ppm). C4″ exhibited coupling with C2″-H (6.89 ppm), and C2″-H also correlated to the carbonyl carbon (165.7 ppm). C5 (95.2 ppm), the linkage site assigned in 2, exhibited correlations to C6-H and the C4 methylene protons, but not to the propargyl group or D ring aryl protons. These data indicated the proper structure assignment should be ether 3, wherein alkylation had occurred at the para phenol of the gallate ester. This phenol is presumably the most acidic in EGCG.
[0142] A second product isolated from the reaction was doubly etherified (see SI for structure) and showed HMBC correlations between a second propargylic methylene (OCH.sub.2, 4.67 ppm) and C4′ (137.0 ppm), and between C4′ and C2′-H (6.53 ppm). Data indicated the second propargyl ether formed on Ring C. The phenols on Ring A appeared to be the least susceptible to alkylation under basic conditions.
[0143] With the structure of 3 confirmed, conditions were screened to optimize its formation while avoiding the use of NaH in DMF—a potentially explosive combination, particularly when heated..sup.10 It was eventually found that treating EGCG with 1 eq. propargyl bromide and 0.5 eq. powdered K.sub.2CO.sub.3 in DMF at room temperature afforded 3 in 45% isolated yield—versus the 33% yield obtained using the NaH/DMF procedure.
[0144] We next synthesized a set of glycol based ω-amino azides with chain lengths varying from 5 to 17 atoms (4a-e, see Table 4 and experimental section for details) in order to produce EGCG conjugates with incrementally increasing chain lengths. Cycloaddition reaction conditions were first optimized with 4c using copper catalysis (Table 3)..sup.11 Standard conditions.sup.12 using catalytic Cu(II) and sodium ascorbate in aqueous THF (Table 3, entries 1 & 2), failed to cycloadd 4c to 3 due to substrate insolubility. When THF was replaced with tBuOH, desired triazole 5c was detected, but only in trace quantities (entry 3). An attempt to replace sodium ascorbate with Cu°.sup.13 was unsuccessful (entry 4), as was the use of stoichiometric Cu(I) (entry 6). Notably, when stoichiometric amounts of CuSO.sub.4 were employed (entry 5), starting materials were consumed and a highly insoluble precipitate formed. The use of H.sub.2O/DMSO cosolvent mixture resulted in the formation of the product in 12% yield (entry 7), which remained unchanged even in the presence of excess aminoazide partner (entry 8). We suspected this material was a copper/product complex and hypothesized that earlier attempts at catalysis may have been poisoned by amino polyphenol 5c. To fortify the copper catalyst against possible product sequestration, we turned to polydentate ligands reported by Sharpless..sup.14 Gratifyingly, in the presence tris((I-benzyl-4-triazolyl)methyl)amine (TBTA), 20 mol % of CuSO.sub.4 rapidly catalyzed the cycloaddition of 4c to 3 in H.sub.2O/DMSO at room temperature to afford triazole adduct 5c in 52% isolated yield (entry 9). When the catalyst load was decreased from 20 to 5 mol %, isolated yield decreased, and conversion plateaued at roughly 80%. The reactions required no workup and product was easily purified as its TFA salt via preparative reverse-phase HPLC (see experimental section for details).
[0145] Using the conditions shown in Table 3, entry 9, a set of EGCG conjugates having increasing chain lengths were synthesized (Table 4). As the number of glycol units increased, the yield of triazole products 5 decreased slightly. But in all cases, analytically pure product was isolated readily using preparative reversed phase HPLC.
[0146] Interestingly, when analyzing amine salts 5 by .sup.1H NMR in protic solvents (i.e. CD.sub.3OD or D.sub.2O), the aryl protons in the A-ring (5.93 ppm) quickly disappeared. Their integration (relative to stable resonances) decreased ˜75% in 3 hours. Overnight storage of the NMR samples saw complete disappearance of both signals. HRMS identified the products as [M+1]+2 ions, indicating C—H bonds in the A ring had been replaced by C-D bonds. Notably. C—H bonds in the C and D rings showed no exchange, even after prolonged storage. Deuteration of flavonoids has been observed in the gas phase by mass spectrometry..sup.15 Jordheim and coworkers reported anthocyanidin natural products are deuterated in 15 vol % TFA in CD.sub.3OD over a period of days..sup.16 Rapid deuteration of compounds 5 at room temperature may derive from the acidity of their amine salt appendages, wherein deuteration of the A-ring was presumably occurring via a dearomatized species of type i (Scheme 2). The A-ring appeared to be considerably more basic than the C and D rings. Along those lines, we observed that EGCG itself would react with N-iodo succinimide to rapidly and selectively iodinate the A-ring (data not shown).
[0147] We next tested if the D-ring site of triazole-linked amino PEGylation would interfere with tau fibril disaggregation observed for EGCG. AD crude brain extracts have been shown to seed aggregation of fluorescently labeled tau in HEK293 recipient biosensor cells expressing an aggregation-prone fragment of tau called K18.sup.17, and seeding is inhibited by EGCG..sup.7a We compared inhibition of seeding by EGCG and D-ring analogs (5a-c) as a preliminary proof-of-concept. Crude extract of autopsied brain tissue of a donor with AD (prepared as described in the SI) were pre-incubated with inhibitors (10 μM final concentration on cells) for 16-18 hours and resulting homogenates were added to the cells for imaging 3 days later. The data obtained is shown in
[0148] Intracellular tau aggregates are seen as bright green puncta in cells that were seeded with crude AD brain extract in the absence of inhibitor. The number of puncta in inhibitor-treated cells are a proxy used to assess the disaggregating activity of EGCG-linked nanoparticles. To our delight, all of the EGCG-linker conjugates inhibited seeding by AD brain extracts by at least 90% with 5c displaying potency nearly on par with EGCG itself. As a comparison with other analogs of EGCG, we tested ECG, which lacks the meta-OH group of the C ring. Consistent with the structure of EGCG bound to tau, which shows no contact with the meta-OH, ECG was seen to inhibit seeding as well as the linker-conjugated analogs and nearly as well as the parent natural product, EGCG. These data demonstrate that D ring derivatizations are well tolerated, consistent with our observation that the D ring remains largely solvent-exposed in the binding cleft of tangled tau filaments from AD brain.
[0149] EGCG is subject to off-target binding and rapid metabolism, which restricts its therapeutic potential. We reason that covalent conjugation of EGCG to nanoparticles may reduce binding to metabolic and off-target proteins, which accommodate EGCG inside of buried active sites of globular proteins that are sterically inaccessible to nanoparticle-bound molecules of EGCG. Thus, we sought to synthesize a series of EGCG-nanoparticle conjugates that varied by linker length to identify a minimal linker that retains interaction of EGCG with the solvent exposed binding cleft of fibrillar tau.
[0150] Ferumoxytol is an FDA approved carbohydrate-coated iron nanoparticle with widespread use in the clinic with applications ranging from anemia treatment to off-label MR imaging of neurovasculature..sup.18 We conjugated an expanded series of EGCG bearing linkers of incrementally increasing length, 5a-e, to Ferumoxytol nanoparticles using standard amidation conditions (sulfo-NHS, EDC, 2 h, rt). Unlike previous inclusion-based, labile EGCG nanoparticle formulations that release EGCG at sites of action,.sup.19 we loaded the small molecule via covalent attachment. Covalent conjugation is likely to reduce off-target binding and has added potential to improve potency by exploiting the multivalency of the nanoparticle (each nanoparticle displays ˜50 potential linking sites).
[0151] We tested the activity of Ferumoxytol conjugated EGCG analogs using the biosensor cell assay described above, except we omitted the pre-incubation step such that our assay more closely resembled the scenario of therapeutic intervention, for which there is no pre-incubation period. Nanoparticle conjugated EGCG derivative was mixed with crude AD brain extract and immediately transfected into tau biosensor cells. We find that all the analogs except for the compound with the shortest linker (5a) exhibited desired activity inhibiting seeding by at least 50% (
[0152] As added evidence of its inhibitory action, we also observed an interesting effect of EGCG nanoparticle incubation with tau paired helical filaments purified from AD brain by negative-stain electron microscopy. Nanoparticles loaded with 5c form dense clouds that engulf AD-tau fibrils, in some cases apparently unwinding the paired helical filament (
[0153] In summary, we have optimized a monoetherification of naturally occurring EGCG and properly assigned the regiochemistry of the reaction. We have established a procedure to directly catalyze cycloaddition of glycol based w-amino azide chains to this molecule. The resultant amino polyphenolic conjugates retain the ability to disaggregate AD brain-derived tau-both as isolated species and when loaded onto Ferumoxytol nanoparticles. These promising results provide a blueprint for future work wherein further refinements to the EGCG molecule and optimized nanoparticulate formulations could provide means to deliver a potent tau fibril disaggregant to the brains of Alzheimer's patients.
Tables
[0154]
TABLE-US-00009 TABLE 3 Protecting group free, copper catalyzed Huisgen cycloaddition to form aminoPEGylated EGCG.sup.a (Reaction shown in FIG. 16) Entry [Cu] Additive Solvent (4:1) Yield.sup.b 1 Cu(OAc).sub.2 (0.2 eq.) — H.sub.2O/THF 0% 2 CuSO.sub.4 .Math. 5H.sub.2O (0.2 eq.) — H.sub.2O/THF 0% 3 CuSO.sub.4 .Math. 5H.sub.2O (0.2 eq.) — H.sub.2O/.sup.tBuOH trace 4.sup.c CuSO.sub.4 .Math. 5H.sub.2O (0.2 eq.) — H.sub.2O/.sup.tBuOH 0% 5 CuSO.sub.4 .Math. 5H.sub.2O (1 eq.) — H.sub.2O/.sup.tBuOH —.sup.d 6.sup.e CuBr (1 eq.) — H.sub.2O/DMSO —.sup.f 7 CuSO.sub.4 .Math. 5H.sub.2O (0.5 eq.) — H.sub.2O/DMSO 12% 8.sup.g CuSO.sub.4 .Math. 5H.sub.2O (0.5 eq.) — H.sub.2O/DMSO 12% 9 CuSO.sub.4 .Math. 5H.sub.2O (0.2 eq.) TBTA.sup.h H.sub.2O/DMSO 52% .sup.aReaction conditions: 3 (1 mmol), 4c (1 mmol), [Cu], additive (50 mol %), sodium ascorbate (2.0 eq.), solvent (0.1 M), 1 h. .sup.bIsolated yield .sup.cCu (powder) was used as a reductant instead of sodium ascorbate .sup.dReaction resulted in the formation of insoluble precipitate .sup.eNo sodium ascorbate .sup.fComplex mixture .sup.g2 mmol of 4c was used .sup.hTBTA = tris((1-benzyl-4-triazolyl)methyl)amine
TABLE-US-00010 TABLE 4 A set of EGCG derivatives having varied linker lengths.sup.a (Reaction shown in FIG. 17) Compound n Yield (%).sup.b 5a 1 68 5b 2 58 5c 3 52 5d 4 46 5e 5 45 .sup.aReaction conditions: 3 (1 mmol), 4 (1 mmol), CuSO.sub.4 .Math. 5H.sub.2O (0.2 eq.), TBTA (50 mol %), sodium ascorbate (2.0 eq.), DMSO/H.sub.2O (4:1) (0.1 M), 1 h. .sup.bIsolated yield
Materials and Experiments
[0155] All reagents were purchased from commercial suppliers (Sigma-Aldrich. Combi-Blocks or Oakwood Chemicals) and were used without further purification. When necessary, reaction solvents were dried using an activated alumina solvent drying system. Thin layer chromatography (TLC) was performed on pre-coated plates Sorbent Technologies, silica gel 60 PF.sub.234 (0.25 mm). TLC were visualized with UV light (254 nm) or stained using KMnO.sub.4 or ninhydrin. Flash chromatography was performed on silica gel 60 (240-400 mesh). Purification of final products was performed using an Agilent 1200 HPLC system equipped with G1361A preparative pumps, and a Waters Sunfire C18 column (5 μm, 19 mm×250 mm). Analytical HPLC was performed using the same system, but with a G1312A binary pump. NMR spectra were recorded on a Bruker Avance (500 MHz) spectrometer using CDCl.sub.3 or CD.sub.3OD as solvents and referenced relative to residual CHCl.sub.3 (δ=7.26 ppm) or CD.sub.3OD (δ=3.31 ppm). Chemical shifts are reported in ppm and coupling constants (J) in Hertz. 13C NMR was recorded on the same instruments (125 MHz) with total proton decoupling referenced relative to residual CHCl.sub.3 (8=77.16 ppm) or CD.sub.3OD (δ=49.00 ppm). Infrared spectra were obtained on Jasco FT/IR-4100, both are equipped with a universal ATR sampling accessory. High-resolution mass spectra were recorded on Waters LCT Premier. Optical rotations were measured on a Rudolph Autopol III Automatic Polarimeter and are quoted in units of 10.sup.−1 deg cm.sup.2 g.sup.−.
Preparation of Amino Azides 4; General Procedure (GP1).
[0156] The corresponding diol (1.0 eq.) was dissolved in DCM (0.6 M), followed by the addition of TsCl (2.1 eq.). The reaction was cooled to 0° C. KOH (8.0 eq.) was then added in one portion, the reaction was warmed to room temperature and stirred for 4 hours. The mixture was then diluted with H.sub.2O (100 mL) and extracted with DCM (3×100 mL). The combined organic layers were dried (MgSO.sub.4), filtered and concentrated in vacuo. The crude white solid was used directly in the next step.
[0157] To the crude bis-tosylate (1.0 eq.) in DMF (0.6 M) under Ar was added NaN.sub.3 (4.0 eq.). The reaction was stirred overnight at 80° C. The mixture was then cooled to room temperature, diluted with H.sub.2O (100 mL) and extracted with EtOAc (3×100 mL). Combined organic layers were washed with H.sub.2O (2×50 mL), brine (2×50 mL), dried (MgSO.sub.4), filtered and concentrated in vacuo. The resulting bis-azide was used directly in the next step without purification.
[0158] Crude bis-azide from the previous step (1.0 eq.) was dissolved in THF/Et.sub.2O/H.sub.2O (5/1/5, 0.6 M). PPh.sub.3 (1.0 eq.) in Et.sub.2O (0.7 M) was then added over 1 hour using a syringe pump. The resulting solution was stirred at room temperature overnight at which time precipitate formation was observed. The reaction was diluted with H.sub.2O (100 mL) and washed with Et.sub.2O (3×100 mL). The aqueous layer was then basified via the addition of solid NaOH to pH=11 and extracted with DCM (3×100 mL). Combined organic layers were dried (MgSO.sub.4), filtered and concentrated in vacuo. The crude product (TLC: DCM/MeOH 8:2 R.sub.f=0.2) was purified via flash column chromatography (silica gel, DCM/MeOH/Et.sub.3N 100:0:0 to 90:10:0 to 80:10:10) to give the desired amino azide.
2-(2-azidoethoxy)ethan-1-amine (4a).SUP.20
[0159] Compound was prepared according to GP1.
[0160] Yield: 90%, yellow oil.
[0161] .sup.1H NMR (500 MHz, CDCl.sub.3): δ=3.65 (t, J=5.0 Hz, 2H, 4-H), 3.54 (t, J=5.1 Hz, 2H, 2-H), 3.38 (t, J=5.0 Hz, 2H, 5-H), 2.90 (t, J=5.1 Hz, 2H, 1-H), 2.40 (s, 2H, NH.sub.2).
[0162] .sup.13C NMR (125 MHz, CDCl.sub.3): δ=72.7, 70.0, 50.7, 41.6.
2-(2-(2-azidoethoxy)ethoxy)ethan-1-amine (4b).SUP.21
[0163] Compound was prepared according to GP1.
[0164] Yield: 90%, yellow oil.
[0165] .sup.1H NMR (500 MHz, CDCl.sub.3): δ=3.68-3.63 (m, 6H, 4-H, 5-H, 8-H), 3.53 (t, J=5.0 Hz, 2H, 2-H), 3.39 (t, J=5.2 Hz, 2H, 6-H), 2.88 (t, 5.0 Hz, 2H, 1-H), 2.17 (s, 2H, NH.sub.2).
[0166] .sup.13C NMR (125 MHz, CDCl.sub.3): δ=73.0, 70.7, 70.3, 70.1, 50.7, 41.6.
2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy)ethan-1-amine (4).SUP.22
[0167] Compound was prepared according to GP1.
[0168] Yield: 85%, yellow oil.
[0169] .sup.1H NMR (500 MHz, CDCl.sub.3): δ=3.68-3.60 (m, 10H, 3-H, 4-H, 5-H, 6-H, 7-H), 3.50 (t, J=5.1 Hz, 2H, 2-H), 3.39 (t, J=5.1 Hz, 2H, 8-H), 2.86 (t, J=5.1 Hz, 2H, 1-H), 1.89 (s, 2H, NH.sub.2)
[0170] .sup.13C NMR (125 MHz, CDCl.sub.3): δ=73.1, 70.71, 70.66, 70.6, 70.3, 70.1, 50.7, 41.7.
14-azido-3,6,9,12-tetraoxatetradecan-1-amine (4d).SUP.23
[0171] Compound was prepared according to GP1.
[0172] Yield: 73%, yellow oil.
[0173] .sup.1H NMR (500 MHz, CDCl.sub.3): δ=3.72-3.60 (m, 14H, 3-H, 4-H, 5-H, 6-H, 7-H, 8-H, 9-H), 3.55 (t, J=3.0 Hz, 2H, 2-H), 3.38 (t, J=4.7 Hz, 2H, 10-H), 2.90 (t, J=4.7 Hz, 2H, 1-H).
[0174] .sup.13C NMR (125 MHz, CDCl.sub.3): δ=71.9, 70.7-70.0 (wide peak), 50.7, 41.4.
17-azido-3,6,9,12,15-pentaoxaheptadecan-1-amine (4e).SUP.24
[0175] Compound was prepared according to GP1.
[0176] Yield: 70%, yellow oil.
[0177] .sup.1H NMR (500 MHz, CDCl.sub.3): δ=3.96 (t, J=3.2 Hz, 2H, 11-H), 3.62-3.80 (m, 18H, 2-H, 3-H, 4-H, 5-H, 6-H, 7-H, 8-H, 9-H, 10-H), 3.50 (t, J=4.90 Hz, 2H, 12-H), 3.15 (t, J=4.90 Hz, 2H, 1-H).
[0178] .sup.13C NMR (125 MHz, CDCl.sub.3): δ=70.6-69.8 (wide peak), 66.9, 50.7, 40.6.
(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 3,5-dihydroxy-4-(prop-2-yn-1-yloxy)benzoate and (2R,3R)-2-(3,5-dihydroxy-4-(prop-2-yn-1-yloxy)phenyl)-5,7-dihydroxychroman-3-yl 3,5-dihydroxy-4-(prop-2-yn-1-yloxy)benzoate (3 and 3′) (using NaH/DMF)
[0179] To NaH (15.7 mg, 0.65 mmol, 1.5 eq.) at 0° C. was added a solution of EGCG (200 mg, 0.44 mmol, 1.0 eq.) in dry DMF (1.45 mL, 0.3 M). The resulting mixture was stirred at room temperature for 30 minutes. Propargyl bromide (53 μL, 0.48 mmol, 1.1 eq., 80% w/w) was then added and the reaction was heated to 80° C. and stirred overnight. Upon cooling to room temperature, the reaction was concentrated in vacuo and subjected to flash column chromatography (silica gel, CHCl.sub.3/MeOH 100:0 to 15:1 to 13:1 to 11:1). Desired monopropargylated product (TLC: CHCl.sub.3/MeOH 8:2, R.sub.f=0.3) was obtained in 33% yield (72 mg) (decomposes at >120° C.), [α].sub.D.sup.21=−162.0° (c=0.1, MeOH) along with 15% of bispropargylated product (R.sub.f=0.6), [α].sub.D.sup.21=−133.0° (c=0.1, MeOH) as white solids.
Monopropargylated Product (3):
[0180] FT-IR (neat): 3358, 3290, 2124, 1697, 1606, 1522, 1454, 1371, 1347, 1242, 1196, 1147, 1056, 1039, 1017, 826, 769, 640 cm.sup.−1.
[0181] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=6.89 (s, 2H, Gal H-2, H-6), 6.47 (s, 2H, H-2′, H-6′), 5.93 (s, 2H, H-6, H-8), 5.52 (m, 1H, H-3), 4.95 (s, 1H, H-2), 4.76 (d, J=2.4 Hz, 2H, OCH.sub.2R), 2.99-2.94 (dd, J=17.3, 4.5 Hz, 1H, H-4a), 2.85-2.80 (dd, J=17.3, 2.3 Hz, 1H, H-40), 2.77 (t, J=2.4 Hz, 1H, ═CH)
[0182] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.7, 156.5, 156.4, 155.8, 150.5, 145.3, 137.0, 132.4, 129.3, 125.7, 108.7, 105.4, 97.9, 95.2, 94.5, 78.6, 77.1, 75.3, 68.9, 58.6, 25.4
[0183] HRMS (ESI): m/z calcd for C.sub.25H.sub.20O.sub.11 [M+H].sup.+: 497.1039; found: 497.1102.
Bispropargylated Produce (3′):
[0184] FT-IR (neat): 3359, 3282, 2926, 2858, 2362, 2124, 1695, 1601, 1519, 1451, 1363, 1235, 1174, 1142, 1049, 1014, 982, 754, 736, 711, 632 cm.sup.−1.
[0185] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=6.88 (s, 2H, Gal H-2, H-6), 6.50 (s, 2H, H-2′, H-6′), 5.94 (s, 2H, H-6, H-8), 5.55 (m, 1H, H-3), 4.99 (s, 1H, H-2), 4.76 (d, J=2.4 Hz, 2H, OCH.sub.2R), 4.66 (d, J=2.4 Hz, 2H, OCH.sub.2R′), 3.01-2.95 (dd, J=17.4, 4.6 Hz, 1H, H-4a), 2.86-2.81 (dd, J=17.3, 2.2 Hz, 1H, H-4), 2.77 (t, J=2.4 Hz, 1H, ═CH), 2.71 (t, J=2.4 Hz, 1H, ≡CH′)
[0186] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.6, 156.5, 155.6, 150.5, 150.4, 137.0, 134.8, 132.3, 125.6, 108.7, 105.5, 97.9, 95.2, 94.5, 79.0, 78.6, 78.1, 75.3, 75.0, 68.8, 58.8, 58.6, 26.4
[0187] HRMS (ESI): m/z calcd for C.sub.28H.sub.23O.sub.11 [M+H].sup.+: 535.1240; found: 535.1252.
(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 3,5-hydroxy-4-(prop-2-yn-1-yloxy)benzoate (3) (using K.SUB.2.CO.SUB.3./DMF)
[0188] To EGCG (1 g, 2.18 mmol, 1.0 eq.) in DMF (11 mL, 0.2 M) at 0° C. was added K2C03 (166 mg, 1.2 mmol, 0.5 eq.) in one portion. The reaction was stirred at room temperature for 1 hour. Propargyl bromide (0.24 mL, 2.18 mmol, 1.1 eq., 80% w/w) was then added and the reaction was stirred at the same temperature overnight. The mixture was then concentrated in vacuo and purified as above furnishing the product in 45% yield (491 mg) along with 10% of bispropargylated side product. All the analytical data matched the one obtained using an alternative procedure.
Click Reaction with PEGylated Linkers; General Procedure (GP2).
[0189] To a flame-dried microwave vial was added 3 (40 mg, 0.081 mmol, 1.0 eq) and the corresponding azide (0.081 mmol, 1.0 eq.). In a separate vial, a solution of CuSO.sub.4.Math.5H.sub.2O (4 mg, 0.016 mmol, 0.2 eq.), sodium ascorbate (34 mg, 0.17 mmol. 2.0 eq.), TBTA (21 mg, 0.04 mmol, 0.5 eq.) in DMSO/H.sub.2O (4:1, 0.81 mL, 0.1 M) was prepared and added to the first flask. The reaction was stirred at room temperature for 1 h. The crude mixture was purified by preparative reverse-phase HPLC (33-60% MeCN/H.sub.2O+0.1% (v/v) TFA in 8.5 min) to give the title compounds (t.sub.R=5.2 min).
(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 4-((1-(2-(2-aminoethoxy)ethyl)-H-1,2,3-triazol-4-yl)methoxy)-3,5-dihydroxybenzoate (5a)
[0190] Compound was prepared according to GP2.
[0191] Yield: 35 mg, 68%, white solid. [α].sub.D.sup.21=−81° (c=0.1, MeOH).
[0192] FT-IR (neat): 3374, 2951, 2934, 1676, 1626, 1523, 1448, 1370, 1196, 1146, 1061, 1015, 770, 724, 650, 612 cm.sup.−1
[0193] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=7.88 (s, 1H, triazole-H), 6.87 (s, 2H, Gal H-2, H-6), 6.50 (s, 2H, H-2′, H-6′), 5.95 (s, 2H, H-6, H-8), 5.54 (m, 1H, H-3), 5.25 (s, 2H, OCH.sub.2R), 4.97 (s, 1H, H-2),
[0194] 4.56 (t, J=4.8 Hz, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0195] 3.83-3.75 (m, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2).
[0196] 3.50-3.48 (m, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0197] 3.01-2.97 (m, 3H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2, and H-4α),
[0198] 2.86-2.82 (dd, J=17.3, 2.2 Hz, 1H, H-4β).
[0199] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.5, 156.5, 155.8, 150.4, 145.3, 137.1, 132.3, 129.4, 125.7, 124.9, 108.8, 105.4, 97.8, 95.1, 94.5, 77.0, 69.1, 69.0, 66.3, 63.9, 49.9, 39.0, 25.4
[0200] HRMS (ESI): m/z calcd for C.sub.29H.sub.32N.sub.4O.sub.2 [M+H].sup.+: 627.1938; found: 627.1954.
(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 4-((1-(2-(2-aminoethoxy)ethoxy)ethyl)-1H-1,2,3-triazol-4-yl)methoxy)-3,5-dihydroxybenzoate (5b)
[0201] Compound was prepared according to GP2.
[0202] Yield: 32 mg, 58%, white solid. [α].sub.D.sup.21=−73° (c=0.1, MeOH).
[0203] FT-IR (neat): 3170, 2964, 2952, 1678, 1627, 1609, 1523, 1450, 1376, 1347, 1201, 1146, 1058, 1039, 969, 836, 720, 677, 602 cm.sup.−1.
[0204] .sup.1H NMR (500 MHz, CD.sub.3OD): 5=7.90 (s, 1H, triazole-H), 6.88 (s, 2H, Gal H-2, H-6), 6.50 (s, 2H, H-2′, H-6′), 5.95 (s, 2H, H-6, H-8), 5.53-5.52 (m, 1H, H-3), 5.26 (s, 2H, OCH.sub.2R), 4.97 (s, 1H, H-2),
[0205] 4.52-4.50 (t, J=4.6 Hz, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0206] 3.82-3.73 (m, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0207] 3.50-3.48 (m, 2H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0208] 3.41 (m, 4H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0209] 3.02-2.96 (m, 3H, N—CH.sub.2CH.sub.2OCH.sub.2CH.sub.2OCH.sub.2CH.sub.2NH.sub.2, and H-4α),
[0210] 2.86-2.82 (dd, J=18.1, 1.9 Hz, 1H, H-4β).
[0211] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.54, 156.46, 155.8, 150.4, 145.3, 137.1, 132.3, 129.4, 125.6, 108.9, 105.3, 97.8, 95.1, 94.5, 77.0, 70.1, 69.8, 68.98, 68.95, 66.3, 63.8, 53.7, 50.1, 39.3, 25.5
[0212] HRMS (ESI): m/z calcd for C.sub.31H.sub.35N.sub.4O.sub.13 [M+H].sup.+: 671.2201; found: 671.2170 (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 4-((1-(2-(2-(2-(2-aminoethoxy)ethoxy)ethoxy)ethyl)-H-1,2,3-triazol-4-yl)methoxy)-3,5-dihydroxybenzoate (5c)
[0213] Compound was prepared according to GP2.
[0214] Yield: 30 mg, 52%, white solid. [α].sub.D.sup.21=−62° (c=0.1. MeOH).
[0215] FT-IR (neat): 3203, 2970, 1674, 1602, 1523, 1437, 1368, 1200, 1143, 1060, 981, 831, 718, 647, 622, 610 cm.sup.−1.
[0216] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=7.87 (s, 1H, triazole-H), 6.89 (s, 2H, Gal H-2, H-6), 6.50 (s, 2H, H-2′, H-6′), 5.94 (s, 2H, H-6, H-8), 5.54-5.53 (m, 1H, H-3), 5.25 (s, 2H, OCH.sub.2R), 4.97 (s, 1H, H-2),
[0217] 4.52 (t, J=4.9 Hz, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0218] 3.81-3.73 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0219] 3.59-3.57 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0220] 3.54-3.47 (m, 4H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2,
[0221] 3.45-3.42 (m, 4H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2),
[0222] 3.07-3.05 (t, J=5.5 Hz, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.2OCH.sub.2CH.sub.2NH.sub.2), 3.01-2.96 (dd, J=17.3, 4.5 Hz, 1H, H-4α), 2.86-2.82 (dd, J=17.3, 2.3 Hz, 1H, H-4β)
[0223] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.54, 156.48, 155, 8, 150.4, 145.3, 137.0, 132.3, 129.4, 125.6, 124.9, 108.9, 105.3, 97.8, 95.1, 94.5, 77.0, 70.0, 69.9, 69.6, 69.0, 66.3, 63.9, 50.1, 39.3, 25.5
[0224] HRMS (ESI): m/z calcd for C.sub.33H.sub.38N.sub.4O.sub.14Na [M+Na].sup.+: 737.2282; found: 737.2308
(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 4-((1-(14-amino-3,6,9,12-tetraoxatetradecyl)-1H-1,2,3-triazol-4-yl)methoxy)-3,5-dihydroxybenzoate (5d)
[0225] Compound was prepared according to GP2.
[0226] Yield: 28 mg, 46%, white solid. [α].sub.D.sup.21=−69° (c=0.1, MeOH).
[0227] FT-IR (neat): 3179, 2926, 1681, 1627, 1523, 1451, 1372, 1349, 1203, 1146, 1061, 1038, 831, 726, 641, 618 cm.sup.−1.
[0228] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=7.90 (s, 1H, triazole-H), 6.87 (s, 2H, Gal H-2, H-6), 6.48 (s, 2H, H-2′, H-6′), 5.93 (s, 2H, H-6, H-8), 5.52-5.53 (m, 1H, H-3), 5.23 (s, 2H, OCH.sub.2R), 4.95 (s, 1H, H-2),
[0229] 4.51-4.48 (t, J=4.7 Hz, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2),
[0230] 3.78-3.70 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2),
[0231] 3.61-3.58 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2),
[0232] 3.55-3.50 (m, 6H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2),
[0233] 3.46-3.40 (m, 6H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2), 3.05-3.03 (t, J=5.0 Hz, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.3OCH.sub.2CH.sub.2NH.sub.2, 3.00-2.94 (dd, J=17.5, 4.6 Hz, 1H, H-4α), 2.85-2.80 (dd, J=17.5, 1.8 Hz, 1H, H-4β)
[0234] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.50, 156.45, 155.8, 150.4, 145.3, 137.2, 132.3, 129.4, 125.6, 125.0, 108.9, 105.3, 97.8, 95.1, 94.5, 77.0, 70.05, 69.94, 69.88, 69.82, 69.78, 69.5, 69.0, 68.9, 66.3, 64.0, 50.1, 39.2, 25.5
[0235] HRMS (ESI): m/z calcd for C35H42N.sub.4O.sub.15Na [M+Na]*: 781.2544; found: 781.2525 (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)chroman-3-yl 4-((1-(17-amino-3,6,9,12,15-pentaoxaheptadecyl)-H-1,2,3-triazol-4-yl)methoxy)-3,5-dihydroxybenzoate (5e)
[0236] Compound was prepared according to GP2.
[0237] Yield: 29 mg, 45/a, white solid. [α].sub.D.sup.21=−79° (c=0.1, MeOH).
[0238] FT-IR (neat): 3307, 2908, 1678, 1625, 1521, 1449, 1374, 1349, 1238, 1201, 1147, 1096, 845, 772, 722, 652, 633 cm.sup.−1.
[0239] .sup.1H NMR (500 MHz, CD.sub.3OD): δ=7.90 (s, 1H, triazole-H), 6.87 (s, 2H, Gal H-2, H-6), 6.49 (s, 2H, H-2′, H-6′), 5.93 (s, 2H, H-6, H-8), 5.52-5.53 (m, 1H, H-3), 5.24 (s, 2H, OCH.sub.2R), 4.95 (s, 1H, H-2),
[0240] 4.52-4.50 (t, J=4.7 Hz, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.4OCH.sub.2CH.sub.2NH.sub.2),
[0241] 3.82-3.71 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.4OCH.sub.2CH.sub.2NH.sub.2),
[0242] 3.63-3.60 (m, 2H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.4OCH—CH.sub.2NH.sub.2),
[0243] 3.57-3.38 (m, 16H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.4OCH.sub.2CH.sub.2NH.sub.2,
[0244] 3.01-2.94 (m, 3H, N—CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.4OCH.sub.2CH.sub.2NH.sub.2, H-4α), 2.85-2.80 (dd, J=17.5, 1.8 Hz, 1H, H-4β)
[0245] .sup.13C NMR (125 MHz, CD.sub.3OD): δ=165.6, 156.56, 156.49, 155.8, 150.4, 145.3, 143.6, 137.2, 132.3, 129.4, 125.6, 124.9, 108.9, 105.3, 97.8, 95.1, 94.5, 77.0, 69.94, 69.87, 69.84, 69.80, 69.76, 69.70, 69.68, 69.43, 69.0, 68.9, 66.3, 63.9, 50.0, 39.2, 25.5
[0246] HRMS (ESI): m/z calcd for C37H47N.sub.4O.sub.16 [M+H].sup.+: 803.2987; found: 803.2997.
REFERENCES FOR EXAMPLE 5
[0247] (1) Present Address: Department of Pharmacology and Pharmaceutical Sciences, University of Southern California School of Pharmacy, 1985 Zonal Ave, Los Angeles Calif. 90089-9121 [0248] (2) Alzheimer's & Dementia 2020, 16, 391. [0249] (3) Gouras, G. K.; Olsson, T. T.; Hansson, O. Neurotherapeutics 2015, 12, 3. [0250] (4) Murray, M. E.; Lowe, V. J.; Graff-Radford, N. R.; Liesinger, A. M.; Cannon, A.; Przybelski, S. A.: Rawal, B.; Parisi, J. E.; Petersen, R. C.; Kantarci, K.; Ross, O. A.; Duara, R.; Knopman, D. S.; Jack, C. R.; Dickson, D. W. Brain 2015, 138, 1370. [0251] (5) (a) Bieschke, J.; Russ, J.; Friedrich, R. P.; Ehrnhoefer, D. E.; Wobst, H.; Neugebauer, K.; Wanker, E. E. Proceedings of the National Academy of Sciences of the United States of America 2010, 107, 7710. (b) Debnath, K.; Shekhar, S.; Kumar, V.; Jana. N. R.; Jana. N. R. ACS Applied Materials and Interfaces 2016, 8, 20309. [0252] (6) Wobst, H. J.; Sharma, A.; Diamond, M. I.; Wanker, E. E.; Bieschke, J. FEBS Letters 2015, 589, 77. [0253] (7) (a) Seidler, P. M.; Boyer. D. R., Sawaya, M. R.; Ge, P.; Shin, W. S.; DeTure, M. A.; Dickson, D. W.; Jiang, L.; Eisenberg, D. S. bioRxiv 2020, 2020.05.29.124537. (b) Sonawane, S. K.; Chidambaram, H.; Boral, D.; Gorantla, N. V.; Balmik, A. A.; Dangi, A.; Ramasamy. S.; Marelli, U. K.; Chinnathambi, S. Scientific Reports 2020, 10. [0254] (8) (a) Lu, M.; Cohen, M. H.; Rieves, D.; Pazdur, R. American Journal of Hematology 2010, 85, 315. (b) Muldoon, L. L.; S??ndor, M.; Pinkston, K. E.; Neuwelt, E. A. Neurosurgery 2005, 57, 785. (c) Neubert, J.; Wagner, S.; Kiwit, J.; Brauer, A. U.; Glumm, J. International Journal of Nanomedicine 2015, 10, 2033. (d) Nguyen, K. L.; Yoshida, T.; Kathuria-Prakash, N.; Zaki, I. H.; Varallyay, C. G.: Semple, S. I.; Saouaf, R.; Rigsby, C. K.; Stoumpos, S.; Whitehead, K. K.; Griffin, L. M.; Saloner, D.; Hope, M. D.; Prince, M. R.; Fogel, M. A.: Schiebler, M. L.; Roditi, G. H.: Radjenovic. A.; Newby, D. E.; Neuwelt. E. A.; Bashir, M. R.; Hu, P.; Paul Finn. J. Radiology 2019, 293, 554. [0255] (9) Wang, J.; Sun, P., Wang, Q.; Zhang, P.; Wang, Y.; Zi, C.; Wang, X.; Sheng, J. Cancer Cell International 2019, 19. [0256] (10) Yang, Q.; Sheng, M.; Henkelis, J. J.; Tu, S.; Wiensch, E.; Zhang, H.; Zhang, Y.; Tucker, C.; Ejeh, D. E. Organic Process Research and Development 2019, 23, 2210. [0257] (11) (a) Aufort, M.; Herscovici, J.; Bouhours. P.; Moreau, N.; Girard, C. Bioorganic and Medicinal Chemistry Letters 2008, 18, 1195. (b) Dieterich, D. C.: Lee, J. J.; Link, A. J.; Graumann, J.; Tirrell, D. A.; Schuman, E. M. Nature Protocols 2007, 2, 532. (c) Flows, M. C.; Ledo, A. L.; Narine, S. S. BioMed Research International 2014, 2014. (d) Lee, W.; Sarkar, S.; Pal, R.; Kim, J. Y.: Park, H.; Huynh, P. T.: Bhise, A.; Bobba, K. N.; Kim, K. I.; Ha, Y. S.; Soni, N.; Kim, W.; Lee, K.; Jung, J. M.; Rajkumar, S.; Lee, K. C.: Yoo, J. ACS Applied Bio Materials 2021, 4. (e) Sun, P.; Chen, J.; Liu, J. a.; Zhang, K. Macromolecules 2017, 50, 1463. [0258] (12) Himo, F.; Lovell, T.; Hilgraf, R.; Rostovtsev, V. V.: Noodleman, L.; Sharpless, K. B.; Fokin, V. V. Journal of the American Chemical Society 2005, 127, 210. [0259] (13) Rostovtsev, V. V.; Green, L. G.; Fokin. V. V.; Sharpless, K. B. Angewandte Chemie—International Edition 2002, 41, 2596. [0260] (14) Chan, T. R.; Hilgraf, R.; Sharpless, K. B.: Fokin, V. V. Organic Letters 2004, 6, 2853. [0261] (15) Madhusudanan, K. P.; Sachdev, K.; Harrison. D. A.; Kulshreshtha, D. K. International Journal of Mass Spectrometry and Ion Processes 1984, 62, 289. [0262] (16) Jordheim, M.; Fossen, T.; Songstad, J.; Andersen, Ø. M. Journal of Agricultural and Food Chemistry 2007, 55, 8261. [0263] (17) (a) Clavaguera, F.; Akatsu, H.; Fraser, G., Crowther, R. A.; Frank, S.; Hench, J.; Probst, A.; Winkler, D. T.; Reichwald, J.; Staufenbiel, M.; Ghetti, B.; Goedert, M.; Tolnay, M. Proceedings of the National Academy of Sciences of the United States of America 2013, 110, 9535. (b) Hyman, B. T. Neuron 2014, 82, 1189. (c) Seidler, P. M.; Boyer, D. R.; Murray, K. A.; Yang, T. P.: Bentzel, M.; Sawaya, M. R.: Rosenberg, G.; Cascio, D.; Williams, C. K.; Newell, K. L.; Ghetti, B.; DeTure, M. A.: Dickson, D. W.; Vinters, H. V.; Eisenberg, D. S. Journal of Biological Chemistry 2019, 294, 16451. [0264] (18) (a) Muldoon, L. L.; Sandor, M.; Pinkston, K. E.; Neuwelt, E. A. Neurosurgery 2005, 57, 785. (b) Toth, G. B.: Varallyay, C. G.: Horvath, A.; Bashir, M. R.; Choyke, P. L.; Daldrup-Link, H. E.; Dosa, E.; Finn, J. P.; Gahramanov, S.; Harisinghani, M.; Macdougall, I.; Neuwelt, A.; Vasanawala. S. S.; Ambady, P.; Barajas, R.; Cetas, J. S.; Ciporen, J.; DeLoughery, T. J.; Doolittle, N. D.; Fu, R.; Grinstead, J.; Guimaraes, A. R.; Hamilton, B. E.; Li, X.; McConnell, H. L.; Muldoon, L. L.; Nesbit, G.; Netto, J. P.; Petterson, D.; Rooney, W. D.; Schwartz, D.; Szidonya, L.; Neuwelt, E. A. Kidney International 2017, 92, 47. (c) Nguyen, K.-L.; Yoshida. T.; Kathuria-Prakash, N.; Zaki, I. H.; Varallyay, C. G.; Semple, S. I.; Saouaf, R.; Rigsby, C. K.; Stoumpos, S.; Whitehead, K. K.; Griffin, L. M.; Saloner, D.; Hope, M. D.; Prince, M. R.: Fogel, M. A.; Schiebler, M. L.; Roditi, G. H.; Radjenovic, A.; Newby. D. E.; Neuwelt, E. A.; Bashir, M. R.; Hu, P.; Finn, J. P. Radiology 2019, 293, 554. (d) Lu, M.; Cohen, M. H.; Rieves, D.; Pazdur, R. American Journal of Hematology 2010, NA. (e) Enteshari Najafabadi, R.; Kazemipour, N.; Esmacili, A.; Beheshti, S.; Nazifi, S. BMC Pharmacology and Toxicology 2018, 19. [0265] (19) (a) He, A.; Guan, X.; Song, H.; Li, S.; Huang, K. Food Bioscience 2020, 37. (b) Radhakrishnan, R.; Kulhari, H.; Pooja, D.; Gudem, S.; Bhargava, S.; Shukla, R.; Sistla, R. Chemistry and Physics of Lipids 2016, 198, 51. (c) Sanna, V.; Singh, C. K.; Jashari, R.; Adhami, V. M.; Chamcheu, J. C.; Rady, I.; Sechi, M.; Mukhtar, H.; Siddiqui, I. A. Scientific Reports 2017, 7. (d) Smith, A.; Giunta. B.; Bickford, P. C.; Fountain. M.; Tan, J.; Shytle, R. D. International Journal of Pharmaceutics 2010, 389, 207. (e) Zou, L. q.; Peng, S. f.; Liu, W.; Gan, L.; Liu, W. I.; Liang, R. h.: Liu, C. m.; Niu, J.; Cao, Y. I.: Liu, Z.; Chen, X. Food Research International 2014, 64, 492. [0266] (20) Tran, F.; Odell, A. V.; Ward, G. E.; Westwood. N. J. Molecules 2013, 18, 11639. [0267] (21) Friscourt, F.; Fahmi, C. J.; Boons, G. J. Journal of the American Chemical Society 2012, 134, 18809. [0268] (22) Bertozzi, C. R.; Bednarski, M. D. Journal of Organic Chemistry 1991, 56, 4326. [0269] (23) Brauch, S.; Henze, M.; Osswald, B.; Naumann, K.; Wessjohann, L. A.; Van Berkel, S. S.; Westermann, B. Organic and Biomolecular Chemistry 2012, 10, 958. [0270] (24) Wang, H.; Raghupathi, K. R.; Zhuang, J.; Thayumanavan, S. ACS Macro Letters 2015, 4, 422.
Example 6: Additional Compounds
[0271] The following are a series of tables that have additional analogs that can be readily synthesized using methods described herein, for example in Example 5.
TABLE-US-00011 Dimeric analogs
TABLE-US-00012 TABLE D Trimeric analogs
TABLE-US-00013 TABLE E Tetrameric analogs
TABLE-US-00014 TABLE F Pentameric analogs
TABLE-US-00015 TABLE G Hexameric analogs
TABLE-US-00016 TABLE H D ring derivatization
INCORPORATION BY REFERENCE
[0272] Each publication and patent mentioned herein is hereby incorporated by reference in its entirety. In case of conflict, the present specification, including any definitions herein, will control.
EQUIVALENTS
[0273] While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of the preceding description and the following claims. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and by reference to the rest of the specification, along with such variations.