PHOTOREACTIVE LIGANDS AND USES THEREOF

20200071277 ยท 2020-03-05

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein are methods for identifying proteins as targets for interaction with a small molecule ligand. Also disclosed herein are small molecule ligands and compositions for use in profiling druggable proteins.

    Claims

    1. A small molecule ligand which binds to a ligand binding site of a protein illustrated in Table 3, wherein the ligand binding site is defined by a sequence set forth in SEQ ID NOs: 1-96.

    2. The small molecule ligand of claim 1, wherein the small molecule ligand binds to one or more residues of a sequence selected from SEQ ID NOs: 1-96.

    3. The small molecule ligand of claim 1, wherein the protein is ACP1 protein and the ligand binding site is defined by the following residues: VDSAATSGYEIGNPPDYR of the ACP1 protein having the UniProtKB accession number P24666.

    4. The small molecule ligand of claim 3, wherein the small molecule ligand is probe 13.

    5. The small molecule ligand of claim 1, wherein the protein is ADCK3 and the ligand binding site is defined by the following residues: LGQMLSIQDDAFINPHLAK of the ADCK3 protein having the UniProtKB accession number Q8NI60.

    6. The small molecule ligand of claim 5, wherein the small molecule ligand is probe 14.

    7. The small molecule ligand of claim 1, wherein the protein is ADK and the ligand binding site is defined by the following residues: IFTLNLSAPFISQFYK of the ADK protein having the UniProtKB accession number P55263.

    8. The small molecule ligand of claim 7, wherein the small molecule ligand is probe 2.

    9. The small molecule ligand of claim 1, wherein the protein is ADSS and the ligand binding site is defined by the following residues: FIEDELQIPVK of the ADSS protein having the UniProtKB accession number P30520.

    10. The small molecule ligand of claim 9, wherein the small molecule ligand is probe 14.

    11. The small molecule ligand of claim 1, wherein the protein is AIFM1 and the ligand binding site is defined by the following residues: PYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAK of the AIFM1 protein having the UniProtKB accession number 095831.

    12. The small molecule ligand of claim 11, wherein the small molecule ligand is probe 2, 3, 4 or 6.

    13. The small molecule ligand of claim 1, wherein the protein is ALDH7A1 and the ligand binding site is defined by the following residues: ILVEGVGEVQEYVDICDYAVGLSR of the ALDH7A1 protein having the UniProtKB accession number P49419.

    14. The small molecule ligand of claim 13, wherein the small molecule ligand is probe 8 or 13.

    15. The small molecule ligand of claim 1, wherein the protein is ARF4 or ARF5 and the ligand binding site is defined by the following residues: LGEIVTTIPTIGFNVETVEYK, corresponding to LGEIVTTIPTIGFNVETVEYK of the ARF4 protein having the UniProtKB accession number P18085.

    16. The small molecule ligand of claim 15, wherein the small molecule ligand is probe 2, 3, 4, 8 or 13.

    17. The small molecule ligand of claim 1, wherein the protein is ARL1 and the ligand binding site is defined by: GTGLDEAMEWLVETLK or LQVGEVVTTIPTIGFNVETVTYK of the ARL1 protein having the UniProtKB accession number P40616.

    18. The small molecule ligand of claim 17, wherein the small molecule ligand is probe 13 or 14.

    19. The small molecule ligand of claim 1, wherein the protein is ATIC and the ligand binding site is defined by the following residues: AFTHTAQYDEAISDYFR of the ATIC protein having the UniProtKB accession number P31939.

    20. The small molecule ligand of claim 19, wherein the small molecule ligand is probe 13.

    21. The small molecule ligand of claim 1, wherein the protein is BLMH and the ligand binding site is defined by: CYFFLSAFVDTAQR or GEISATQDVMMEEIFR of the BLMH protein having the UniProtKB accession number Q13867.

    22. The small molecule ligand of claim 21, wherein the small molecule ligand is probe 13 or 14.

    23. The small molecule ligand of claim 1, wherein the protein is CALR and the ligand binding site is defined by: SGTIFDNFLITNDEAYAEEFGNETWGVTK or HEQNIDCGGGYVK of the CALR protein having the UniProtKB accession number P27797.

    24. The small molecule ligand of claim 23, wherein the small molecule ligand is probe 6, 9, or 13.

    25. The small molecule ligand of claim 1, wherein the protein is CAPN1 and the ligand binding site is defined by the following residues: LVFVHSAEGNEFWSALLEK of the CAPN1 protein having the UniProtKB accession number P07384.

    26. The small molecule ligand of claim 25, wherein the small molecule ligand is probe 14.

    27. The small molecule ligand of claim 1, wherein the protein is CKB and the ligand binding site is defined by: FPAEDEFPDLSAHNNHMAK, LAVEALSSLDGDLAGR, TFLVWVNEEDHLR, FCTGLTQIETLFK, LGFSEVELVQMVVDGVK or LEQGQAIDDLMPAQK of the CKB protein having the UniProtKB accession number P12277.

    28. The small molecule ligand of claim 27, wherein the small molecule ligand is probe 3 or 13.

    29. The small molecule ligand of claim 1, wherein the protein is CKMT1B and the ligand binding site is defined by the following residues: SFLIWVNEEDHTR of the CKMT1B protein having the UniProtKB accession number P12532.

    30. The small molecule ligand of claim 29, wherein the small molecule ligand is probe 3.

    31. The small molecule ligand of claim 1, wherein the protein is CLPP and the ligand binding site is defined by the following residues: QSLQVIESAMER of the CLPP protein having the UniProtKB accession number Q16740.

    32. The small molecule ligand of claim 31, wherein the small molecule ligand is probe 6.

    33. The small molecule ligand of claim 1, wherein the protein is CSNK1A1 and the ligand binding site is defined by the following residues: DYNVLVMDLLGPSLEDLFNFCSR of the CSNK1A1 protein having the UniProtKB accession number P48729.

    34. The small molecule ligand of claim 33, wherein the small molecule ligand is probe 14.

    35. The small molecule ligand of claim 1, wherein the protein is CSNK2B and the ligand binding site is defined by the following residues: VYCENQPMLPIGLSDIPGEAMVK of the CSNK2B protein having the UniProtKB accession number P67870.

    36. The small molecule ligand of claim 35, wherein the small molecule ligand is probe 14.

    37. The small molecule ligand of claim 1, wherein the protein is CTSB and the ligand binding site is defined by the following residues: GQDHCGIESEVVAGIPR of the CTSB protein having the UniProtKB accession number P07858.

    38. The small molecule ligand of claim 37, wherein the small molecule ligand is probe 2, 4, 9 or 13.

    39. The small molecule ligand of claim 1, wherein the protein is CTSD and the ligand binding site is defined by: DPDAQPGGELMLGGTDSK, EGCEAIVDTGTSLMVGPVDEVR or AIGAVPLIQGEYMIPCEK of the CTSD protein having the UniProtKB accession number P07339.

    40. The small molecule ligand of claim 39, wherein the small molecule ligand is probe 2, 3, 4, 6, 8, 9, 13, 14 or 15.

    41. The small molecule ligand of claim 1, wherein the protein is CYB5R3 and the ligand binding site is defined by the following residues: LWYTLDR of the CYB5R3 protein having the UniProtKB accession number P00387.

    42. The small molecule ligand of claim 41, wherein the small molecule ligand is probe 3.

    43. The small molecule ligand of claim 1, wherein the protein is DECR1 and the ligand binding site is defined by the following residues: FDGGEEVLISGEFNDLR of the DECR1 protein having the UniProtKB accession number Q16698.

    44. The small molecule ligand of claim 43, wherein the small molecule ligand is probe 6.

    45. The small molecule ligand of claim 1, wherein the protein is DHX9 and the ligand binding site is defined by the following residues: ISAVSVAER of the DHX9 protein having the UniProtKB accession number Q08211.

    46. The small molecule ligand of claim 45, wherein the small molecule ligand is probe 3.

    47. The small molecule ligand of claim 1, wherein the protein is DLD and the ligand binding site is defined by the following residues: VLGAHILGPGAGEMVNEAALALEYGASCEDIAR of the DLD protein having the UniProtKB accession number P09622.

    48. The small molecule ligand of claim 47, wherein the small molecule ligand is probe 4, 13 or 14.

    49. The small molecule ligand of claim 1, wherein the protein is ECH1 and the ligand binding site is defined by: MFTAGIDLMDMASDILQPK, YQETFNVIER or EVDVGLAADVGTLQR of the ECH1 protein having the UniProtKB accession number Q13011.

    50. The small molecule ligand of claim 49, wherein the small molecule ligand is probe 3, 4, 6, 8, 13, 14 or 15.

    51. The small molecule ligand of claim 1, wherein the protein is EIF4A1 and the ligand binding site is defined by: MFVLDEADEMLSR or GYDVIAQAQSGTGK of the EIF4A1 protein having the UniProtKB accession number P60842.

    52. The small molecule ligand of claim 51, wherein the small molecule ligand is probe 9, 13 or 14.

    53. The small molecule ligand of claim 1, wherein the protein is EIF4A2 and the ligand binding site is defined by the following residues: GYDVIAQAQSGTGK of the EIF4A2 protein having the UniProtKB accession number Q14240.

    54. The small molecule ligand of claim 53, wherein the small molecule ligand is probe 13.

    55. The small molecule ligand of claim 1, wherein the protein is ETFB and the ligand binding site is defined by the following residues: HSMNPFCEIAVEEAVR of the ETFB protein having the UniProtKB accession number P38117.

    56. The small molecule ligand of claim 55, wherein the small molecule ligand is probe 3.

    57. The small molecule ligand of claim 1, wherein the protein is FECH and the ligand binding site is defined by the following residues: SEVVILFSAHSLPMSVVNR of the FECH protein having the UniProtKB accession number P22830.

    58. The small molecule ligand of claim 57, wherein the small molecule ligand is probe 4.

    59. The small molecule ligand of claim 1, wherein the protein is GLA and the ligand binding site is defined by: SILDWTSFNQER, FMCNLDCQEEPDSCISEK or LFMEMAELMVSEGWK of the GLA protein having the UniProtKB accession number P06280.

    60. The small molecule ligand of claim 59, wherein the small molecule ligand is probe 4 or 9.

    61. The small molecule ligand of claim 1, wherein the protein is GLB1 and the ligand binding site is defined by the following residues: TEAVASSLYDILAR of the GLB1 protein having the UniProtKB accession number P16278.

    62. The small molecule ligand of claim 61, wherein the small molecule ligand is probe 9.

    63. The small molecule ligand of claim 1, wherein the protein is GLO1 and the ligand binding site is defined by the following residues: GLAFIQDPDGYWIEILNPNK of the GLO1 protein having the UniProtKB accession number Q04760.

    64. The small molecule ligand of claim 63, wherein the small molecule ligand is probe 3 or 14.

    65. The small molecule ligand of claim 1, wherein the protein is GLUD1 and the ligand binding site is defined by: YSTDVSVDEVK or HGGTIPIVPTAEFQDR of the GLUD1 protein having the UniProtKB accession number P00367.

    66. The small molecule ligand of claim 65, wherein the small molecule ligand is probe 6.

    67. The small molecule ligand of claim 1, wherein the protein is GOLPH3 and the ligand binding site is defined by the following residues: EGYTSFWNDCISSGLR of the GOLPH3 protein having the UniProtKB accession number Q9H4A6.

    68. The small molecule ligand of claim 67, wherein the small molecule ligand is probe 14.

    69. The small molecule ligand of claim 1, wherein the protein is GSTP1 and the ligand binding site is defined by the following residues: FQDGDLTLYQSNTILR of the GSTP1 protein having the UniProtKB accession number P09211.

    70. The small molecule ligand of claim 69, wherein the small molecule ligand is probe 2.

    71. The small molecule ligand of claim 1, wherein the protein is HBA2 and the ligand binding site is defined by: VGAHAGEYGAEALER or VDPVNFK of the HBA2 protein having the UniProtKB accession number P69905.

    72. The small molecule ligand of claim 71, wherein the small molecule ligand is probe 4.

    73. The small molecule ligand of claim 1, wherein the protein is HEXA and the ligand binding site is defined by the following residues: LTSDLTFAYER of the HEXA protein having the UniProtKB accession number P06865.

    74. The small molecule ligand of claim 73, wherein the small molecule ligand is probe 9.

    75. The small molecule ligand of claim 1, wherein the protein is HMOX2 and the ligand binding site is defined by the following residues: AENTQFVK or LATTALYFTYSALEEEMER of the HMOX2 protein having the UniProtKB accession number P30519.

    76. The small molecule ligand of claim 75, wherein the small molecule ligand is probe 2, 3, 4, 6, 8, 14 or 15.

    77. The small molecule ligand of claim 1, wherein the protein is HSD17B4 and the ligand binding site is defined by the following residues: LGLLGLANSLAIEGR of the HSD17B4 protein having the UniProtKB accession number P51659.

    78. The small molecule ligand of claim 77, wherein the small molecule ligand is probe 3.

    79. The small molecule ligand of claim 1, wherein the protein is HSP90AB1 and the ligand binding site is defined by: VFIMDSCDELIPEYLNFIR or GFEVVYMTEPIDEYCVQQLK of the HSP90AB1 protein having the UniProtKB accession number P08238.

    80. The small molecule ligand of claim 79, wherein the small molecule ligand is probe 13 or 14.

    81. The small molecule ligand of claim 1, wherein the protein is HSP90B1 and the ligand binding site is defined by: LISLTDENALSGNEELTVK or YSQFINFPIYVWSSK of the HSP90B1 protein having the UniProtKB accession number P14625.

    82. The small molecule ligand of claim 81, wherein the small molecule ligand is probe 6 or 9.

    83. The small molecule ligand of claim 1, wherein the protein is HSPA8 and the ligand binding site is defined by the following residues: SFYPEEVSSMVLTK of the HSPA8 protein having the UniProtKB accession number P11142.

    84. The small molecule ligand of claim 83, wherein the small molecule ligand is probe 13 or 14.

    85. The small molecule ligand of claim 1, wherein the protein is IMPDH2 and the ligand binding site is defined by the following residues: YEQGFITDPVVLSPK of the IMPDH2 protein having the UniProtKB accession number P12268.

    86. The small molecule ligand of claim 85, wherein the small molecule ligand is probe 13.

    87. The small molecule ligand of claim 1, wherein the protein is LDHA and the ligand binding site is defined by the following residues: DLADELALVDVIEDK of the LDHA protein having the UniProtKB accession number P00338.

    88. The small molecule ligand of claim 87, wherein the small molecule ligand is probe 9.

    89. The small molecule ligand of claim 1, wherein the protein is LDHB and the ligand binding site is defined by the following residues: MVVESAYEVIK of the LDHB protein having the UniProtKB accession number P07195.

    90. The small molecule ligand of claim 89, wherein the small molecule ligand is probe 4.

    91. The small molecule ligand of claim 1, wherein the protein is LGMN and the ligand binding site is defined by the following residues: DYTGEDVTPQNFLAVLR of the LGMN protein having the UniProtKB accession number Q99538.

    92. The small molecule ligand of claim 91, wherein the small molecule ligand is probe 9.

    93. The small molecule ligand of claim 1, wherein the protein is LTA4H and the ligand binding site is defined by the following residues: LVVDLTDIDPDVAYSSVPYEK of the LTA4H protein having the UniProtKB accession number P09960.

    94. The small molecule ligand of claim 93, wherein the small molecule ligand is probe 4, 8 or 13.

    95. The small molecule ligand of claim 1, wherein the protein is NAMPT and the ligand binding site is defined by the following residues: YLLETSGNLDGLEYK of the NAMPT protein having the UniProtKB accession number P43490.

    96. The small molecule ligand of claim 95, wherein the small molecule ligand is probe 3, 6, 8, 13, 14 or 15.

    97. The small molecule ligand of claim 1, wherein the protein is NPM1 and the ligand binding site is defined by: DELHIVEAEAMNYEGSPIK or MSVQPTVSLGGFEITPPVVLR of the NPM1 protein having the UniProtKB accession number P06748.

    98. The small molecule ligand of claim 97, wherein the small molecule ligand is probe 13.

    99. The small molecule ligand of claim 1, wherein the protein is PCMT1 and the ligand binding site is defined by the following residues: LILPVGPAGGNQMLEQYDK of the PCMT1 protein having the UniProtKB accession number P22061.

    100. The small molecule ligand of claim 99, wherein the small molecule ligand is probe 2, 3 or 14.

    101. The small molecule ligand of claim 1, wherein the protein is PDHB and the ligand binding site is defined by the following residues: VFLLGEEVAQYDGAYK of the PDHB protein having the UniProtKB accession number P11177.

    102. The small molecule ligand of claim 101, wherein the small molecule ligand is probe 2, 3, 13 or 14.

    103. The small molecule ligand of claim 1, wherein the protein is PGK1 and the ligand binding site is defined by the following residues: QIVWNGPVGVFEWEAFAR of the PGK1 protein having the UniProtKB accession number P00558.

    104. The small molecule ligand of claim 103, wherein the small molecule ligand is probe 3.

    105. The small molecule ligand of claim 1, wherein the protein is PKM and the ligand binding site is defined by the following residues: IYVDDGLISLQVK or LAPITSDPTEATAVGAVEASFK of the PKM protein having the UniProtKB accession number P14618.

    106. The small molecule ligand of claim 105, wherein the small molecule ligand is probe 2 or 9.

    107. The small molecule ligand of claim 1, wherein the protein is POR and the ligand binding site is defined by the following residues: TALTYYLDITNPPR of the POR protein having the UniProtKB accession number P16435.

    108. The small molecule ligand of claim 107, wherein the small molecule ligand is probe 13 or 14.

    109. The small molecule ligand of claim 1, wherein the protein is PPP1CA or PPP1CC and the ligand binding site is defined by the following residues: IYGFYDECK, which corresponds to IYGFYDECK of the PPP1CC protein having the UniProtKB accession number P36873.

    110. The small molecule ligand of claim 109, wherein the small molecule ligand is probe 2.

    111. The small molecule ligand of claim 1, wherein the protein is PPP1CC and the ligand binding site is defined by the following residues: EIFLSQPILLELEAPLK of the PPP1CC protein having the UniProtKB accession number P36873.

    112. The small molecule ligand of claim 111, wherein the small molecule ligand is probe 14.

    113. The small molecule ligand of claim 1, wherein the protein is PPT1 and the ligand binding site is defined by the following residues: TLMEDVENSFFLNVNSQVTTVCQALAK of the PPT1 protein having the UniProtKB accession number P50897.

    114. The small molecule ligand of claim 113, wherein the small molecule ligand is probe 2, 4, 8, 9, 13, 14 or 15.

    115. The small molecule ligand of claim 1, wherein the protein is PRDX2 and the ligand binding site is defined by the following residues: TDEGIAYR of the PRDX2 protein having the UniProtKB accession number P32119.

    116. The small molecule ligand of claim 115, wherein the small molecule ligand is probe 13.

    117. The small molecule ligand of claim 1, wherein the protein is PSMB4 and the ligand binding site is defined by the following residues: FEGGVVIAADMLGSYGSLAR of the PSMB4 protein having the UniProtKB accession number P28070.

    118. The small molecule ligand of claim 117, wherein the small molecule ligand is probe 6.

    119. The small molecule ligand of claim 1, wherein the protein is PSMB5 and the ligand binding site is defined by: LLANMVYQYK or DAYSGGAVNLYHVR of the PSMB5 protein having the UniProtKB accession number P28074.

    120. The small molecule ligand of claim 119, wherein the small molecule ligand is probe 3, 4 or 6.

    121. The small molecule ligand of claim 1, wherein the protein is PSMB6 and the ligand binding site is defined by the following residues: SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK of the PSMB6 protein having the UniProtKB accession number P28072.

    122. The small molecule ligand of claim 121, wherein the small molecule ligand is probe 3, 6 or 14.

    123. The small molecule ligand of claim 1, wherein the protein is RAB7A and the ligand binding site is defined by the following residues: DEFLIQASPR of the RAB7A protein having the UniProtKB accession number P51149.

    124. The small molecule ligand of claim 123, wherein the small molecule ligand is probe 14.

    125. The small molecule ligand of claim 1, wherein the protein is RUVBL2 and the ligand binding site is defined by the following residues: ALESDMAPVLIMATNR of the RUVBL2 protein having the UniProtKB accession number Q9Y230.

    126. The small molecule ligand of claim 125, wherein the small molecule ligand is probe 14.

    127. The small molecule ligand of claim 1, wherein the protein is SMYD3 and the ligand binding site is defined by the following residues: DQYCFECDCFR of the SMYD3 protein having the UniProtKB accession number Q9H7B4.

    128. The small molecule ligand of claim 127, wherein the small molecule ligand is probe 9.

    129. The small molecule ligand of claim 1, wherein the protein is TPP1 and the ligand binding site is defined by the following residues: GCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLK of the TPP1 protein having the UniProtKB accession number 014773.

    130. The small molecule ligand of claim 129, wherein the small molecule ligand is probe 4, 9, 13, 14 or 15.

    131. The small molecule ligand of claim 1, wherein the protein is TXNDC17 and the ligand binding site is defined by the following residues: YEEVSVSGFEEFHR of the TXNDC17 protein having the UniProtKB accession number Q9BRA2.

    132. The small molecule ligand of claim 131, wherein the small molecule ligand is probe 14.

    133. The small molecule ligand of claim 1, wherein the protein is YWHAE and the ligand binding site is defined by: EAAENSLVAYK or AAFDDAIAELDTLSEESYK of the YWHAE protein having the UniProtKB accession number P62258.

    134. The small molecule ligand of claim 133, wherein the small molecule ligand is probe 13.

    135. The small molecule ligand of claim 1, wherein the protein is YWHAQ and the ligand binding site is defined by the following residues: TAFDEAIAELDTLNEDSYK of the YWHAQ protein having the UniProtKB accession number P27348.

    136. The small molecule ligand of claim 135, wherein the small molecule ligand is probe 14.

    137. The small molecule ligand of claim 1, wherein the protein is YWHAZ and the ligand binding site is defined by the following residues: TAFDEAIAELDTLSEESYK of the YWHAZ protein having the UniProtKB accession number P63104.

    138. The small molecule ligand of claim 137, wherein the small molecule ligand is probe 13 or 14.

    139. The small molecule ligand of claim 1, wherein the protein is EXO1 and the ligand binding site is defined by the following residues: SQGVDCLVAPYEADAQLAYLNK of the EXO1 protein having the UniProtKB accession number Q9UQ84.

    140. The small molecule ligand of claim 139, wherein the small molecule ligand is probe 2, 6, 8, 9 or 13.

    141. The small molecule ligand of claim 1, wherein the protein is LMNA and the ligand binding site is defined by the following residues: MQQQLDEYQELLDIK of the LMNA protein having the UniProtKB accession number P02545.

    142. The small molecule ligand of claim 141, wherein the small molecule ligand is probe 6 or 13.

    143. A method of identifying a small molecule ligand capable of interacting with a cellular protein, comprising: a) providing a cell which expresses the cellular protein; b) exposing the cell to a first-small molecule ligand of predetermined affinity for the cellular protein and a second small molecule ligand, wherein the first small molecule ligand of predetermined affinity has a structure comprising at least a photoreactive diazirine group and a terminal alkyne group; c) irradiating the cell with UV light; d) performing lysis on the cell; e) subjecting proteins in the post lysis material to tagging of the first small molecule ligand; and f) determining the level of tagging in the presence of the second small molecule ligand compared to the level of tagging in the absence of the second small molecule ligand.

    144. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (I): ##STR00076## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    145. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (Ia): ##STR00077## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring; and R.sup.3 is a optionally substituted C2-C6 alkyl.

    146. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (II): ##STR00078## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    147. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (IIa): ##STR00079## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring; and R.sup.3 is a optionally substituted C2-C6 alkyl.

    148. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (III): ##STR00080## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    149. The method of claim 143, wherein the at least one small molecule ligand has a structure represented by Formula (Ma): ##STR00081## wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring; and R.sup.3 is a optionally substituted C2-C6 alkyl.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0009] Various aspects of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings of which:

    [0010] FIG. 1A-FIG. 1H exemplify a chemical proteomic strategy for mapping of fragment-protein interactions in cells. FIG. 1A represents schematic depiction of fully functionalized fragment (FFF) probes and experimental workflow to identify FFF-protein interactions in cells by quantitative MS-based proteomics. Isotopically heavy and light amino acid-labeled cells are treated with distinct FFF probes for 30 min, followed by UV light exposure, lysis, conjugation to biotin azide by CuAAC, streptavidin enrichment of labeled proteins, tryptic digestion and subsequent analysis of tryptic peptides. FIG. 1B exemplifies structures of FFF probes. Shown are the constant (containing the diazirine photoreactive group and clickable alkyne handle) and variable (consisting of small-molecule fragments; enclosed in box) regions of probes. FIG. 1C exemplifies FFF probe-protein interactions in cells. HEK293T cells were treated with probes (20 M) for 30 min, followed by photocrosslinking and analysis as described in FIG. 1D. Asterisk mark representative distinct probe-protein interactions. FIG. 1E exemplifies additional profiles of FFF probe-protein interactions. FIG. 1D exemplifies experimental workflow to visualize FFF probe-protein interactions in cells by SDS-PAGE coupled with in-gel fluorescence scanning. Cells are treated with indicated FFF probe for 30 min, followed by photocrosslinking, lysis, CuAAC conjugation to a rhodamine (TAMRA)-azide tag, separation by SDS-PAGE, and visualization by in-gel fluorescence scanning FIG. 1E exemplifies FFF probe-protein interactions in cells. HEK293T cells were treated with FFF probes (20 M) for 30 min in situ, followed by photocrosslinking, separation of soluble and membrane fractions and analysis. (FIG. 1F, FIG. 1G) Fragment probes show concentration-dependent labeling of proteins in HEK293T cells (FIG. 1F), with little to no further change in protein labeling when incubated in cells for 5 to 30 min prior to photocrosslinking (FIG. 1G). FIG. 1H exemplifies HEK293T cells were treated with FFF probes (20 M) for 30 min, and the cells were then washed 1-2 with DPBS prior to photocrosslinking. Asterisks mark proteins that show similar extents of probe labeling before and after cell washing.

    [0011] FIG. 2A-FIG. 2T exemplify quantitative MS-based proteomic analysis of fragment-protein interactions in cells. FIG. 2A exemplifies heatmap showing relative protein enrichment values of FFF probes (200 M) versus control 1 in HEK293T cells. FIG. 2B is a representative SILAC ratio plot of proteins differentially enriched in probe-vs-probe (13 versus 3) experiments in HEK293T cells. Proteins preferentially enriched (>3-fold by either probe, depicted with dashed lines) in 13-vs-3 experiments that were also preferentially enriched (>2-fold) by 13 or 3 in probe-vs-control 1 experiments are depicted. FIG. 2B also exemplifies proteins that were strongly enriched by both probes in probe-vs-control 1 experiments and proteins not enriched by either probe. FIG. 2C exemplifies that most proteins demonstrating preferential enrichment (>3-fold) in probe-vs-probe experiments show corresponding preferential enrichment by the same probe in probe-vs-1 experiments. Light gray portions of bars mark fractions of proteins that were strongly enriched by both probes in probe-vs-control 1 experiments. (FIG. 2D-FIG. 2F) Heatmaps (FIG. 2D, FIG. 2E) and extracted MS1 chromatograms of representative tryptic peptides (FIG. 2F) for four example proteins showing strong preferential enrichment by one FFF probe over control 1 (FIG. 2D) and the corresponding results for these proteins in probe-vs-probe experiments (FIG. 2E). FIG. 2G exemplifies that the majority of proteins that are strongly enriched (SILAC ratio>10) by most FFF probes (8 of 11) in probe-vs-control 1 experiments show preferential enrichment by one FFF probe in probe-vs-probe experiments. (FIG. 2H-FIG. 2J) Heatmaps (FIG. 2H, FIG. 2I) and extracted MS1 chromatograms of representative tryptic peptides (FIG. 2J) for three example proteins showing enrichment by the majority of FFF probes over control 1 (FIG. 2H) and preferential enrichment by FFF probe 3 in probe-vs-probe experiments (FIG. 2I). FIG. 2K exemplifies that FFF probes show minimal toxicity in HEK293T cells when tested under conditions that mirror those used for mapping probe-protein interactions in cells (200 M FFF probe, 45 min incubation). Viability was assessed by CellTiter-Glo luminescent assay. Data represent average valuesSD. n=3 per group. FIG. 2L exemplifies SILAC ratio plots for representative FFF probes in which isotopically heavy and light amino acid-labeled HEK293T cells were treated with control 1 or the indicated FFF probe (200 M each). Dashed line indicates required threshold enrichment ratio (>5-fold) for designation of FFF targets. FIG. 2M exemplifies representative SILAC ratio plots for control experiments in which isotopically heavy and light amino acid-labeled HEK293T cells were treated with the same FFF probe (200 M). FIG. 2N exemplifies that fraction of targets for representative FFF probes that exhibit UV-dependent enrichment. Briefly, light cells were treated with 200 M of the corresponding probe and UV-irradiated while heavy cells were treated with the same probe and not exposed to UV light. Proteins were considered to be labeled in a UV-dependent fashion if >3-fold enrichment in light cells was observed. For each probe, >97% of protein targets exhibited UV-dependent enrichment. FIG. 2O exemplifies the number of protein targets enriched by corresponding FFF probes tested at 20 and 200 M. (FIG. 2P) Heatmap of enriched proteins in FFF probe-versus-control 1 experiments using 20 M FFF in HEK293T cells. FIG. 2Q exemplifies histogram of HEK293T cell-derived iBAQ values as estimates of the abundance distribution for protein targets of FFF probes. FIG. 2R exemplifies box-and-whisker plot of iBAQ values for FFF protein targets plotted versus the number of FFF probes that enriched each protein (=Spearman's correlation coefficient). FIG. 2S exemplifies histogram showing the number of FFF probe hits per protein target; a median value of three probes were found per protein. FIG. 2T exemplifies confirmation of FFF probe interaction profiles for representative protein targets. Proteins were recombinantly expressed as FLAG-tagged forms in HEK293T cells, followed by treatment with the indicated FFF probes (20 M), photocrosslinking and lysis, SDS-PAGE, and in-gel fluorescence scanning. FIG. 2U exemplifies that for proteins shown in FIG. 2T, extracted MS1 chromatograms and corresponding SILAC ratios of representative tryptic peptides quantified in the indicated probe-versus-probe experiments.

    [0012] FIG. 3A-FIG. 3P exemplify types of proteins and sites on these proteins targeted by FFF probes. (FIG. 3A, FIG. 3B) Categorization of FFF probe targets based on presence or absence in DrugBank (FIG. 3A) and protein class distribution (FIG. 3B). FIG. 3C exemplifies the number of FFF probe-modified peptides per protein target. FIG. 3D represents the distribution of probe-modified peptides that overlap (or do not overlap) with residues in predicted binding pockets of proteins with structures available in the PDB (as determined by fpocket analysis). (FIG. 3E-FIG. 3G) Examples of probe labeling sites mapped onto protein structures. Tryptic peptides containing probe-labeled sites are shown in green, and residues that overlap with predicted binding pockets are shown in beige. FIG. 3E exemplifies that FFF 13-modified peptide (aa 197-215) in human YWHAE (gray, PDB 3UBW) overlaps with the binding cleft that interacts with myeloid leukemia factor 1 (MLF1-derived peptide shown in yellow). This pocket is also the target of fragment (3S)-pyrrolindin-3-ol shown in purple. FIG. 3F exemplifies that FFF 13-modified peptide (aa 66-79) in human BAX (gray, PDB 4ZIE) complexed with BH3 peptide of BIM (cyan). FIG. 3G exemplifies the ribbon structure of human CTSB (gray, PDB 1GMY) highlighting FFF 9-modified peptide (aa 315-332) that is competed when HEK293T cells are co-treated with 9 (200 M) and CTSB inhibitor Z-FA-FMK. Represented in yellow is the catalytic cysteine C108 (red) bound to Z-FA-FMK. FIG. 3H exemplies that fraction of FFF probe targets with (membrane) or without (soluble) known/predicted transmembrane domains. FIG. 3I exemplifies the breakdown of soluble and membrane proteins, and corresponding probe-modified peptides from these proteins, with available crystal structures. FIG. 3J exemplifies the distribution of peptides labeled by one or more FFF probes. FIG. 3K exemplifies the distribution of probe-modified peptides based on overlap of their amino acid sequence with predicted binding pocket residues determined by fpocket analysis. FIG. 3L exemplifies the fraction of proteins with multiple probe-modified peptides that correspond to shared or distinct binding pockets. FIG. 3M exemplifies for proteins with annotated functional sites, distances of functional sites from probe-modified peptides. Functional sites include annotated enzyme catalytic residues (active sites), substrate binding sites, and metal-binding sites. FIG. 3N exemplifies the functional class distribution for proteins with FFF-modified peptides and subdivided based on availability of crystal structures for these proteins. FIG. 3O exemplifies FFF 9-modified peptides (green/tan, where tan further designates residues that overlap with those predicted to be part of binding pockets as determined by fpocket) in the structure of human GLA (gray, PDB 3S5Z). Peptides aa 50-68 and aa 241-253 are found near the active site (purple, with substrate alpha D-galactose depicted in yellow) and a secondary ligand binding site (with the beta D-galactose ligand depicted in yellow), respectively. FIG. 3P exemplifies overlap of protein targets of FFF probes with protein targets of cysteine-reactive fragments.

    [0013] FIG. 4A-FIG. 4M exemplify ligand discovery by competitive profiling of elaborated fragment-based compounds. FIG. 4A exemplifies a schematic for competitive profiling experiments. Isotopically heavy and light amino acid-labeled cells are treated with DMSO or elaborated fragment competitor, respectively, and the corresponding FFF probe for 30 min, followed by UV light exposure, cell lysis, CuAAC conjugation to biotin azide, streptavidin enrichment of probe-labeled proteins, tryptic digestion, and quantitative MS analysis of tryptic peptides. Competed targets are defined as those showing >3-fold reductions in FFF probe labeling in the presence of competitor compound. FIG. 4B exemplifies structure of fragment cores (upper) with representative elaborated competitors (lower, where core fragments are depicted). (FIG. 4C, FIG. 4D) Heatmap of (FIG. 4C) and number of competitor compounds per (FIG. 4D) competed protein targets in experiments using 20 M FFF and 160 M competitor. FIG. 4E exemplifies categorization of competed targets based on presence or absence in DrugBank for experiments using either 20 M FFF probes (+160 M competitors) or 200 M FFF probes (+200 M competitors). Targets competed in both 20 and 200 M data sets were excluded from the 200 M groups for the pie chart analysis. FIG. 4F exemplifies the protein functional class distribution for competed targets compared to all FFF probe targets. (FIG. 4G, FIG. 4H) Representative SILAC ratio plots for competitive profiling experiments with FFF probes 8 (FIG. 4G) and 3 (FIG. 4H) (20 M) and 8 competitors 20 and 21, respectively. PTGR2 (FIG. 4G) and SLC25A20 (FIG. 4H) were identified as the top competed targets for 20 and 21, respectively. Dotted lines indicate a three-fold ratio change threshold for designating competed targets. (FIG. 4I-FIG. 4K) Structures of elaborated fragment competitors with corresponding FFF probe used in competitive profiling experiments. Core fragment structure within each competitor compound is highlighted. FIG. 4L exemplifies the number of competed protein targets per competitor tested in HEK293T cells at 160 M with 20 M FFF probe. FIG. 4M exemplifies the total number of competed protein targets for five representative competitors (160-200 M) evaluated in experiments with high (200 M) or low (20 M) concentrations of FFF probes.

    [0014] FIG. 5A-FIG. 5S exemplify fragment-derived ligands disrupt function of PTGR2 and SLC25A20 in human cells. FIG. 5A exemplifies structure of hPTGR2 (PDB 2ZB4, gray) highlighting FFF 8-modified tryptic peptides (aa 55-66, green; and aa 261-278, pink) near the active site (15-keto-PGE2 in yellow, NADP+ in blue) of PTGR2. Probe labeling (200 M) of both tryptic peptides was blocked by 20 (200 M), as shown with representative MS1 plots for each peptide. FIG. 5B exemplifies PTGR2 ligands 22 and 20 but not inactive control 23, inhibited 15-keto prostaglandin E2 (15-keto-PGE2) reductase activity of recombinant PTGR2. Data represent average valuesSD; n=3 per group. FIG. 5C exemplifies structures (top) and activities (bottom gels) of initial PTGR2 ligand 20, optimized ligand 22, and inactive analog 23. Gels show concentration-dependent competitor blockade of FFF 8 labeling of recombinantly expressed FLAG-tagged PTGR2 in HEK29T cells. FIG. 5D exemplifies compound 22, but not inactive control 23, increased 15-keto-PGE2-dependent PPAR transcriptional activity in PTGR2-transfected HEK293T cells. Data represent average valuesSD; #### p<0.0001 for 15k-PGE2-treated PTGR2-transfected cells versus empty vector group, ****p<0.0001 for compound-versus DMSO-treated groups; n=3 per group. FIG. 5E exemplifies structures (top) and activities (bottom gels) of SLC25A20 ligand 21 and inactive analog 24. Gel shows concentration-dependent competitor blockade of FFF 3 labeling (20 M) of recombinantly expressed FLAG-tagged SLC25A20 in HEK29T cells. (FIG. 5F, FIG. 5G) Compound 21, but not 24, increases long-chain (>C14) acylcarnitine content (FIG. 5F) and reduces maximal exogenous fatty acid oxidation (FIG. 5G) of HSC-5 cells. Data represent average valuesSD; **p<0.01 and ****p<0.0001 for compound-versus DMSO-treated groups; n=3-5 per group. FIG. 5H exemplifies expanded screen of competitor compounds by monitoring reductions in FFF probe labeling of recombinantly expressed, FLAG-tagged human PTGR2 and SLC25A20 in HEK293T cells. FIG. 5I exemplifies competition gel profiles for competitor compounds corresponding to fragment elements from FFF probes 8 (competitor 49 for PTGR2) and 3 (competitor 50 for SLC25A20). FIG. 5J exemplifies optimization of PTGR2 inhibitors. Upiper images show structures of analogs of lead inhibitor 20 that were synthesized and tested. Lower image shows competition gel profiles for these analogs with human PTGR2 expressed in HEK293T cells. FIG. 5K exemplifies extracted MS1 chromatograms and corresponding SILAC ratios for representative tryptic peptides of PTGR2 from competition experiments with the indicated compounds, in which isotopically light and heavy amino acid-labeled HEK293T cells were treated with FFF probe 8 (20 M) and, respectively, DMSO (red) or competitor compound (blue) at the indicated concentrations. (FIG. 5L, FIG. 5M) Competition SILAC plots for optimized PTGR2 inhibitor 22 (60 M, FIG. 5L) and inactive control 23 (160 M, FIG. 5M) tested with FFF probe 8 (20 M). FIG. 5N exemplifies PTGR2 ligands 20 and 22 do not directly induce PPAR transcriptional activity in HEK293T cells co-transfected with a GAL4-PPAR luciferase reporter and an empty control vector. FIG. 5O exemplifies fitted full dose-response of data exemplified in FIG. 5D. FIG. 5P exemplify fitted IC.sub.50 curve for the concentration-dependent blockade of 3 (20 M) labeling of SLC25A20 expressed in HEK293T cells by 21 with representative competition gel shown below. Data represent average valuesSD; n=3 per group. FIG. 5Q exemplify extracted MS1 chromatograms and corresponding SILAC ratios for representative tryptic peptides of SLC25A20 from competition experiments with the indicated compounds at the indicated concentrations. FIG. 5R exemplify competition SILAC plots for inactive control 24 (160 M) tested with FFF probe 3 (20 M). FIG. 5S exemplify oxygen consumption rate (OCR) of HSC5 cells pre-treated for 40 min with 21 or 24 and then provided with exogenous palmitate. A concentration-dependent inhibition of basal and maximal respiration was observed for 21, but not 24. Data represent average valuesSD; n=5 per group. Oligomycin is an inhibitor of ATP synthase; FCCP=carbonyl cyanide-4-(trifluoromethoxy)phenylhydrazone is an ionophore uncoupling reagent that collapses mitochondrial membrane potential, allowing maximal respiration; RAA=rotenone and antimycin A are complex I and complex III inhibitors that block mitochondrial respiration, enabling the calculation of non-mitochondrial respiration.

    [0015] FIG. 6A-J illustrates additional small molecule ligands substituents disclosed herein.

    DETAILED DESCRIPTION OF THE DISCLOSURE

    [0016] Chemical probes can be discovered through multiple routes that can involve, for example, high-throughput screening (HTS) of individual proteins (target-based) or more complex cell and organismal systems (e.g., phenotype-based systems). In some instances, high-throughput screening, whether it is target- or phenotype-based, uses large chemical libraries (10.sup.6) composed of relatively high MW (300-500 Da) and structurally diverse compounds. In some cases, hit compounds from these libraries prove difficult to optimize due to their size, structural complexity, and suboptimal ligand efficiency. Target-based screens are furthermore generally performed with purified proteins and therefore do not provide direct information about the activity of ligands in more complex biological systems (e.g., cells), where factors that regulate protein structure and function, such as subcellular localization, post-translational modification, and protein-protein interactions can affect ligand-protein interactions. Alternatively, phenotype-based screening, for example, faces the challenge of identifying the molecular target(s) of active compounds, in particular, in cases where the screening hits display moderate-low potency.

    [0017] Fragment-based ligand and drug discovery (FBLD) is an approach that utilizes smaller numbers (10.sup.3) of low molecular weight compounds (<300 Da), and typically screened at high concentrations (>100 M). In some instances, FBLD emphasizes the identification of structurally simple hit compounds that are then optimized into more potent ligands. In some cases, a tenet of FBLD is that, by limiting molecular size, a relatively small number of fragments can represent a large fraction of accessible chemical space.

    [0018] In some embodiments, described herein is another method of identifying small molecule ligands for interaction with target proteins of interest. In some instances, this method allows for mapping of small molecule ligands for interaction with a target protein under native conditions, thereby allowing for accurate mapping of interaction with potential small molecule ligands. In some instances, the method allows for identification of novel proteins as druggable targets as the method eliminates the need of recombinant expression and purification.

    [0019] In additional embodiments, described herein include small molecule ligands, compositions, cells and assays related to the method of identifying small molecule ligands for interaction with target proteins of interest.

    Small Molecule Ligands

    [0020] In some embodiments, disclosed herein are small molecule ligands in which each of the small molecule ligand comprises a photoreactive diazirine group and an alkyne group. In some instances, the alkyne group is a terminal alkyne group. In some instances, the small molecule ligand further comprises a small molecule fragment. In some embodiments, the small molecule fragments described herein comprise non-naturally occurring molecules. In some instances, the non-naturally occurring molecules do not include natural and/or non-natural peptide fragments, or small molecules that are produced naturally within the body of a mammal.

    [0021] In some embodiments, a small molecule fragment described herein comprises a molecule weight of about 100 Dalton or higher. In some embodiments, the small molecule fragment comprises a molecule weight of about 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000 Dalton, or higher. In some instances, the molecule weight of the small molecule fragment is between about 150 and about 500, about 150 and about 450, about 150 and about 440, about 150 and about 430, about 150 and about 400, about 150 and about 350, about 150 and about 300, about 150 and about 250, about 170 and about 500, about 180 and about 450, about 190 and about 400, about 200 and about 350, about 130 and about 300, or about 120 and about 250 Dalton.

    [0022] In some embodiments, the molecule weight of a small molecule fragment described herein is calculated based on the molecule weight of carbon and hydrogen atoms and optionally further based on nitrogen, oxygen and/or sulfur atoms of the small molecule fragment. In some cases, the molecule weight of the small molecule fragment is calculated without the molecular weight of one or more elements selected from a halogen, a nonmetal, a transition metal, or a combination thereof.

    [0023] In some embodiments, a small molecule fragment described herein comprises micromolar or millimolar binding affinity. In some instances, the small molecule fragment comprises a binding affinity of about 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 1 M, 10 M, 1000 M, 5000 M, 1 mM, 10 mM, or higher.

    [0024] In some embodiments, a small molecule fragment described herein has a high ligand efficiency (LE). Ligand efficiency is the measurement of the binding energy per atom of a ligand to its binding partner. In some instances, the ligand efficiency is defined as the ratio of the Gibbs free energy (G) to the number of non-hydrogen atoms of the compound (N):


    LE=(G)/N.

    [0025] In some cases, LE is also arranged as:


    LE=1.4(log IC.sub.50)/N.

    [0026] In some instances, the LE score is about 0.3 kcal mol.sup.1HA.sup.1, about 0.35 kcal mol.sup.1HA.sup.1, about 0.4 kcal mol.sup.1HA.sup.1, or higher.

    [0027] In some embodiments, a small molecule fragment described herein is designed based on the Rule of 3. In some embodiments, the Rule of 3 comprises a non-polar solvent-polar solvent (e.g. octanol-water) partition coefficient log P of about 3 or less, a molecular mass of about 300 Daltons or less, about 3 hydrogen bond donors or less, about 3 hydrogen bond acceptors or less, and about 3 rotatable bonds or less.

    [0028] In some embodiments, a small molecule fragment described herein comprises three cyclic rings or less.

    [0029] In some embodiments, a small molecule fragment described herein binds to a binding site of a protein in which the protein is about 20 amino acid residues in length or more. In some instances, the small molecule fragment described herein binds to a binding site of a protein in which the protein is about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000 amino acid residues in length or more.

    [0030] In some embodiments, a small molecule fragment described herein is obtained from a compound library. In some cases, the compound library comprises ChemBridge fragment library, Pyramid Platform Fragment-Based Drug Discovery, Maybridge fragment library, FRGx from AnalytiCon, TCI-Frag from AnCoreX, Bio Building Blocks from ASINEX, BioFocus 3D from Charles River, Fragments of Life (FOL) from Emerald Bio, Enamine Fragment Library, IOTA Diverse 1500, BIONET fragments library, Life Chemicals Fragments Collection, OTAVA fragment library, Prestwick fragment library, Selcia fragment library, TimTec fragment-based library, Allium from Vitas-M Laboratory, or Zenobia fragment library.

    [0031] In some embodiments, a small molecule fragment comprises a structure illustrated in FIG. 1B, in which each fragment nomenclature (or probe nomenclature) is illustrated by a numerical number. For example, the small molecule fragment

    ##STR00001##

    is assigned as probe 1.

    [0032] In some embodiments, a small molecule ligand described herein has a structure represented by Formula (I):

    ##STR00002##

    wherein R is selected from the groups provided below:

    ##STR00003## ##STR00004##

    Protein Targets

    [0033] In some embodiments, a protein target described herein is a soluble protein or a membrane protein. In some cases, a protein target described herein is involved in one or more of a biological process such as protein transport, lipid metabolism, apoptosis, transcription, electron transport, mRNA processing, or host-virus interaction. In some instances, the protein target is associated with one or more of diseases such as cancer or one or more disorders or conditions such as immune, metabolic, developmental, reproductive, neurological, psychiatric, renal, cardiovascular, or hematological disorders or conditions.

    [0034] In some embodiments, the protein target comprises one or more functions of an enzyme, a transporter, a receptor, a channel protein, an adaptor protein, a chaperone, a signaling protein, a plasma protein, transcription related protein, translation related protein, mitochondrial protein, or cytoskeleton related protein. In some embodiments, the protein target is an enzyme, a transporter, a receptor, a channel protein, an adaptor protein, a chaperone, a signaling protein, a plasma protein, transcription related protein, translation related protein, mitochondrial protein, or cytoskeleton related protein. In some instances, the protein target has an uncategorized function.

    [0035] In some embodiments, the protein target is an enzyme. An enzyme is a protein molecule that accelerates or catalyzes chemical reaction. In some embodiments, non-limiting examples of enzymes include kinases, proteases, or deubiquitinating enzymes.

    [0036] In some instances, exemplary kinases include tyrosine kinases such as the TEC family of kinases such as Tec, Bruton's tyrosine kinase (Btk), interleukin-2-indicible T-cell kinase (Itk) (or Emt/Tsk), Bmx, and Txk/Rlk; spleen tyrosine kinase (Syk) family such as SYK and Zeta-chain-associated protein kinase 70 (ZAP-70); Src kinases such as Src, Yes, Fyn, Fgr, Lck, Hck, Blk, Lyn, and Frk; JAK kinases such as Janus kinase 1 (JAK1), Janus kinase 2 (JAK2), Janus kinase 3 (JAK3), and Tyrosine kinase 2 (TYK2); or ErbB family of kinases such as Her1 (EGFR, ErbB1), Her2 (Neu, ErbB2), Her3 (ErbB3), and Her4 (ErbB4).

    [0037] In some embodiments, the protein target is a protease. In some embodiments, the protease is a caspase. In some instances, the caspase is an initiator (apical) caspase. In some instances, the caspase is an effector (executioner) caspase. Exemplary caspase includes CASP2, CASP8, CASP9, CASP10, CASP3, CASP6, CASP7, CASP4, and CASP5. In some instances, the cysteine protease is a cathepsin. Exemplary cathepsin includes Cathepsin B, Cathepsin C, CathepsinF, Cathepsin H, Cathepsin K, Cathepsin L1, Cathepsin L2, Cathepsin O, Cathepsin S, Cathepsin W, or Cathepsin Z.

    [0038] In some embodiments, the protein target is a deubiquitinating enzyme (DUB). In some embodiments, exemplary deubiquitinating enzymes include cysteine proteases DUBs or metalloproteases. Exemplary cysteine protease DUBs include ubiquitin-specific protease (USP/UBP) such as USP1, USP2, USP3, USP4, USP5, USP6, USP7, USP8, USP9X, USP9Y, USP10, USP11, USP12, USP13, USP14, USP15, USP16, USP17, USP17L2, USP17L3, USP17L4, USP17L5, USP17L7, USP17L8, USP18, USP19, USP20, USP21, USP22, USP23, USP24, USP25, USP26, USP27X, USP28, USP29, USP30, USP31, USP32, USP33, USP34, USP35, USP36, USP37, USP38, USP39, USP40, USP41, USP42, USP43, USP44, USP45, or USP46; ovarian tumor (OTU) proteases such as OTUB1 and OTUB2; Machado-Josephin domain (MJD) proteases such as ATXN3 and ATXN3L; and ubiquitin C-terminal hydrolase (UCH) proteases such as BAP1, UCHL1, UCHL3, and UCHL5. Exemplary metalloproteases include the Jab1/Mov34/Mpr1 Pad1 N-terminal+ (MPN+) (JAMM) domain proteases.

    [0039] In some embodiments, exemplary proteins as enzymes include, but are not limited to, abhydrolase domain-containing protein 10, mitochondrial (ABHD10); aconitate hydratase, mitochondrial (ACO2); low molecular weight phosphotyrosine protein phosphatase (ACP1); chaperone activity of bcl complex-like, mitochondrial (ADCK3); adenosine kinase (ADK); adenylosuccinate synthetase isozyme 2 (ADSS); acylglycerol kinase, mitochondrial (AGK); alkyldihydroxyacetonephosphate synthase, peroxisomal (AGPS); apoptosis-inducing factor 1, mitochondrial (AIFM1); Delta-1-pyrroline-5-carboxylate synthase (ALDH18A1); mitochondrial 10-formyltetrahydrofolate dehydrogen (ALDH1L2); alpha-aminoadipic semialdehyde dehydrogenase (ALDH7A1); ATPase ASNA1 (ASNA1); ATPase family AAA domain-containing protein 3A (ATAD3A); bifunctional purine biosynthesis protein PURH (ATIC); bleomycin hydrolase (BLMH); calpain-1 catalytic subunit (CAPN1); creatine kinase B-type (CKB); caseinolytic peptidase B protein homolog (CLPB); putative ATP-dependent Clp protease proteolytic subunit (CLPP); carnitine O-palmitoyltransferase 2, mitochondrial (CPT2); probable serine carboxypeptidase CPVL (CPVL); cathepsin B (CTSB); cathepsin D (CTSD); NADH-cytochrome b5 reductase 3 (CYB5R3); cytochrome P450 20A1 (CYP20A1); 2,4-dienoyl-CoA reductase, mitochondrial (DECR1); delta(24)-sterol reductase (DHCR24); dihydrolipoyl dehydrogenase, mitochondrial (DLD); deoxyribonuclease-2-alpha (DNASE2); endothelin-converting enzyme 1 (ECE1); Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (ECH1); eukaryotic translation initiation factor 3 subunit (EIF3F); elongation of very long chain fatty acids protein (ELOVL2); exonuclease 1 (EXO1); phenylalanine-tRNA ligase beta subunit (FARSB); fatty acid synthase (FASN); squalene synthase (FDFT1); ferrochelatase, mitochondrial (FECH); alpha-galactosidase A (GLA); beta-galactosidase (GLB1); lactoylglutathione lyase (GLO1); glutamate dehydrogenase 1, mitochondrial (GLUD1); hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (HADH); trifunctional enzyme subunit alpha, mitochondrial (HADHA); histidine-tRNA ligase, cytoplasmic (HARS); minor histocompatibility antigen H13 (HM13); heme oxygenase 2 (HMOX2); estradiol 17-beta-dehydrogenase 12 (HSD17B12); peroxisomal multifunctional enzyme type 2 (HSD17B4); insulin-degrading enzyme (IDE); isocitrate dehydrogenase (IDH2); gamma-interferon-inducible lysosomal thiol reductase (IFI30); inosine-5-monophosphate dehydrogenase 2 (IMPDH2); leucine-tRNA ligase, cytoplasmic (LARS); L-lactate dehydrogenase A chain (LDHA); L-lactate dehydrogenase B chain (LDHB); legumain (LGMN); lysosomal acid lipase/cholesteryl ester hydrolase (LIPA); methyltransferase-like protein 7A (METTL7A); NADH-ubiquinone oxidoreductase chain 2 (MT-ND2); monofunctional C1-tetrahydrofolate synthase, mitochondrial (MTHFD1L); alpha-N-acetylglucosaminidase (NAGLU); peroxisomal NADH pyrophosphatase NUDT12 (NUDT12); nucleoside diphosphate-linked moiety X motif 19, mitochondrial (NUDT19); ornithine aminotransferase, mitochondrial (OAT); phosphoenolpyruvate carboxykinase (PCK2); protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT1); prenylcysteine oxidase 1 (PCYOX1); presequence protease, mitochondrial (PITRM1); pyruvate kinase isozymes M1/M2 (PKM); peroxiredoxin-2 (PRDX2); DNA-dependent protein kinase catalytic subunit (PRKDC); proteasome subunit alpha type-2 (PSMA2); dolichyl-diphosphooligosaccharide-protein glycosyltransferase subnit 1 (RPN1); RuvB-like 1 (RUVBL1); thimet oligopeptidase (THOP1); or tripeptidyl-peptidase 1 (TPP1).

    [0040] In some embodiments, the protein target is a transcription factor or regulator. Exemplary protein targets as transcription factors and regulators include, but are not limited to, actin-like protein 6A (ACTL6A); putative adenosylhomocysteinase 2 (AHCYL1); acidic leucine-rich nuclear phosphoprotein 32 family member A (ANP32A); complement component 1 Q subcomponent-binding protein (C1QBP); probable ATP-dependent RNA helicase DDX17 (DDX17); probable ATP-dependent RNA helicase DHX36 (DHX36); elongation factor 1-alpha 1 (EEF1A1); eukaryotic initiation factor 4A-I (EIF4A1); electron transfer flavoprotein subunit beta (ETFB); far upstream element-binding protein 1 (FUBP1); histone H1.2 (HIST1H1C); heterogeneous nuclear ribonucleoprotein K (HNRNPK); interleukin enhancer-binding factor 2 (ILF2); DNA replication licensing factor MCM2 (MCM2); DNA replication licensing factor MCM4 (MCM4); N-alpha-acetyltransferase 15, NatA auxiliary subunit (NAA15); non-POU domain-containing octamer-binding protein (NONO); nucleobindin-1 (UCB1); polyadenylate-binding protein 1 (PABPC1); paraspeckle component 1 (PSPC1); RNA-binding protein 14 (RBM14); putative RNA-binding protein 3 (RBM3); RNA-binding motif protein, X chromosome (RBMX); 40S ribosomal protein S3 (RPS3); X-ray repair cross-complementing protein 6 (XRCC6); nuclease-sensitive element-binding protein 1 (YBX1); prostaglandin reductase 2 (PTGR2); zinc binding alcohol dehydrogenase domain containing 2 (ZADH2); or lysophosphatidylcholine acetyltransferase 3 (LPCAT3).

    [0041] In some embodiments, the protein target is a channel, transporter or receptor. Exemplary protein targets as channels, transporters, or receptors include, but are not limited to, alpha-actinin-4 (ACTN4); AP-1 complex subunit beta-1 (AP1B1); ADP-ribosylation factor 1 (ARF1); ADP-ribosylation factor 3 (ARF3); ADP-ribosylation factor 4 (ARF4); ADP-ribosylation factor 5 (ARF5); sodium/potassium-transporting ATPase subunit alpha (ATP 1A1); sarcoplasmic/endoplasmic reticulum calcium ATPase (ATP2A2); plasma membrane calcium-transporting ATPase 1 (ATP2B1); plasma membrane calcium-transporting ATPase 4 (ATP2B4); ATP synthase subunit alpha, mitochondrial (ATP5A1); coatomer subunit beta (COPB1); exportin-2 (CSE1L); Electron transfer flavoprotein subunit beta (ETFB); heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1); heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2); importin-4 (IPO4); cytochrome c oxidase subunit 2 (MT-CO2); nuclear autoantigenic sperm protein (NASP); nucleoporin Nup37 (NUP37); nuclear pore complex protein Nup93 (NUP93); nuclear transport factor 2 (NUTF2); membrane-associated progesterone receptor component (PGRMC2); prohibitin-2 (PHB2); protein quaking (QKI); sideroflexin-1 (SFXN1); ADP/ATP translocase 3 (SLC25A6); mitochondrial carnitine/acylcarnitine carrier protein (SLC25A20) or voltage-dependent anion-selective channel protein (VDAC3).

    [0042] In some embodiments, the protein target is a chaperone. Exemplary protein targets as chaperones include, but are not limited to, acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B); large proline-rich protein BAG6 (BAG6); T-complex protein 1 subunit beta (CCT2); peptidyl-prolyl cis-trans isomerase FKBP4 (FKBP4); heat shock protein HSP 90-beta (HSP90AB1); endoplasmin (HSP90B1); LDLR chaperone MESD (MESDC2); nucleophosmin (NPM1); or protein SET (SET).

    [0043] In some embodiments, the protein target is an adapter, scaffolding or modulator protein. Exemplary protein targets as adapter, scaffolding, or modulator proteins include, but are not limited to, actin, alpha skeletal muscle (ACTA1); actin, cytoplasmic 1 (ACTB); cytoskeleton-associated protein 4 (CKAP4); cytochrome c oxidase subunit 5A, mitochondrial (COX5A); catenin beta-1 (CTNNB1); FGFR1 oncogene partner (FGFR1OP); HAUS augmin-like complex subunit 2 (HAUS2); hemoglobin subunit alpha (HBA2); kinesin-like protein KIF11 (KIF11); myosin-10 (MYH10); myosin-9 (MYH9); phosphatidylinositol transfer protein beta isoform (PITPNB); proactivator polypeptide (PSAP); endophilin-B1 (SH3GLB1); stomatin-like protein 2 (STOML2); tubulin beta-4B chain (TUBB4B); or tubulin beta-6 chain (TUBB6).

    [0044] In some embodiments, a protein target comprises a protein illustrated in Tables 1-4. In some instances, a protein target comprises a protein illustrated in Table 1. In some embodiments, the protein target comprises a binding site denoted in Table 1. In some instances, a protein target comprises a protein illustrated in Table 2. In some embodiments, the protein target comprises a binding site denoted in Table 2. In some instances, a protein target comprises a protein illustrated in Table 3. In some embodiments, the protein target comprises a binding site denoted in Table 3. In some instances, a protein target comprises a protein illustrated in Table 4.

    Methods of Use

    [0045] In some embodiments, disclosed herein include a method of identifying a protein that is capable of interacting with a small molecule ligand. In some instances, the method comprises (a) providing a cell sample; (b) exposing the cell sample to a plurality of potential small molecule ligands having a structure comprising at least a photoreactive diazirine group and a terminal alkyne group; (c) irradiating the cell sample with UV light; (d) performing lysis on the cell sample; (e) subjecting proteins in the post lysis material to fluorophore tagging (e.g., rhodamine, fluorescein, and the like); and (f) isolating at least one fluorophore-tagged protein. In other instances, the method comprises (a) providing a cell sample; (b) exposing the cell sample to the small molecule ligand having a structure comprising at least a photoreactive diazirine group, and a terminal alkyne group; (c) irradiating the cell sample with UV light; (d) performing lysis on the cell sample; (e) subjecting the proteins in the post lysis material to tagging; and (f) isolating the tagged proteins for analysis to identify a protein capable of interating with the small molecule ligand.

    [0046] In some cases, the small molecule ligand has a structure represented by Formula (I):

    ##STR00005##

    wherein R is selected from the groups provided below:

    ##STR00006## ##STR00007##

    [0047] In some cases, the small molecule ligand has a structure represented by Formula (Ib):

    ##STR00008##

    wherein R is an amide substituent bonded to the NH group of the amines provided in FIGS. 6A-J.

    [0048] In some cases, the small molecule ligand has a structure represented by Formula (II):

    ##STR00009##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0049] In some cases, the small molecule ligand has a structure represented by Formula (III):

    ##STR00010##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0050] In some cases, the small molecule ligand has a structure represented by Formula (III):

    ##STR00011##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0051] In some cases, the small molecule ligand has a structure represented by Formula (IV):

    ##STR00012##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0052] In some cases, the small molecule ligand has a structure represented by Formula (V):

    ##STR00013##

    wherein R.sup.1 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl.

    [0053] In some cases, the small molecule ligand has a structure represented by Formula (VI):

    ##STR00014##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0054] In some cases, the tagging further comprises i) attaching the small molecule ligand-protein complex to a biotin moiety and ii) interacting the biotin moiety with a streptavidin-coupled bead.

    [0055] In some instances, the analysis comprises a proteomic analysis.

    [0056] In some instances, a cell from the cell sample is a mammalian cell. In some cases, a cell from the cell sample is obtained from HEK293T, K562, or HSC-5 cell lines. In some cases, a cell from the cell sample is a tumor cell.

    [0057] In some cases, the method is an in situ method. In other cases, the method is an in vitro method.

    [0058] In some embodiments, also disclosed herein include a method of identifying a small molecule ligand binding site on an isolated protein. In some cases, the method comprises (a) providing an isolated protein; (b) exposing the protein to a plurality of potential small molecule ligands having a structure comprising at least a photoreactive diazirine group and a terminal alkyne group; (c) irradiating the protein with UV light; (d) tagging the protein with biotin; (e) binding the biotin-tagged protein to solid phase beads; (f) digesting the protein to provide protein fragments; and (g) analyzing the protein fragments to determine the small molecule ligand binding site.

    [0059] In some instances, the isolated protein is selected from Tables 1-3. In some cases, the isolated protein is selected from Table 1. In some cases, the isolated protein is selected from Table 2. In some cases, the isolated protein is selected from Table 3. In some cases, the isolated protein is a recombinant protein.

    [0060] In some cases, the small molecule ligand has a structure represented by Formula (I):

    ##STR00015##

    wherein R is selected from the groups provided below:

    ##STR00016## ##STR00017##

    [0061] In some cases, the small molecule ligand has a structure represented by Formula (Ib):

    ##STR00018##

    wherein R is an amide substituent bonded to the NH group of the amines provided in FIGS. 6A-J.

    [0062] In some cases, the small molecule ligand has a structure represented by Formula (II):

    ##STR00019##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0063] In some cases, the small molecule ligand has a structure represented by Formula (III):

    ##STR00020##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0064] In some cases, the small molecule ligand has a structure represented by Formula (III):

    ##STR00021##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0065] In some cases, the small molecule ligand has a structure represented by Formula (IV):

    ##STR00022##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0066] In some cases, the small molecule ligand has a structure represented by Formula (V):

    ##STR00023##

    wherein R.sup.1 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl.

    [0067] In some cases, the small molecule ligand has a structure represented by Formula (VI):

    ##STR00024##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring.

    [0068] In some instances, the analyzing comprises a proteomic analysis.

    [0069] In some embodiments, tagging comprises labeling the protein with a labeling group for use in further analysis of the protein. In some instances, the labeling group comprises a fluorophore. In some instances, a fluorophore comprises rhodamine, rhodol, fluorescein, thiofluorescein, aminofluorescein, carboxyfluorescein, chlorofluorescein, methylfluorescein, sulfofluorescein, aminorhodol, carboxyrhodol, chlororhodol, methylrhodol, sulforhodol, aminorhodamine, carboxyrhodamine, chlororhodamine, methylrhodamine, sulforhodamine, thiorhodamine, cyanine, indocarbocyanine, oxacarbocyanine, thiacarbocyanine, merocyanine, cyanine 2, cyanine 3, cyanine 3.5, cyanine 5, cyanine 5.5, cyanine 7, oxadiazole derivatives, pyridyloxazole, nitrobenzoxadiazole, benzoxadiazole, pyren derivatives, cascade blue, oxazine derivatives, Nile red, Nile blue, cresyl violet, oxazine 170, acridine derivatives, proflavin, acridine orange, acridine yellow, arylmethine derivatives, auramine, crystal violet, malachite green, tetrapyrrole derivatives, porphin, phtalocyanine, bilirubin 1-dimethylaminonaphthyl-5-sulfonate, 1-anilino-8-naphthalene sulfonate, 2-p-touidinyl-6-naphthalene sulfonate, 3-phenyl-7-isocyanatocoumarin, N-(p-(2-benzoxazolyl)phenyl)maleimide, stilbenes, pyrenes, 6-FAM (Fluorescein), 6-FAM (NHS Ester), 5(6)-FAM, 5-FAM, Fluorescein dT, 5-TAMRA-cadavarine, 2-aminoacridone, HEX, JOE (NHS Ester), MAX, TET, ROX, TAMRA, TARMA (NHS Ester), TEX 615, ATTO 488, ATTO 532, ATTO 550, ATTO 565, ATTO Rho101, ATTO 590, ATTO 633, ATTO 647N, TYE 563, TYE 665, or TYE 705.

    [0070] In some embodiments, the labeling group comprises a biotin, a streptavidin, bead, resin, a solid support, or a combination thereof. As used herein, a biotin described herein comprises biotin and biotin derivatives. Exemplary biotin derivatives include, but are not limited by, desthiobiotin, biotin alkyne or biotin azide. In some instances, a biotin described herein is desthiobiotin. In some cases, a biotin described herein is d-Desthiobiotin.

    [0071] In some instances, the labeling group comprising biotin further comprises a linker. In some cases, the linker is about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more residues in length. In some instances, the linker further comprises a cleavage site, such as a protease cleavage site (e.g., TEV cleavage site). In some cases, the biotin-linker moiety is further isotopically-labeled, for example, isotopically labeled with .sup.13C and .sup.15N atoms at one or more amino acid residue positions. In some cases, the biotin-linker moiety is a isotopically-labeled TEV-tag as described in Weerapana, et al., Quantitative reactivity profiling predicts functional cysteines in proteomes, Nature 468(7325): 790-795.

    [0072] In some cases, the labeling group comprising biotin further interacts with a streptavidin moiety. In some instances, the labeling group comprising biotin is further attached to a bead, such as a streptavidin-coupled bead. In some instances, the labeling group comprising biotin is further attached to a resin or a solid support, such as a streptavidin-coupled resin or a streptavidin-coupled solid support. In some instances, the solid support is a plate, a platform, a cover slide, a microfluidic channel, and the like.

    [0073] In some cases, the method is a high-throughput method.

    [0074] In some embodiments, disclosed herein also include proteins and their respective binding sites identified for interaction with one or more small molecule ligands. In some instances, the binding sites are disclosed in Tables 1-3. In some cases, the binding sites are disclosed in Table 3.

    [0075] In some embodiments, disclosed herein is a small molecule ligand which binds to the ACP1 protein, wherein the small molecule ligand binds to one or more of the following residues: VDSAATSGYEIGNPPDYR of the ACP1 protein having the UniProtKB accession number P24666. In some instances, also disclosed herein is a small molecule ligand which binds to the ACP1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: VDSAATSGYEIGNPPDYR of the ACP1 protein having the UniProtKB accession number P24666. In some instances, the small molecule ligand is probe 13.

    [0076] In some embodiments, disclosed herein is a small molecule ligand which binds to the ADCK3 protein, wherein the small molecule ligand binds to one or more of the following residues: LGQMLSIQDDAFINPHLAK of the ADCK3 protein having the UniProtKB accession number Q8NI60. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ADCK3 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LGQMLSIQDDAFINPHLAK of the ADCK3 protein having the UniProtKB accession number Q8NI60. In some instances, the small molecule ligand is probe 14.

    [0077] In some embodiments, disclosed herein is a small molecule ligand which binds to the ADK protein, wherein the small molecule ligand binds to one or more of the following residues: IFTLNLSAPFISQFYK of the ADK protein having the UniProtKB accession number P55263. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ADK protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: IFTLNLSAPFISQFYK of the ADK protein having the UniProtKB accession number P55263. In some instances, the small molecule ligand is probe 2.

    [0078] In some embodiments, disclosed herein is a small molecule ligand which binds to the ADSS protein, wherein the small molecule ligand binds to one or more of the following residues: FIEDELQIPVK of the ADSS protein having the UniProtKB accession number P30520. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ADSS protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: FIEDELQIPVK of the ADSS protein having the UniProtKB accession number P30520. In some instances, the small molecule ligand is probe 14.

    [0079] In some embodiments, disclosed herein is a small molecule ligand which binds to the AIFM1 protein, wherein the small molecule ligand binds to one or more of the following residues: PYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAK of the AIFM1 protein having the UniProtKB accession number 095831. In some embodiments, also disclosed herein is a small molecule ligand which binds to the AIFM1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: PYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAK of the AIFM1 protein having the UniProtKB accession number 095831. In some instances, the small molecule ligand is probe 2, 3, 4 or 6.

    [0080] In some embodiments, disclosed herein is a small molecule ligand which binds to the ALDH7A1 protein, wherein the small molecule ligand binds to one or more of the following residues: ILVEGVGEVQEYVDICDYAVGLSR of the ALDH7A1 protein having the UniProtKB accession number P49419. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ALDH7A1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: ILVEGVGEVQEYVDICDYAVGLSR of the ALDH7A1 protein having the UniProtKB accession number P49419. In some instances, the small molecule ligand is probe 8 or 13.

    [0081] In some embodiments, disclosed herein is a small molecule ligand which binds to a protein selected from ARF4 or ARF5, wherein the small molecule ligand binds to one or more of the following residues: LGEIVTTIPTIGFNVETVEYK, corresponding to LGEIVTTIPTIGFNVETVEYK of the ARF4 protein having the UniProtKB accession number P18085. In some embodiments, also disclosed herein is a small molecule ligand which binds to a protein selected from ARF4 or ARF5, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LGEIVTTIPTIGFNVETVEYK, corresponding to LGEIVTTIPTIGFNVETVEYK of the ARF4 protein having the UniProtKB accession number P18085. In some instances, the small molecule ligand is probe 2, 3, 4, 8 or 13.

    [0082] In some embodiments, disclosed herein is a small molecule ligand which binds to the ARL1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: GTGLDEAMEWLVETLK and LQVGEVVTTIPTIGFNVETVTYK of the ARL1 protein having the UniProtKB accession number P40616. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ARL1 protein, wherein the small molecule ligand binds a ligand binding site defined by: GTGLDEAMEWLVETLK or LQVGEVVTTIPTIGFNVETVTYK of the ARL1 protein having the UniProtKB accession number P40616. In some instances, the small molecule ligand is probe 13 or 14.

    [0083] In some embodiments, disclosed herein is a small molecule ligand which binds to the ATIC protein, wherein the small molecule ligand binds to one or more of the following residues: AFTHTAQYDEAISDYFR of the ATIC protein having the UniProtKB accession number P31939. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ATIC protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: AFTHTAQYDEAISDYFR of the ATIC protein having the UniProtKB accession number P31939. In some instances, the small molecule ligand is probe 13.

    [0084] In some embodiments, disclosed herein is a small molecule ligand which binds to the BLMH protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: CYFFLSAFVDTAQR and GEISATQDVMMEEIFR of the BLMH protein having the UniProtKB accession number Q13867. In some embodiments, also disclosed herein is a small molecule ligand which binds to the BLMH protein, wherein the small molecule ligand binds a ligand binding site defined by: CYFFLSAFVDTAQR or GEISATQDVMMEEIFR of the BLMH protein having the UniProtKB accession number Q13867. In some instances, the small molecule ligand is probe 13 or 14.

    [0085] In some embodiments, disclosed herein is a small molecule ligand which binds to the CALR protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: SGTIFDNFLITNDEAYAEEFGNETWGVTK and HEQNIDCGGGYVK of the CALR protein having the UniProtKB accession number P27797. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CALR protein, wherein the small molecule ligand binds a ligand binding site defined by: SGTIFDNFLITNDEAYAEEFGNETWGVTK or HEQNIDCGGGYVK of the CALR protein having the UniProtKB accession number P27797. In some instances, the small molecule ligand is probe 6, 9, or 13.

    [0086] In some embodiments, disclosed herein is a small molecule ligand which binds to the CAPN1 protein, wherein the small molecule ligand binds to one or more of the following residues: LVFVHSAEGNEFWSALLEK of the CAPN1 protein having the UniProtKB accession number P07384. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CAPN1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LVFVHSAEGNEFWSALLEK of the CAPN1 protein having the UniProtKB accession number P07384. In some instances, the small molecule ligand is probe 14.

    [0087] In some embodiments, disclosed herein is a small molecule ligand which binds to the CKB protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: FPAEDEFPDLSAHNNHMAK, LAVEALSSLDGDLAGR, TFLVWVNEEDHLR, FCTGLTQIETLFK, LGFSEVELVQMVVDGVK and LEQGQAIDDLMPAQK of the CKB protein having the UniProtKB accession number P12277. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CKB protein, wherein the small molecule ligand binds a ligand binding site defined by: FPAEDEFPDLSAHNNHMAK, LAVEALSSLDGDLAGR, TFLVWVNEEDHLR, FCTGLTQIETLFK, LGFSEVELVQMVVDGVK or LEQGQAIDDLMPAQK of the CKB protein having the UniProtKB accession number P12277. In some instances, the small molecule ligand is probe 3 or 13.

    [0088] In some embodiments, disclosed herein is a small molecule ligand which binds to the CKMT1B protein, wherein the small molecule ligand binds to one or more of the following residues: SFLIWVNEEDHTR of the CKMT1B protein having the UniProtKB accession number P12532. In some embodiments, disclosed herein is a small molecule ligand which binds to the CKMT1B protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: SFLIWVNEEDHTR of the CKMT1B protein having the UniProtKB accession number P12532. In some instances, the small molecule ligand is probe 3.

    [0089] In some embodiments, disclosed herein is a small molecule ligand which binds to the CLPP protein, wherein the small molecule ligand binds to one or more of the following residues: QSLQVIESAMER of the CLPP protein having the UniProtKB accession number Q16740. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CLPP protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: QSLQVIESAMER of the CLPP protein having the UniProtKB accession number Q16740. In some instances, the small molecule ligand is probe 6.

    [0090] In some embodiments, disclosed herein is a small molecule ligand which binds to the CSNK1A1 protein, wherein the small molecule ligand binds to one or more of the following residues: DYNVLVMDLLGPSLEDLFNFCSR of the CSNK1A1 protein having the UniProtKB accession number P48729. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CSNK1A1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: DYNVLVMDLLGPSLEDLFNFCSR of the CSNK1A1 protein having the UniProtKB accession number P48729. In some instances, the small molecule ligand is probe 14.

    [0091] In some embodiments, disclosed herein is a small molecule ligand which binds to the CSNK2B protein, wherein the small molecule ligand binds to one or more of the following residues: VYCENQPMLPIGLSDIPGEAMVK of the CSNK2B protein having the UniProtKB accession number P67870. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CSNK2B protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: VYCENQPMLPIGLSDIPGEAMVK of the CSNK2B protein having the UniProtKB accession number P67870. In some instances, the small molecule ligand is probe 14.

    [0092] In some embodiments, disclosed herein is a small molecule ligand which binds to the CTSB protein, wherein the small molecule ligand binds to one or more of the following residues: GQDHCGIESEVVAGIPR of the CTSB protein having the UniProtKB accession number P07858. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CTSB protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: GQDHCGIESEVVAGIPR of the CTSB protein having the UniProtKB accession number P07858. In some cases, the small molecule ligand is probe 2, 4, 9 or 13.

    [0093] In some embodiments, disclosed herein is a small molecule ligand which binds to the CTSD protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: DPDAQPGGELMLGGTDSK, EGCEAIVDTGTSLMVGPVDEVR and AIGAVPLIQGEYMIPCEK of the CTSD protein having the UniProtKB accession number P07339. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CTSD protein, wherein the small molecule ligand binds a ligand binding site defined by: DPDAQPGGELMLGGTDSK, EGCEAIVDTGTSLMVGPVDEVR or AIGAVPLIQGEYMIPCEK of the CTSD protein having the UniProtKB accession number P07339. In some cases, the small molecule ligand is probe 2, 3, 4, 6, 8, 9, 13, 14 or 15.

    [0094] In some embodiments, disclosed herein is a small molecule ligand which binds to the CYB5R3 protein, wherein the small molecule ligand binds to one or more of the following residues: LWYTLDR of the CYB5R3 protein having the UniProtKB accession number P00387. In some embodiments, also disclosed herein is a small molecule ligand which binds to the CYB5R3 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LWYTLDR of the CYB5R3 protein having the UniProtKB accession number P00387. In some cases, the small molecule ligand is probe 3.

    [0095] In some embodiments, disclosed herein is a small molecule ligand which binds to the DECR1 protein, wherein the small molecule ligand binds to one or more of the following residues: FDGGEEVLISGEFNDLR of the DECR1 protein having the UniProtKB accession number Q16698. In some embodiments, also disclosed herein is a small molecule ligand which binds to the DECR1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: FDGGEEVLISGEFNDLR of the DECR1 protein having the UniProtKB accession number Q16698. In some cases, the small molecule ligand is probe 6.

    [0096] In some embodiments, disclosed herein is a small molecule ligand which binds to the DHX9 protein, wherein the small molecule ligand binds to one or more of the following residues: ISAVSVAER of the DHX9 protein having the UniProtKB accession number Q08211. In some embodiments, also disclosed herein is a small molecule ligand which binds to the DHX9 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: ISAVSVAER of the DHX9 protein having the UniProtKB accession number Q08211. In some cases, the small molecule ligand is probe 3.

    [0097] In some embodiments, disclosed herein is a small molecule ligand which binds to the DLD protein, wherein the small molecule ligand binds to one or more of the following residues: VLGAHILGPGAGEMVNEAALALEYGASCEDIAR of the DLD protein having the UniProtKB accession number P09622. In some embodiments, also disclosed herein is a small molecule ligand which binds to the DLD protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: VLGAHILGPGAGEMVNEAALALEYGASCEDIAR of the DLD protein having the UniProtKB accession number P09622. In some cases, the small molecule ligand is probe 4, 13 or 14.

    [0098] In some embodiments, disclosed herein is a small molecule ligand which binds to the ECH1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: MFTAGIDLMDMASDILQPK, YQETFNVIER and EVDVGLAADVGTLQR of the ECH1 protein having the UniProtKB accession number Q13011. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ECH1 protein, wherein the small molecule ligand binds a ligand binding site defined by: MFTAGIDLMDMASDILQPK, YQETFNVIER or EVDVGLAADVGTLQR of the ECH1 protein having the UniProtKB accession number Q13011. In some cases, the small molecule ligand is probe 3, 4, 6, 8, 13, 14 or 15.

    [0099] In some embodiments, disclosed herein is a small molecule ligand which binds to the EIF4A1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: MFVLDEADEMLSR and GYDVIAQAQSGTGK of the EIF4A1 protein having the UniProtKB accession number P60842. In some embodiments, also disclosed herein is a small molecule ligand which binds to the EIF4A1 protein, wherein the small molecule ligand binds a ligand binding site defined by: MFVLDEADEMLSR or GYDVIAQAQSGTGK of the EIF4A1 protein having the UniProtKB accession number P60842. In some cases, the small molecule ligand is probe 9, 13 or 14.

    [0100] In some embodiments, disclosed herein is a small molecule ligand which binds to the EIF4A2 protein, wherein the small molecule ligand binds to one or more of the following residues: GYDVIAQAQSGTGK of the EIF4A2 protein having the UniProtKB accession number Q14240. In some embodiments, also disclosed herein is a small molecule ligand which binds to the EIF4A2 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: GYDVIAQAQSGTGK of the EIF4A2 protein having the UniProtKB accession number Q14240. In some instances, the small molecule ligand is probe 13.

    [0101] In some embodiments, disclosed herein is a small molecule ligand which binds to the ETFB protein, wherein the small molecule ligand binds to one or more of the following residues: HSMNPFCEIAVEEAVR of the ETFB protein having the UniProtKB accession number P38117. In some embodiments, also disclosed herein is a small molecule ligand which binds to the ETFB protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: HSMNPFCEIAVEEAVR of the ETFB protein having the UniProtKB accession number P38117. In some cases, the small molecule ligand is probe 3.

    [0102] In some embodiments, disclosed herein is a small molecule ligand which binds to the FECH protein, wherein the small molecule ligand binds to one or more of the following residues: SEVVILFSAHSLPMSVVNR of the FECH protein having the UniProtKB accession number P22830. In some embodiments, also disclosed herein is a small molecule ligand which binds to the FECH protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: SEVVILFSAHSLPMSVVNR of the FECH protein having the UniProtKB accession number P22830. In some cases, the small molecule ligand is probe 4.

    [0103] In some embodiments, disclosed herein is a small molecule ligand which binds to the GLA protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: SILDWTSFNQER, FMCNLDCQEEPDSCISEK and LFMEMAELMVSEGWK of the GLA protein having the UniProtKB accession number P06280. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GLA protein, wherein the small molecule ligand binds a ligand binding site defined by: SILDWTSFNQER, FMCNLDCQEEPDSCISEK or LFMEMAELMVSEGWK of the GLA protein having the UniProtKB accession number P06280. In some cases, the small molecule ligand is probe 4 or 9.

    [0104] In some embodiments, disclosed herein is a small molecule ligand which binds to the GLB1 protein, wherein the small molecule ligand binds to one or more of the following residues: TEAVASSLYDILAR of the GLB1 protein having the UniProtKB accession number P16278. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GLB1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TEAVASSLYDILAR of the GLB1 protein having the UniProtKB accession number P16278. In some instances, the small molecule ligand is probe 9.

    [0105] In some embodiments, disclosed herein is a small molecule ligand which binds to the GLO1 protein, wherein the small molecule ligand binds to one or more of the following residues: GLAFIQDPDGYWIEILNPNK of the GLO1 protein having the UniProtKB accession number Q04760. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GLO1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: GLAFIQDPDGYWIEILNPNK of the GLO1 protein having the UniProtKB accession number Q04760. In some instances, the small molecule ligand is probe 3 or 14.

    [0106] In some embodiments, disclosed herein is a small molecule ligand which binds to the GLUD1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: YSTDVSVDEVK and HGGTIPIVPTAEFQDR of the GLUD1 protein having the UniProtKB accession number P00367. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GLUD1 protein, wherein the small molecule ligand binds a ligand binding site defined by: YSTDVSVDEVK or HGGTIPIVPTAEFQDR of the GLUD1 protein having the UniProtKB accession number P00367. In some instances, the small molecule ligand is probe 6.

    [0107] In some embodiments, disclosed herein is a small molecule ligand which binds to the GOLPH3 protein, wherein the small molecule ligand binds to one or more of the following residues: EGYTSFWNDCISSGLR of the GOLPH3 protein having the UniProtKB accession number Q9H4A6. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GOLPH3 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: EGYTSFWNDCISSGLR of the GOLPH3 protein having the UniProtKB accession number Q9H4A6. In some instances, the small molecule ligand is probe 14.

    [0108] In some embodiments, disclosed herein is a small molecule ligand which binds to the GSTP1 protein, wherein the small molecule ligand binds to one or more of the following residues: FQDGDLTLYQSNTILR of the GSTP1 protein having the UniProtKB accession number P09211. In some embodiments, also disclosed herein is a small molecule ligand which binds to the GSTP1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: FQDGDLTLYQSNTILR of the GSTP1 protein having the UniProtKB accession number P09211. In some instances, the small molecule ligand is probe 2.

    [0109] In some embodiments, disclosed herein is a small molecule ligand which binds to the HBA2 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: VGAHAGEYGAEALER and VDPVNFK of the HBA2 protein having the UniProtKB accession number P69905. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HBA2 protein, wherein the small molecule ligand binds a ligand binding site defined by: VGAHAGEYGAEALER or VDPVNFK of the HBA2 protein having the UniProtKB accession number P69905. In some instances, the small molecule ligand is probe 4.

    [0110] In some embodiments, disclosed herein is a small molecule ligand which binds to the HEXA protein, wherein the small molecule ligand binds to one or more of the following residues: LTSDLTFAYER of the HEXA protein having the UniProtKB accession number P06865. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HEXA protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LTSDLTFAYER of the HEXA protein having the UniProtKB accession number P06865. In some instances, the small molecule ligand is probe 9.

    [0111] In some embodiments, disclosed herein is a small molecule ligand which binds to the HMOX2 protein, wherein the small molecule ligand binds to one or more of the following residues: AENTQFVK and LATTALYFTYSALEEEMER of the HMOX2 protein having the UniProtKB accession number P30519. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HMOX2 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: AENTQFVK or LATTALYFTYSALEEEMER of the HMOX2 protein having the UniProtKB accession number P30519. In some instances, the small molecule ligand is probe 2, 3, 4, 6, 8, 14 or 15.

    [0112] In some embodiments, disclosed herein is a small molecule ligand which binds to the HSD17B4 protein, wherein the small molecule ligand binds to one or more of the following residues: LGLLGLANSLAIEGR of the HSD17B4 protein having the UniProtKB accession number P51659. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HSD17B4 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LGLLGLANSLAIEGR of the HSD17B4 protein having the UniProtKB accession number P51659. In some instances, the small molecule ligand is probe 3.

    [0113] In some embodiments, disclosed herein is a small molecule ligand which binds to the HSP90AB1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: VFIMDSCDELIPEYLNFIR and GFEVVYMTEPIDEYCVQQLK of the HSP90AB1 protein having the UniProtKB accession number P08238. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HSP90AB1 protein, wherein the small molecule ligand binds a ligand binding site defined by: VFIMDSCDELIPEYLNFIR or GFEVVYMTEPIDEYCVQQLK of the HSP90AB1 protein having the UniProtKB accession number P08238. In some instances, the small molecule ligand is probe 13 or 14.

    [0114] In some embodiments, disclosed herein is a small molecule ligand which binds to the HSP90B1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: LISLTDENALSGNEELTVK and YSQFINFPIYVWSSK of the HSP90B1 protein having the UniProtKB accession number P14625. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HSP90B1 protein, wherein the small molecule ligand binds a ligand binding site defined by: LISLTDENALSGNEELTVK or YSQFINFPIYVWSSK of the HSP90B1 protein having the UniProtKB accession number P14625. In some instances, the small molecule ligand is probe 6 or 9.

    [0115] In some embodiments, disclosed herein is a small molecule ligand which binds to the HSPA8 protein, wherein the small molecule ligand binds to one or more of the following residues: SFYPEEVSSMVLTK of the HSPA8 protein having the UniProtKB accession number P11142. In some embodiments, also disclosed herein is a small molecule ligand which binds to the HSPA8 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: SFYPEEVSSMVLTK of the HSPA8 protein having the UniProtKB accession number P11142. In some instances, the small molecule ligand is probe 13 or 14.

    [0116] In some embodiments, disclosed herein is a small molecule ligand which binds to the IMPDH2 protein, wherein the small molecule ligand binds to one or more of the following residues: YEQGFITDPVVLSPK of the IMPDH2 protein having the UniProtKB accession number P12268. In some embodiments, also disclosed herein is a small molecule ligand which binds to the IMPDH2 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: YEQGFITDPVVLSPK of the IMPDH2 protein having the UniProtKB accession number P12268. In some instances, the small molecule ligand is probe 13.

    [0117] In some embodiments, disclosed herein is a small molecule ligand which binds to the LDHA protein, wherein the small molecule ligand binds to one or more of the following residues: DLADELALVDVIEDK of the LDHA protein having the UniProtKB accession number P00338. In some embodiments, also disclosed herein is a small molecule ligand which binds to the LDHA protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: DLADELALVDVIEDK of the LDHA protein having the UniProtKB accession number P00338. In some instances, the small molecule ligand is probe 9.

    [0118] In some embodiments, disclosed herein is a small molecule ligand which binds to the LDHB protein, wherein the small molecule ligand binds to one or more of the following residues: MVVESAYEVIK of the LDHB protein having the UniProtKB accession number P07195. In some embodiments, also disclosed herein is a small molecule ligand which binds to the LDHB protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: MVVESAYEVIK of the LDHB protein having the UniProtKB accession number P07195. In some instances, the small molecule ligand is probe 4.

    [0119] In some embodiments, disclosed herein is a small molecule ligand which binds to the LGMN protein, wherein the small molecule ligand binds to one or more of the following residues: DYTGEDVTPQNFLAVLR of the LGMN protein having the UniProtKB accession number Q99538. In some embodiments, also disclosed herein is a small molecule ligand which binds to the LGMN protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: DYTGEDVTPQNFLAVLR of the LGMN protein having the UniProtKB accession number Q99538. In some instances, the small molecule ligand is probe 9.

    [0120] In some embodiments, disclosed herein is a small molecule ligand which binds to the LTA4H protein, wherein the small molecule ligand binds to one or more of the following residues: LVVDLTDIDPDVAYSSVPYEK of the LTA4H protein having the UniProtKB accession number P09960. In some embodiments, also disclosed herein is a small molecule ligand which binds to the LTA4H protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LVVDLTDIDPDVAYSSVPYEK of the LTA4H protein having the UniProtKB accession number P09960. In some cases, the small molecule ligand is probe 4, 8 or 13.

    [0121] In some embodiments, disclosed herein is a small molecule ligand which binds to the NAMPT protein, wherein the small molecule ligand binds to one or more of the following residues: YLLETSGNLDGLEYK of the NAMPT protein having the UniProtKB accession number P43490. In some embodiments, also disclosed herein is a small molecule ligand which binds to the NAMPT protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: YLLETSGNLDGLEYK of the NAMPT protein having the UniProtKB accession number P43490. In some cases, the small molecule ligand is probe 3, 6, 8, 13, 14 or 15.

    [0122] In some embodiments, disclosed herein is a small molecule ligand which binds to the NPM1 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: DELHIVEAEAMNYEGSPIK and MSVQPTVSLGGFEITPPVVLR of the NPM1 protein having the UniProtKB accession number P06748. In some embodiments, also disclosed herein is a small molecule ligand which binds to the NPM1 protein, wherein the small molecule ligand binds a ligand binding site defined by: DELHIVEAEAMNYEGSPIK or MSVQPTVSLGGFEITPPVVLR of the NPM1 protein having the UniProtKB accession number P06748. In some cases, the small molecule ligand is probe 13.

    [0123] In some embodiments, disclosed herein is a small molecule ligand which binds to the PCMT1 protein, wherein the small molecule ligand binds to one or more of the following residues: LILPVGPAGGNQMLEQYDK of the PCMT1 protein having the UniProtKB accession number P22061. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PCMT1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: LILPVGPAGGNQMLEQYDK of the PCMT1 protein having the UniProtKB accession number P22061. In some instances, the small molecule ligand is probe 2, 3 or 14.

    [0124] In some embodiments, disclosed herein is a small molecule ligand which binds to the PDHB protein, wherein the small molecule ligand binds to one or more of the following residues: VFLLGEEVAQYDGAYK of the PDHB protein having the UniProtKB accession number P11177. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PDHB protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: VFLLGEEVAQYDGAYK of the PDHB protein having the UniProtKB accession number P11177. In some instances, the small molecule ligand is probe 2, 3, 13 or 14.

    [0125] In some embodiments, disclosed herein is a small molecule ligand which binds to the PGK1 protein, wherein the small molecule ligand binds to one or more of the following residues: QIVWNGPVGVFEWEAFAR of the PGK1 protein having the UniProtKB accession number P00558. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PGK1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: QIVWNGPVGVFEWEAFAR of the PGK1 protein having the UniProtKB accession number P00558. In some instances, the small molecule ligand is probe 3.

    [0126] In some embodiments, disclosed herein is a small molecule ligand which binds to the PKM protein, wherein the small molecule ligand binds to one or more of the following residues: IYVDDGLISLQVK and LAPITSDPTEATAVGAVEASFK of the PKM protein having the UniProtKB accession number P14618. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PKM protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: IYVDDGLISLQVK or LAPITSDPTEATAVGAVEASFK of the PKM protein having the UniProtKB accession number P14618. In some instances, the small molecule ligand is probe 2 or 9.

    [0127] In some embodiments, disclosed herein is a small molecule ligand which binds to the POR protein, wherein the small molecule ligand binds to one or more of the following residues: TALTYYLDITNPPR of the POR protein having the UniProtKB accession number P16435. In some embodiments, also disclosed herein is a small molecule ligand which binds to the POR protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TALTYYLDITNPPR of the POR protein having the UniProtKB accession number P16435. In some instances, the small molecule ligand is probe 13 or 14.

    [0128] In some embodiments, disclosed herein is a small molecule ligand which binds to a protein selected from PPP and PPP1CC, wherein the small molecule ligand binds to one or more of the following residues: IYGFYDECK, which corresponds to IYGFYDECK of the PPP1CC protein having the UniProtKB accession number P36873. In some embodiments, also disclosed herein is a small molecule ligand which binds to a protein selected from PPP1CA and PPP1CC, wherein the small molecule ligand binds a ligand binding site defined by the following residues: IYGFYDECK, which corresponds to IYGFYDECK of the PPP1CC protein having the UniProtKB accession number P36873. In some instances, the small molecule ligand is probe 2.

    [0129] In some embodiments, disclosed herein is a small molecule ligand which binds to the PPP1CC protein, wherein the small molecule ligand binds to one or more of the following residues: EIFLSQPILLELEAPLK of the PPP1CC protein having the UniProtKB accession number P36873. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PPP1CC protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: EIFLSQPILLELEAPLK of the PPP1CC protein having the UniProtKB accession number P36873. In some instances, the small molecule ligand is probe 14.

    [0130] In some embodiments, disclosed herein is a small molecule ligand which binds to the PPT1 protein, wherein the small molecule ligand binds to one or more of the following residues: TLMEDVENSFFLNVNSQVTTVCQALAK of the PPT1 protein having the UniProtKB accession number P50897. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PPT1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TLMEDVENSFFLNVNSQVTTVCQALAK of the PPT1 protein having the UniProtKB accession number P50897. In some cases, the small molecule ligand is probe 2, 4, 8, 9, 13, 14 or 15.

    [0131] In some embodiments, disclosed herein is a small molecule ligand which binds to the PRDX2 protein, wherein the small molecule ligand binds to one or more of the following residues: TDEGIAYR of the PRDX2 protein having the UniProtKB accession number P32119. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PRDX2 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TDEGIAYR of the PRDX2 protein having the UniProtKB accession number P32119. In some cases, the small molecule ligand is probe 13.

    [0132] In some embodiments, disclosed herein is a small molecule ligand which binds to the PSMB4 protein, wherein the small molecule ligand binds to one or more of the following residues: FEGGVVIAADMLGSYGSLAR of the PSMB4 protein having the UniProtKB accession number P28070. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PSMB4 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: FEGGVVIAADMLGSYGSLAR of the PSMB4 protein having the UniProtKB accession number P28070. In some cases, the small molecule ligand is probe 6.

    [0133] In some embodiments, disclosed herein is a small molecule ligand which binds to the PSMB5 protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: LLANMVYQYK and DAYSGGAVNLYHVR of the PSMB5 protein having the UniProtKB accession number P28074. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PSMB5 protein, wherein the small molecule ligand binds a ligand binding site defined by: LLANMVYQYK or DAYSGGAVNLYHVR of the PSMB5 protein having the UniProtKB accession number P28074. In some instances, the small molecule ligand is probe 3, 4 or 6.

    [0134] In some embodiments, disclosed herein is a small molecule ligand which binds to the PSMB6 protein, wherein the small molecule ligand binds to one or more of the following residues: SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK of the PSMB6 protein having the UniProtKB accession number P28072. In some embodiments, also disclosed herein is a small molecule ligand which binds to the PSMB6 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK of the PSMB6 protein having the UniProtKB accession number P28072. In some instances, the small molecule ligand is probe 3, 6 or 14.

    [0135] In some embodiments, disclosed herein is a small molecule ligand which binds to the RAB7A protein, wherein the small molecule ligand binds to one or more of the following residues: DEFLIQASPR of the RAB7A protein having the UniProtKB accession number P51149. In some embodiments, also disclosed herein is a small molecule ligand which binds to the RAB7A protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: DEFLIQASPR of the RAB7A protein having the UniProtKB accession number P51149. In some instances, the small molecule ligand is probe 14.

    [0136] In some embodiments, disclosed herein is a small molecule ligand which binds to the RUVBL2 protein, wherein the small molecule ligand binds to one or more of the following residues: ALESDMAPVLIMATNR of the RUVBL2 protein having the UniProtKB accession number Q9Y230. In some embodiments, also disclosed herein is a small molecule ligand which binds to the RUVBL2 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: ALESDMAPVLIMATNR of the RUVBL2 protein having the UniProtKB accession number Q9Y230. In some instances, the small molecule ligand is probe 14.

    [0137] In some embodiments, disclosed herein is a small molecule ligand which binds to the SMYD3 protein, wherein the small molecule ligand binds to one or more of the following residues: DQYCFECDCFR of the SMYD3 protein having the UniProtKB accession number Q9H7B4. In some embodiments, also disclosed herein is a small molecule ligand which binds to the SMYD3 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: DQYCFECDCFR of the SMYD3 protein having the UniProtKB accession number Q9H7B4. In some cases, the small molecule ligand is probe 9.

    [0138] In some embodiments, disclosed herein is a small molecule ligand which binds to the TPP1 protein, wherein the small molecule ligand binds to one or more of the following residues: GCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLK of the TPP1 protein having the UniProtKB accession number 014773. In some embodiments, also disclosed herein is a small molecule ligand which binds to the TPP1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: GCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLK of the TPP1 protein having the UniProtKB accession number 014773. In some instances, the small molecule ligand is probe 4, 9, 13, 14 or 15.

    [0139] In some embodiments, disclosed herein is a small molecule ligand which binds to the TXNDC17 protein, wherein the small molecule ligand binds to one or more of the following residues: YEEVSVSGFEEFHR of the TXNDC17 protein having the UniProtKB accession number Q9BRA2. In some embodiments, also disclosed herein is a small molecule ligand which binds to the TXNDC17 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: YEEVSVSGFEEFHR of the TXNDC17 protein having the UniProtKB accession number Q9BRA2. In some instances, the small molecule ligand is probe 14.

    [0140] In some embodiments, disclosed herein is a small molecule ligand which binds to the YWHAE protein, wherein the small molecule ligand binds to one or more residues of a ligand binding site selected from: EAAENSLVAYK and AAFDDAIAELDTLSEESYK of the YWHAE protein having the UniProtKB accession number P62258. In some embodiments, also disclosed herein is a small molecule ligand which binds to the YWHAE protein, wherein the small molecule ligand binds a ligand binding site defined by: EAAENSLVAYK or AAFDDAIAELDTLSEESYK of the YWHAE protein having the UniProtKB accession number P62258. In some cases, the small molecule ligand is probe 13.

    [0141] In some embodiments, disclosed herein is a small molecule ligand which binds to the YWHAQ protein, wherein the small molecule ligand binds to one or more of the following residues: TAFDEAIAELDTLNEDSYK of the YWHAQ protein having the UniProtKB accession number P27348. In some embodiments, also disclosed herein is a small molecule ligand which binds to the YWHAQ protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TAFDEAIAELDTLNEDSYK of the YWHAQ protein having the UniProtKB accession number P27348. In some cases, the small molecule ligand is probe 14.

    [0142] In some embodiments, disclosed herein is a small molecule ligand which binds to the YWHAZ protein, wherein the small molecule ligand binds to one or more of the following residues: TAFDEAIAELDTLSEESYK of the YWHAZ protein having the UniProtKB accession number P63104. In some embodiments, also disclosed herein is a small molecule ligand which binds to the YWHAZ protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: TAFDEAIAELDTLSEESYK of the YWHAZ protein having the UniProtKB accession number P63104. In some instances, the small molecule ligand is probe 13 or 14.

    [0143] In some embodiments, disclosed herein is a small molecule ligand which binds to the EXO1 protein, wherein the small molecule ligand binds to one or more of the following residues: SQGVDCLVAPYEADAQLAYLNK of the EXO1 protein having the UniProtKB accession number Q9UQ84. In some embodiments, also disclosed herein is a small molecule ligand which binds to the EXO1 protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: SQGVDCLVAPYEADAQLAYLNK of the EXO1 protein having the UniProtKB accession number Q9UQ84. In some instances, the small molecule ligand is probe 2, 6, 8, 9 or 13.

    [0144] In some embodiments, disclosed herein is a small molecule ligand which binds to the LMNA protein, wherein the small molecule ligand binds to one or more of the following residues: MQQQLDEYQELLDIK of the LMNA protein having the UniProtKB accession number P02545. In some embodiments, also disclosed herein is a small molecule ligand which binds to the LMNA protein, wherein the small molecule ligand binds a ligand binding site defined by the following residues: MQQQLDEYQELLDIK of the LMNA protein having the UniProtKB accession number P02545. In some instances, the small molecule ligand is probe 6 or 13.

    [0145] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (Ia):

    ##STR00025##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring;
    and R.sup.3 is an optionally substituted C2-C6 alkyl.

    [0146] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (IIa):

    ##STR00026##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring;
    and R.sup.3 is an optionally substituted C2-C6 alkyl.

    [0147] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (IIIa):

    ##STR00027##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring;
    and R.sup.3 is an optionally substituted C2-C6 alkyl.

    [0148] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (IVa):

    ##STR00028##

    wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring;
    and R.sup.3 is an optionally substituted C2-C6 alkyl.

    [0149] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (Va):

    ##STR00029##

    wherein R.sup.1 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl;
    and R.sup.2 is an optionally substituted C2-C6 alkyl.

    [0150] In some cases, the small molecule ligand which binds to a protein has a structure represented by Formula (VIa):

    ##STR00030##

    [0151] wherein R.sup.1 is hydrogen and R.sup.2 is selected from substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted cycloalkyl, optionally substituted heterocyclyl, optionally substituted heteroaryl, optionally substituted aralkyl, optionally substituted heteroarylalkyl, or optionally substituted heterocyclylalkyl; or R.sup.1 and R.sup.2 together with the nitrogen to which they are attached form an optionally substituted heterocyclyl ring;

    and R.sup.3 is an optionally substituted C2-C6 alkyl.

    [0152] Cells, Analytical Techniques, and Instrumentation

    [0153] In certain embodiments, one or more of the methods disclosed herein comprise a cell sample. In some embodiments, the cell sample for use with the methods described herein is obtained from cells of an animal. In some instances, the animal cell includes a cell from a marine invertebrate, fish, insects, amphibian, reptile, or mammal. In some instances, the mammalian cell is a primate, ape, equine, bovine, porcine, canine, feline, or rodent. In some instances, the mammal is a primate, ape, dog, cat, rabbit, ferret, or the like. In some cases, the rodent is a mouse, rat, hamster, gerbil, hamster, chinchilla, or guinea pig. In some embodiments, the bird cell is from a canary, parakeet or parrots. In some embodiments, the reptile cell is from a turtles, lizard or snake. In some cases, the fish cell is from a tropical fish. In some cases, the fish cell is from a zebrafish (e.g. Danino rerio). In some cases, the worm cell is from a nematode (e.g. C. elegans). In some cases, the amphibian cell is from a frog. In some embodiments, the arthropod cell is from a tarantula or hermit crab.

    [0154] In some embodiments, the cell sample for use with the methods described herein is obtained from a mammalian cell. In some instances, the mammalian cell is an epithelial cell, connective tissue cell, hormone secreting cell, a nerve cell, a skeletal muscle cell, a blood cell, or an immune system cell.

    [0155] Exemplary mammalian cells include, but are not limited to, 293A cell line, 293FT cell line, 293F cells, 293 H cells, HEK 293 cells, CHO DG44 cells, CHO-S cells, CHO-K1 cells, Expi293F cells, Flp-In T-REx 293 cell line, Flp-In-293 cell line, Flp-In-3T3 cell line, Flp-In-BHK cell line, Flp-In-CHO cell line, Flp-In-CV-1 cell line, Flp-In-Jurkat cell line, FreeStyle 293-F cells, FreeStyle CHO-S cells, GripTite 293 MSR cell line, GS-CHO cell line, HepaRG cells, T-REx Jurkat cell line, Per.C6 cells, T-REx-293 cell line, T-REx-CHO cell line, T-REx-HeLa cell line, NC-HIMT cell line, and PC12 cell line.

    [0156] In some instances, the cell sample for use with the methods described herein is obtained from cells of a tumor cell line. In some instances, the sample is obtained from cells of a solid tumor cell line. In some instances, the solid tumor cell line is a sarcoma cell line. In some instances, the solid tumor cell line is a carcinoma cell line. In some embodiments, the sarcoma cell line is obtained from a cell line of alveolar rhabdomyosarcoma, alveolar soft part sarcoma, ameloblastoma, angiosarcoma, chondrosarcoma, chordoma, clear cell sarcoma of soft tissue, dedifferentiated liposarcoma, desmoid, desmoplastic small round cell tumor, embryonal rhabdomyosarcoma, epithelioid fibrosarcoma, epithelioid hemangioendothelioma, epithelioid sarcoma, esthesioneuroblastoma, Ewing sarcoma, extrarenal rhabdoid tumor, extraskeletal myxoid chondrosarcoma, extraskeletal osteosarcoma, fibrosarcoma, giant cell tumor, hemangiopericytoma, infantile fibrosarcoma, inflammatory myofibroblastic tumor, Kaposi sarcoma, leiomyosarcoma of bone, liposarcoma, liposarcoma of bone, malignant fibrous histiocytoma (MFH), malignant fibrous histiocytoma (MFH) of bone, malignant mesenchymoma, malignant peripheral nerve sheath tumor, mesenchymal chondrosarcoma, myxofibrosarcoma, myxoid liposarcoma, myxoinflammatory fibroblastic sarcoma, neoplasms with perivascular epitheioid cell differentiation, osteosarcoma, parosteal osteosarcoma, neoplasm with perivascular epitheioid cell differentiation, periosteal osteosarcoma, pleomorphic liposarcoma, pleomorphic rhabdomyosarcoma, PNET/extraskeletal Ewing tumor, rhabdomyosarcoma, round cell liposarcoma, small cell osteosarcoma, solitary fibrous tumor, synovial sarcoma, telangiectatic osteosarcoma.

    [0157] In some embodiments, the carcinoma cell line is obtained from a cell line of adenocarcinoma, squamous cell carcinoma, adenosquamous carcinoma, anaplastic carcinoma, large cell carcinoma, small cell carcinoma, anal cancer, appendix cancer, bile duct cancer (i.e., cholangiocarcinoma), bladder cancer, brain tumor, breast cancer, cervical cancer, colon cancer, cancer of Unknown Primary (CUP), esophageal cancer, eye cancer, fallopian tube cancer, gastroenterological cancer, kidney cancer, liver cancer, lung cancer, medulloblastoma, melanoma, oral cancer, ovarian cancer, pancreatic cancer, parathyroid disease, penile cancer, pituitary tumor, prostate cancer, rectal cancer, skin cancer, stomach cancer, testicular cancer, throat cancer, thyroid cancer, uterine cancer, vaginal cancer, or vulvar cancer.

    [0158] In some instances, the cell sample is obtained from cells of a hematologic malignant cell line. In some instances, the hematologic malignant cell line is a T-cell cell line. In some instances, B-cell cell line. In some instances, the hematologic malignant cell line is obtained from a T-cell cell line of: peripheral T-cell lymphoma not otherwise specified (PTCL-NOS), anaplastic large cell lymphoma, angioimmunoblastic lymphoma, cutaneous T-cell lymphoma, adult T-cell leukemia/lymphoma (ATLL), blastic NK-cell lymphoma, enteropathy-type T-cell lymphoma, hematosplenic gamma-delta T-cell lymphoma, lymphoblastic lymphoma, nasal NK/T-cell lymphomas, or treatment-related T-cell lymphomas.

    [0159] In some instances, the hematologic malignant cell line is obtained from a B-cell cell line of: acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), acute monocytic leukemia (AMoL), chronic lymphocytic leukemia (CLL), high-risk chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), high-risk small lymphocytic lymphoma (SLL), follicular lymphoma (FL), mantle cell lymphoma (MCL), Waldenstrom's macroglobulinemia, multiple myeloma, extranodal marginal zone B cell lymphoma, nodal marginal zone B cell lymphoma, Burkitt's lymphoma, non-Burkitt high grade B cell lymphoma, primary mediastinal B-cell lymphoma (PMBL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, B cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, splenic marginal zone lymphoma, plasma cell myeloma, plasmacytoma, mediastinal (thymic) large B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma, or lymphomatoid granulomatosis.

    [0160] In some embodiments, the cell sample for use with the methods described herein is obtained from a tumor cell line. Exemplary tumor cell line includes, but is not limited to, 600MPE, AU565, BT-20, BT-474, BT-483, BT-549, Evsa-T, Hs578T, MCF-7, MDA-MB-231, SkBr3, T-47D, HeLa, DU145, PC3, LNCaP, A549, H1299, NCI-H460, A2780, SKOV-3/Luc, Neuro2a, RKO, RKO-AS45-1, HT-29, SW1417, SW948, DLD-1, SW480, Capan-1, MC/9, B72.3, B25.2, B6.2, B38.1, DMS 153, SU.86.86, SNU-182, SNU-423, SNU-449, SNU-475, SNU-387, Hs 817.T, LMH, LMH/2A, SNU-398, PLHC-1, HepG2/SF, OCI-Ly1, OCI-Ly2, OCI-Ly3, OCI-Ly4, OCI-Ly6, OCI-Ly7, OCI-Ly10, OCI-Ly18, OCI-Ly19, U2932, DB, HBL-1, RIVA, SUDHL2, TMD8, MEC1, MEC2, 8E5, CCRF-CEM, MOLT-3, TALL-104, AML-193, THP-1, BDCM, HL-60, Jurkat, RPMI 8226, MOLT-4, RS4, K-562, KASUMI-1, Daudi, GA-10, Raji, JeKo-1, NK-92, and Mino.

    [0161] In some embodiments, the cell sample for use in the methods is from any tissue or fluid from an individual. Samples include, but are not limited to, tissue (e.g. connective tissue, muscle tissue, nervous tissue, or epithelial tissue), whole blood, dissociated bone marrow, bone marrow aspirate, pleural fluid, peritoneal fluid, central spinal fluid, abdominal fluid, pancreatic fluid, cerebrospinal fluid, brain fluid, ascites, pericardial fluid, urine, saliva, bronchial lavage, sweat, tears, ear flow, sputum, hydrocele fluid, semen, vaginal flow, milk, amniotic fluid, and secretions of respiratory, intestinal or genitourinary tract. In some embodiments, the sample is a tissue sample, such as a sample obtained from a biopsy or a tumor tissue sample. In some embodiments, the sample is a blood serum sample. In some embodiments, the sample is a blood cell sample containing one or more peripheral blood mononuclear cells (PBMCs). In some embodiments, the sample contains one or more circulating tumor cells (CTCs). In some embodiments, the sample contains one or more disseminated tumor cells (DTC, e.g., in a bone marrow aspirate sample).

    [0162] In some embodiments, the cell samples are obtained from the individual by any suitable means of obtaining the sample using well-known and routine clinical methods. Procedures for obtaining tissue samples from an individual are well known. For example, procedures for drawing and processing tissue sample such as from a needle aspiration biopsy is well-known and is employed to obtain a sample for use in the methods provided. Typically, for collection of such a tissue sample, a thin hollow needle is inserted into a mass such as a tumor mass for sampling of cells that, after being stained, will be examined under a microscope.

    [0163] Sample Preparation and Analysis

    [0164] In some embodiments, the sample is a sample solution. In some instances, the sample solution comprises a solution such as a buffer (e.g. phosphate buffered saline) or a media. In some embodiments, the media is an isotopically labeled media. In some instances, the sample solution is a cell solution.

    [0165] In some embodiments, the sample (e.g., cells or a cell solution) is incubated with one or more probes for analysis of protein-probe interactions. In some instances, the sample (e.g., cells or a cell solution) is further incubated in the presence of an additional probe prior to addition of the one or more probes. In other instances, the sample (e.g., cells or a cell solution) is further incubated with a non-probe small molecule ligand, in which the non-probe small molecule ligand does not contain a photoreactive moiety and/or an alkyne group. In such instances, the sample is incubated with a probe and non-probe small molecule ligand for competitive protein profiling analysis.

    [0166] In some cases, the sample is compared with a control. In some cases, a difference is observed between a set of probe protein interactions between the sample and the control. In some instances, the difference correlates to the interaction between the small molecule fragment and the proteins.

    [0167] In some embodiments, one or more methods are utilized for labeling a sample (e.g. cells or a cell solution) for analysis of probe protein interactions. In some instances, a method comprises labeling the sample (e.g. cells or a cell solution) with an enriched media. In some cases, the sample (e.g. cells or a cell solution) is labeled with isotope-labeled amino acids, such as .sup.13C or .sup.15N-labeled amino acids. In some cases, the labeled sample is further compared with a non-labeled sample to detect differences in probe protein interactions between the two samples. In some instances, this difference is a difference of a target protein and its interaction with a small molecule ligand in the labeled sample versus the non-labeled sample. In some instances, the difference is an increase, decrease or a lack of protein-probe interaction in the two samples. In some instances, the isotope-labeled method is termed SILAC, stable isotope labeling using amino acids in cell culture.

    [0168] In some instances, the sample is divided into a first cell solution and a second cell solution. In some cases, the first cell solution is incubated with a first probe for an extended period of time to generate a first group of probe-protein complexes. In some instances, the extended period of time is about 5, 10, 15, 20, 30, 60, 90, 120 minutes or longer. In some instances, the second cell solution comprises a second probe to generate a second group of probe-protein complexes. In some instances, the first probe and the second probe are different. In some embodiments, cells from the second cell solution are treated with a buffer, such as a control buffer, in which the buffer does not contain a small molecule fragment probe. In some embodiments, the control buffer comprises dimethyl sulfoxide (DMSO).

    [0169] In some embodiments, a method comprises incubating a sample (e.g. cells or a cell solution) or a processed sample (e.g., a cell lysate) with a labeling group (e.g., an isotopically labeled labeling group) to tag one or more proteins of interest for further analysis. In such cases, the labeling group comprises a biotin, a streptavidin, bead, resin, a solid support, or a combination thereof, and further comprises a linker that is optionally isotopically labeled. As described above, the linker can be about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more residues in length and can further comprise a cleavage site, such as a protease cleavage site (e.g., TEV cleavage site). In some cases, the labeling group is a biotin-linker moiety, which is optionally isotopically labeled with .sup.13C and .sup.15N atoms at one or more amino acid residue positions within the linker. In some cases, the biotin-linker moiety is a isotopically-labeled TEV-tag as described in Weerapana, et al., Quantitative reactivity profiling predicts functional cysteines in proteomes, Nature 468(7325): 790-795.

    [0170] In some embodiments, an isotopic reductive dimethylation (ReDi) method is utilized for processing a sample. In some cases, the ReDi labeling method involves reacting peptides with formaldehyde to form a Schiff base, which is then reduced by cyanoborohydride. This reaction dimethylates free amino groups on N-termini and lysine side chains and monomethylates N-terminal prolines. In some cases, the ReDi labeling method comprises methylating peptides from a first processed sample with a light label using reagents with hydrogen atoms in their natural isotopic distribution and peptides from a second processed sample with a heavy label using deuterated formaldehyde and cyanoborohydride. Subsequent proteomic analysis (e.g., mass spectrometry analysis) based on a relative peptide abundance between the heavy and light peptide verison can be used for analysis of probe-protein interactions.

    [0171] In some embodiments, isobaric tags for relative and asolute quantitation (iTRAQ) method is utilized for processing a sample. In some cases, the iTRAQ method is based on the covalent labeling of the N-terminus and side chain amines of peptides from a processed sample. In some cases, reagent such as 4-plex or 8-plex is used for labeling the peptides.

    [0172] In some embodiments, the probe-protein complex is further conjugated to a chromophore, such as a fluorophore. In some instances, the probe-protein complex is separated and visualized utilizing an electrophoresis system, such as through a gel electrophoresis, or a capillary electrophoresis. Exemplary gel electrophoresis includes agarose based gels, polyacrylamide based gels, or starch based gels. In some instances, the probe-protein is subjected to a native electrophoresis condition. In some instances, the probe-protein is subjected to a denaturing electrophoresis condition.

    [0173] In some instances, the probe-protein after harvesting is further fragmentized to generate protein fragments. In some instances, fragmentation is generated through mechanical stress, pressure, or chemical means. In some instances, the protein from the probe-protein complexes is fragmented by a chemical means. In some embodiments, the chemical means is a protease. Exemplary proteases include, but are not limited to, serine proteases such as chymotrypsin A, penicillin G acylase precursor, dipeptidase E, DmpA aminopeptidase, subtilisin, prolyl oligopeptidase, D-Ala-D-Ala peptidase C, signal peptidase I, cytomegalovirus assemblin, Lon-A peptidase, peptidase Clp, Escherichia coli phage K1F endosialidase CIMCD self-cleaving protein, nucleoporin 145, lactoferrin, murein tetrapeptidase LD-carboxypeptidase, or rhomboid-1; threonine proteases such as ornithine acetyltransferase; cysteine proteases such as TEV protease, amidophosphoribosyltransferase precursor, gamma-glutamyl hydrolase (Rattus norvegicus), hedgehog protein, DmpA aminopeptidase, papain, bromelain, cathepsin K, calpain, caspase-1, separase, adenain, pyroglutamyl-peptidase I, sortase A, hepatitis C virus peptidase 2, sindbis virus-type nsP2 peptidase, dipeptidyl-peptidase VI, or DeSI-1 peptidase; aspartate proteases such as beta-secretase 1 (BACE1), beta-secretase 2 (BACE2), cathepsin D, cathepsin E, chymosin, napsin-A, nepenthesin, pepsin, plasmepsin, presenilin, or renin; glutamic acid proteases such as AfuGprA; and metalloproteases such as peptidase_M48.

    [0174] In some instances, the fragmentation is a random fragmentation. In some instances, the fragmentation generates specific lengths of protein fragments, or the shearing occurs at particular sequence of amino acid regions.

    [0175] In some instances, the protein fragments are further analyzed by a proteomic method such as by liquid chromatography (LC) (e.g. high performance liquid chromatography), liquid chromatography-mass spectrometry (LC-MS), matrix-assisted laser desorption/ionization (MALDI-TOF), gas chromatography-mass spectrometry (GC-MS), capillary electrophoresis-mass spectrometry (CE-MS), or nuclear magnetic resonance imaging (NMR).

    [0176] In some embodiments, the LC method is any suitable LC methods well known in the art, for separation of a sample into its individual parts. This separation occurs based on the interaction of the sample with the mobile and stationary phases. Since there are many stationary/mobile phase combinations that are employed when separating a mixture, there are several different types of chromatography that are classified based on the physical states of those phases. In some embodiments, the LC is further classified as normal-phase chromatography, reverse-phase chromatography, size-exclusion chromatography, ion-exchange chromatography, affinity chromatography, displacement chromatography, partition chromatography, flash chromatography, chiral chromatography, and aqueous normal-phase chromatography.

    [0177] In some embodiments, the LC method is a high performance liquid chromatography (HPLC) method. In some embodiments, the HPLC method is further categorized as normal-phase chromatography, reverse-phase chromatography, size-exclusion chromatography, ion-exchange chromatography, affinity chromatography, displacement chromatography, partition chromatography, chiral chromatography, and aqueous normal-phase chromatography.

    [0178] In some embodiments, the HPLC method of the present disclosure is performed by any standard techniques well known in the art. Exemplary HPLC methods include hydrophilic interaction liquid chromatography (HILIC), electrostatic repulsion-hydrophilic interaction liquid chromatography (ERLIC) and reverse phase liquid chromatography (RPLC).

    [0179] In some embodiments, the LC is coupled to a mass spectroscopy as a LC-MS method. In some embodiments, the LC-MS method includes ultra-performance liquid chromatography-electrospray ionization quadrupole time-of-flight mass spectrometry (UPLC-ESI-QTOF-MS), ultra-performance liquid chromatography-electrospray ionization tandem mass spectrometry (UPLC-ESI-MS/MS), reverse phase liquid chromatography-mass spectrometry (RPLC-MS), hydrophilic interaction liquid chromatography-mass spectrometry (HILIC-MS), hydrophilic interaction liquid chromatography-triple quadrupole tandem mass spectrometry (HILIC-QQQ), electrostatic repulsion-hydrophilic interaction liquid chromatography-mass spectrometry (ERLIC-MS), liquid chromatography time-of-flight mass spectrometry (LC-QTOF-MS), liquid chromatography-tandem mass spectrometry (LC-MS/MS), multidimensional liquid chromatography coupled with tandem mass spectrometry (LC/LC-MS/MS). In some instances, the LC-MS method is LC/LC-MS/MS. In some embodiments, the LC-MS methods of the present disclosure are performed by standard techniques well known in the art.

    [0180] In some embodiments, the GC is coupled to a mass spectroscopy as a GC-MS method. In some embodiments, the GC-MS method includes two-dimensional gas chromatography time-of-flight mass spectrometry (GC*GC-TOFMS), gas chromatography time-of-flight mass spectrometry (GC-QTOF-MS) and gas chromatography-tandem mass spectrometry (GC-MS/MS).

    [0181] In some embodiments, CE is coupled to a mass spectroscopy as a CE-MS method. In some embodiments, the CE-MS method includes capillary electrophoresis-negative electrospray ionization-mass spectrometry (CE-ESI-MS), capillary electrophoresis-negative electrospray ionization-quadrupole time of flight-mass spectrometry (CE-ESI-QTOF-MS) and capillary electrophoresis-quadrupole time of flight-mass spectrometry (CE-QTOF-MS).

    [0182] In some embodiments, the nuclear magnetic resonance (NMR) method is any suitable method well known in the art for the detection of one or more cysteine binding proteins or protein fragments disclosed herein. In some embodiments, the NMR method includes one dimensional (1D) NMR methods, two dimensional (2D) NMR methods, solid state NMR methods and NMR chromatography. Exemplary 1D NMR methods include .sup.1Hydrogen, .sup.13Carbon, .sup.15Nitrogen, .sup.17Oxygen, .sup.19Fluorine, .sup.31Phosphorus, .sup.39Potassium, .sup.23Sodium, .sup.33Sulfur, .sup.87Strontium, .sup.27Aluminium, .sup.43Calcium, .sup.35Chlorine, .sup.37Chlorine, .sup.63Copiper, .sup.65Copiper, .sup.57Iron, .sup.25Magnesium, .sup.199Mercury or .sup.67Zinc NMR method, distortionless enhancement by polarization transfer (DEPT) method, attached proton test (APT) method and 1D-incredible natural abundance double quantum transition experiment (INADEQUATE) method. Exemplary 2D NMR methods include correlation spectroscopy (COSY), total correlation spectroscopy (TOCSY), 2D-INADEQUATE, 2D-adequate double quantum transfer experiment (ADEQUATE), nuclear overhauser effect spectroscopy (NOSEY), rotating-frame NOE spectroscopy (ROESY), heteronuclear multiple-quantum correlation spectroscopy (HMQC), heteronuclear single quantum coherence spectroscopy (HSQC), short range coupling and long range coupling methods. Exemplary solid state NMR method include solid state .sup.13Carbon NMR, high resolution magic angle spinning (HR-MAS) and cross polarization magic angle spinning (CP-MAS) NMR methods. Exemplary NMR techniques include diffusion ordered spectroscopy (DOSY), DOSY-TOCSY and DOSY-HSQC.

    [0183] In some embodiments, the protein fragments are analyzed by method as described in Weerapana et al., Quantitative reactivity profiling predicts functional cysteines in proteomes, Nature, 468:790-795 (2010).

    [0184] In some embodiments, the results from the mass spectroscopy method are analyzed by an algorithm for protein identification. In some embodiments, the algorithm combines the results from the mass spectroscopy method with a protein sequence database for protein identification. In some embodiments, the algorithm comprises ProLuCID algorithm, Probity, Scaffold, SEQUEST, or Mascot.

    [0185] In some embodiments, a value is assigned to each of the protein from the probe-protein complex. In some embodiments, the value assigned to each of the protein from the probe-protein complex is obtained from the mass spectroscopy analysis. In some instances, the value is the area-under-the curve from a plot of signal intensity as a function of mass-to-charge ratio. In some embodiments, a first value is assigned to the protein obtained from the first cell solution and a second value is assigned to the same protein obtained from the second cell solution. In some instances, a ratio is calculated between the two values. In some instances, a ratio of greater than 2 indicates that the protein is a candidate for interacting with a drug. In some instances, the ratio is greater than 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some cases, the ratio is at most 20.

    [0186] In some instances, the ratio is calculated based on averaged values. In some instances, the averaged value is an average of at least two, three, or four values of the protein from each cell solution, or that the protein is observed at least two, three, or four times in each cell solution and a value is assigned to each observed time. In some instances, the ratio further has a standard deviation of less than 12, 10, or 8.

    [0187] In some instances, a value is not an averaged value. In some instances, the ratio is calculated based on value of a protein observed only once in a cell population. In some instances, the ratio is assigned with a value of 20.

    Kits/Article of Manufacture

    [0188] Disclosed herein, in certain embodiments, are kits and articles of manufacture for use with one or more methods described herein. In some embodiments, described herein is a kit for generating a protein comprising a photoreactive ligand. In some embodiments, such kit includes photoreactive small molecule ligands described herein, small molecule fragments or libraries and/or controls, and reagents suitable for carrying out one or more of the methods described herein. In some instances, the kit further comprises samples, such as a cell sample, and suitable solutions such as buffers or media. In some embodiments, the kit further comprises recombinant proteins for use in one or more of the methods described herein. In some embodiments, additional components of the kit comprises a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in a method described herein. Suitable containers include, for example, bottles, vials, plates, syringes, and test tubes. In one embodiment, the containers are formed from a variety of materials such as glass or plastic.

    [0189] The articles of manufacture provided herein contain packaging materials. Examples of pharmaceutical packaging materials include, but are not limited to, bottles, tubes, bags, containers, and any packaging material suitable for a selected formulation and intended mode of use.

    [0190] For example, the container(s) include probes, test compounds, and one or more reagents for use in a method disclosed herein. Such kits optionally include an identifying description or label or instructions relating to its use in the methods described herein.

    [0191] A kit typically includes labels listing contents and/or instructions for use, and package inserts with instructions for use. A set of instructions will also typically be included.

    [0192] In one embodiment, a label is on or associated with the container. In one embodiment, a label is on a container when letters, numbers or other characters forming the label are attached, molded or etched into the container itself; a label is associated with a container when it is present within a receptacle or carrier that also holds the container, e.g., as a package insert. In one embodiment, a label is used to indicate that the contents are to be used for a specific therapeutic application. The label also indicates directions for use of the contents, such as in the methods described herein.

    Certain Terminology

    [0193] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which the claimed subject matter belongs. It is to be understood that the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of any subject matter claimed. In this application, the use of the singular includes the plural unless specifically stated otherwise. It must be noted that, as used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. In this application, the use of or means and/or unless stated otherwise. Furthermore, use of the term including as well as other forms, such as include, includes, and included, is not limiting.

    [0194] As used herein, ranges and amounts can be expressed as about a particular value or range. About also includes the exact amount. Hence about 5 L means about 5 L and also 5 L. Generally, the term about includes an amount that would be expected to be within experimental error.

    [0195] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

    [0196] The term protein, as used herein, refers to any polymeric chain of amino acids. The term protein encompasses native or modified protein, protein fragments, or polypeptide analogs comprising non-native amino acid residues. In some instances, a protein is monomeric. In other instances, a protein is polymeric. In some instances, a protein described herein is also referred to as an isolated polypeptide, or a polypeptide that by virtue of its origin or source of derivation is not associated with naturally associated components that accompany it in its native state; is substantially free of other proteins from the same species; is expressed by a cell from a different species; or does not occur in nature.

    [0197] In some embodiments, the term bind(s) or binding encompass a covalent interaction between a small molecule ligand and a protein binding site described herein. In other embodiments, the term bind(s) or binding encompass a non-covalent interaction between a small molecule ligand and a protein binding site described herein. In additional embodiments, the term bind(s) or binding encompass an interaction between a small molecule ligand and a region of a protein of interest in which the region on the protein is about 1 , 2 , 3 , 4 , 5 , 6 , 7 , 8 , 9 or 10 away from a binding site on the protein of interest. In some cases, the binding site is a functional or active site on the protein. In some cases, the binding site on the protein is not a functional or active site. In additional cases, the binding site on the protein is distal from a functional or active site. In the context of a competition interaction with two or more different small molecule ligands, the term bind(s) or binding can encompass blocking or displacement of small molecule ligands from interacting with a region or binding site on a protein of interest.

    [0198] As used herein, the term functional site or active site are used interchangeably and refer to a region of a protein that has a specific biological activity. For example, the functional site can be a site that binds a substrate or other binding partner and optionally contributes the amino acid residues that directly participate in the making and breaking of chemical bonds. In some instances, a functional site or active site encompass, e.g., catalytic sites of enzymes, ligand binding domains of receptors, binding domains of regulators, or receptor binding domains of secreted proteins. In some cases, the functional or active site also encompass transactivation, protein-protein interaction, or DNA binding domains of transcription factors and regulators.

    EXAMPLES

    [0199] These examples are provided for illustrative purposes only and not to limit the scope of the claims provided herein.

    Example 1Cell Lines

    [0200] HEK293T cells were maintained in high-glucose DMEM (Gibco) supplemented with 10% (v/v) fetal bovine serum (FBS), penicillin (100 U/mL), streptomycin (100 g/mL) and L-glutamine (2 mM). K562 and HSC-5 cells were maintained in high-glucose IMDM (Gibco) supplemented with 10% (v/v) fetal bovine serum (FBS), penicillin (100 U/mL) and streptomycin (100 g/mL). All cell lines were grown at 37 C. in a humidified 5% CO2 atmosphere. For SILAC experiments, each cell line was passaged at least six times in either SILAC DMEM or SILAC IMDM, (Thermo), which lack L-lysine and L-arginine, and supplemented with 10% (v/v) dialyzed FBS (Gemini), PSQ (as above), and either [.sup.13C.sub.6, .sup.15N.sub.2]-L-lysine and [.sup.13C.sub.6, .sup.15N.sub.4]-L-arginine (100 g/mL each) or L-lysine.HCl and L-arginine.HCl (100 g/mL each). Heavy and light cells were maintained in parallel and cell aliquots were frozen after six passages in SILAC media and stored in liquid N.sub.2 until needed. Whenever thawed, cells were passaged at least three times before being used in experiments.

    [0201] 3T3-L1 preadipocytes were maintained in DMEM supplemented with 10% bovine calf serum. 10T1/2 cells were maintained in DMEM with 10% fetal bovine serum (FBS). To induce differentiation, confluent cells were cultured in DMEM with 10% FBS and exposed to dexamethasone (1 M), 3-isobutyl-1-methylxanthine (IBMX; 0.5 mM), and insulin (1 g/ml) for 2 days, followed by culture with insulin alone (1 g/ml).

    Example 2In Situ Labeling of Live Cells with Fully Functionalized Fragment (FFF) Probes

    [0202] For gel-based experiments, cells were grown in 6-well plates to 90% confluence at the time of treatment. Cells were carefully washed with Dulbecco's phosphate buffered saline (DPBS) and replenished with fresh serum-free media containing indicated FFF probe, and, if applicable, competitors or DMSO vehicle (1 mL). Following incubation at 37 C. for 30 min, cells were directly exposed to 365 nm light for 10 min. For no UV experiments, cells were incubated at 4 C. for 10 min under ambient light. For MS-based experiments, cell labeling was performed in a similar manner as described above. Modifications to this protocol included using isotopically light and heavy SILAC cells that were grown to near complete confluence prior to treatment in 10 cm plates. In probe-versus-control probe and probe-versus-probe experiments, isotopically light cells were treated with indicated fragment probe, while the heavy cells were treated with control probe (1), or additional FFF probe to be compared, at indicated concentrations. In competition type experiments, heavy and light cells were co-treated with the indicated FFF probe and competitor or DMSO, respectively. Following treatments and photocrosslinking, cells were harvested in cold DPBS by scraping, centrifuged (1,400 g, 3 min, 4 C.), and pellets washed with cold DPBS (2) and then aspirated. Pellets were either directly processed or kept frozen at 80 C. until use.

    Example 3Preparation of Probe-Labeled Proteome for Gel- and MS-Based Protein Analyses

    [0203] Cells pellets were lysed in cold DPBS (100-500 L) using a Branson Sonifier probe sonicator (10 pulses, 30% duty cycle, output setting=4). For experiments requiring cell fractionation into membrane and soluble proteomes, cell lysates were then centrifuged (100,000g, 45 min) to provide soluble (supernatant) and membrane (pellet) fractions. Membrane pellets were resuspended in cold DPBS after separation by sonication. Protein concentration was determined using the DC Protein Assay (Bio-Rad) and absorbance read using a Tecan, Infinite F500 plate reader following manufacturer's instructions. For SILAC experiments, isotopically heavy and light whole cell lysates were adjusted to 1.5 mg/mL, and were then mixed in equal proportions (500 L each) in cold DPBS.

    Example 4Gel-Based Analysis of Crosslinked Proteins in Cells

    [0204] Proteomes from treated cells were diluted to 1 mg/mL. To each sample (50 L), 6 L of a freshly prepared click reagent mixture containing 0.1 mM tris(benzyltriazolylmethyl)amine (TBTA) (3 L/sample, 1.7 mM in 1:4 DMSO:t-ButOH), 1 mM CuSO.sub.4 (1 L/sample, 50 mM in H.sub.2O), 25 M tetramethylrhodamine (TAMRA) azide (1 L/sample, 1.25 mM in DMSO), and freshly prepared 1 mM tris(2-carboxyethyl)phosphine HCl (TCEP) (1 L/sample, 50 mM in PBS or H.sub.2O) was added to conjugate the fluorophore to probe-labeled proteins. Upon addition of the click mixture, each reaction was immediately mixed by vortexing and then allowed to react at ambient temperature for 1 hr before quenching the reactions with SDS loading buffer (4 stock, 17 L). Proteins (25 g total protein loaded per gel lane) were resolved using SDS-PAGE (10% acrylamide) and visualized by in-gel fluorescence on a Hitachi FMBIO-II or a Bio-Rad ChemiDoc MP flatbed fluorescence scanner.

    Example 5Preparation of Labeled Proteome for MS-Based Analysis

    [0205] Profiling experiments were adapted methods previously reported. To the combined mixture of heavy and light soluble proteomes (1.5 mg) in 1 mL DPBS, a mixture of TBTA (60 L/sample, 1.7 mM in 1:4 DMSO:t-BuOH), CuSO.sub.4 (20 L/sample, 50 mM in H.sub.2O), TCEP (20 L/sample, 50 mM in DPBS) and Biotin-N3 (10 L/sample, 10 mM in DMSO) was added and each sample was rotated at room temperature. After 1 hr, the mixture was transferred to a 15 mL falcon tube and a cold 4:1 mixture (2.5 mL) of methanol (MeOH)/chloroform (CHCl.sub.3) was added followed by cold PBS (1 mL) on ice. The resulting cloudy mixture was centrifuged (5,000g, 10 min, 4 C.) to fractionate the protein interphase from the organic and aqueous solvent layers. After washing the protein disc carefully with cold 1:1 MeOH:CHCl.sub.3 (31 mL) followed by sonication in cold 4:1 MeOH:CHCl.sub.3 (3 mL) to ensure click reagents were efficiently removed, the remaining precipitate was pelleted by centrifugation (5,000g, 10 min, 4 C.). The pellet was aspirated and resuspended in a freshly-prepared solution of proteomics-grade urea (500 L, 6 M in DPBS) containing 10 L of 10% SDS and then dissolved by sonication. Disulfides were reduced by adding 50 L of a 1:1 mixture containing TCEP (200 mM in DPBS) pre-neutralized with potassium carbonate (600 mM DPBS) for 30 min at 37 C. Reduced thiols were then alkylated by addition of iodoacetamide (70 L of 400 mM in DPBS) for 30 min at ambient temperature protected from light. To each solution, 130 L of 10% SDS (in DPBS) was added and then diluted to 0.2% SDS with DPBS (5.5 mL) and incubated with pre-equilibrated streptavidin agarose resin (100 L 1:1 slurry, Pierce) for 1.5 hr at ambient temperature on a rotator. The streptavidin beads were collected by centrifugation (1,400 g, 1-2 min) and sequentially washed with 0.2% SDS in DPBS (15 mL), detergent-free DPBS (25 mL), and H.sub.2O (25 mL) to remove unbound protein, excess detergent, and small molecules. The resin was transferred to a Protein LoBind tube (Eppendorf) and bound proteins were digested on-bead overnight at 37 C. in 200 L total volume containing sequencing grade porcine trypsin (2 g, Promega) in the presence of urea (2 M in DPBS) and CaCl.sub.2 (1 mM). The proteolyzed supernatant was transferred to a fresh Protein LoBind tube, acidified with formic acid (5% final) and stored at 20 C. until analyzed.

    Example 6Multidimensional Liquid Chromatography-Tandem Mass Spectrometry (LC/LC-MS/MS) Analysis of Tryptic Digests

    [0206] Peptides from tryptic digests were pressure loaded onto a 250 m (inner diameter) fused silica capillary column packed with C18 resin (4 cm, Aqua 5 m, Phenomenex). Samples were analyzed using an LTQ-Orbitrap Velos mass spectrometer (Thermo Scientific) coupled to an Agilent 1200 series quaternary pump. Peptides were eluted by two-dimensional separation on a column with a 5 m tip [100 m fused silica, packed with C18 (10 cm) and strong cation exchange (SCX) resin (4 cm, Phenomenex)] using a five-step MudPIT protocol that involves 0%, 25%, 50%, 80% and 100% salt bumps of ammonium acetate (NH.sub.4OAc; 500 mM) to elute peptides stepwise from the SCX to the C18 resin followed by an increasing gradient of acetonitrile in each step (5%-100% buffer B in buffer A; buffer A: 95% H.sub.2O, 5% acetonitrile, 0.1% formic acid; buffer B: 5% H.sub.2O, 95% acetonitrile, 0.1% formic acid). The flow rate through the column was 0.25 l/min and the voltage applied to the nano-LC electrospray ionization source was 2.5 kV. Spectra were collected in a data-dependent acquisition mode such that each scan cycle involved a single high-resolution full MS spectrum of parent ions (MS1 scan from 400-1800 m/z) collected in the orbitrap coupled to 30 CID-induced fragmentation (MS2) scans in the ion trap of the 30 most abundant parent ions from the MS1 scan. Dynamic exclusion (repeat count of 1, exclusion duration of 20 s). Parent ions with unassigned or +1 charge states by the instrument were excluded for fragmentation. All other parameters were left at default values.

    Example 7Peptide and Protein Identification and Quantification

    [0207] From each of the five .raw files (one for each salt bump) generated by the instrument (Xcalibur software), the MS2 spectra for all fragmented parent ions (.ms2 file) were extracted using RAW Xtract (version 1.9.9.2; 2004 release). Each .ms2 file was searched using the ProLuCID algorithm against a reverse-concatenated, nonredundant (gene-centric) database of the human proteome (Uniprot releaseNov. 5, 2012) or mouse proteome (Nov. 5, 2012) and filtered using DTASelect 2.0 within the Integrated Proteomics Pipeline (IP2) software. All cysteine residues were specified with a static modification for carbamidomethylation (+57.0215 Da) and one oxidized methionine residue per peptide (if found) was allowed as a variable oxidation (+15.9949 Da). In addition, peptides were required to have at least one tryptic terminus. Each dataset was simultaneously searched for both light and heavy isotopologues of the same peptide by specifying the mass shift of heavy residues as static modifications on lysine (+8.0142 Da) and arginine (+10.0082 Da) in a coupled heavy search. The precursor ion mass tolerance for a minimum envelope of three isotopic peaks was set to 50 ppm, the minimum peptide length was six residues, the false-positive rate was set at 1% or lower and at least 2 peptides of a protein must be detected in order to be advanced to the next step of analysis.

    [0208] Heavy and light parent ion chromatograms associated with successfully identified peptides were extracted and compared using in-house software (CIMAGE). Briefly, extracted MS1 ion chromatograms (10 ppm error tolerance of predicted m/z) from both light and heavy target peptide masses (m/z) were generated using a retention time window (10 min) centered on the time when the peptide ion was selected for MS/MS fragmentation (minimum 3 MS1's per peak), and subsequently identified. Next, the ratio of the peak areas under the light and heavy signals (signal-to-noise ratio>2.5) was calculated. Computational filters used to ensure that the correct peak-pair was used for quantification include a co-elution correlation score filter (R20.8), removing target peptides with bad co-elution profile, and an envelope correlation score filter (R2>0.8) that eliminates target peptides whose predicted pattern of the isotopic envelope distribution does not match the experimentally observed high-resolution MS1 spectrum. In addition, peptides detected as singletons, where only the heavy ion of a peptide pair was identified, but that cleared all other filtering parameters, are given a default assigned ratio of 20; which is defined as any measured ratio that is 20 and is the maximum ratio reported here.

    Example 8Proteomic Analysis of Probe-Labeled Proteins by Mass Spectrometry

    [0209] Median SILAC ratios were filtered to ensure that each protein ratio was resultant from three or more unique and quantified peptides and that the combined peptide ratios possessed a standard deviation of less than 60% of the median; if greater, the combined ratio was assigned the lowest quantified peptide value. SILAC ratios meeting these criteria were then combined with replicate data sets from the same probe, cell line and experimental conditions. Identification of probe targets enriched in fragment probe versus control probe experiments in HEK293T cells represent averaged data from at least two biological replicate experiments and K562 data in single replicate experiments. Identification of probe targets from comparison of probe versus probe experiments and from fragment probe competition experiments represent averaged values of at least two biological replicate experiments.

    [0210] In order to be classified as a probe target, proteins must (1) comply with the above criteria and (2) be enriched greater than 5-fold over control probe 1 (SILAC>5) in at least two different probe data sets (200 M). If protein is enriched 5-fold or more by only one probe, then it had to be quantified in three or more independent experiments. In order to be included in probe-versus-probe comparisons, protein must abide by the above criteria and also be a target for at least one of the two probes, as designated above. For competition experiments, proteins (1) must be designated probe targets for the probe being used, as described above, (2) competed greater than 3-fold (competition SILAC ratio>3) unless otherwise noted, and (3) must have SILAC ratios derived from three or more quantified peptides.

    Example 9Fragment Probe Target Meta-Analysis

    [0211] Custom python scripts were used to compile functional annotations of final probe targets available in the UniProtKB/Swiss-Prot Protein Knowledge database. Probe targets were queried against the DrugBank database (Version 4.2) and fractionated into DrugBank and non-DrugBank proteins. Functional keywords assigned at the protein level were collected from the Uniprot database and the two DrugBank and non-DrugBank categories were further classified into protein functional classes. Membrane proteins were defined as proteins possessing known or predicted transmembrane domains (UniProt analysis), and the remaining targets were considered soluble. Heatmaps were generated using RStudio software.

    Example 10Cell Treatments and Preparation for MS-Based Analyses of Probe-Modified Peptides

    [0212] Preparation and analysis was adapted from methods previously reported. In brief, for global mapping of fragment probe-modified peptides, separate 10 cm dishes of cells were treated with probes (200-250 M) in 3.0 mL of DMEM (serum-free) and (if applicable) competitor ligands, proteomes harvested and subjected to click chemistry conditions with either light or heavy isotopically labeled biotin-TEV-azide (10 L of 5 mM stocks in DMSO, final concentration=100 M), TCEP, ligand and CuSO.sub.4 as detailed above. The samples were allowed to react for 1 h at which point the samples were centrifuged (16,000 g, 5 min, 4 C.). The resulting pellets were sonicated in ice-cold methanol (500 L) and the resuspended light- and heavy-labeled samples were then combined and centrifuged (16,000 g, 5 min, 4 C.). The pellets were then solubilized in PBS containing 1.2% SDS (1 mL) with sonication and heating (5 min, 95 C.). Samples were transferred to falcon tubes containing DPBS (5 mL), to which a 100 L of streptavidin-agarose beads slurry was added. After incubation, the beads (3 hr) were pelleted by centrifugation (1,400 g, 3 min) and were washed (210 mL PBS and 210 mL water). The beads were transferred to eppendorf tubes with 1 mL DPBS, centrifuged (1,400 g, 3 min), and resuspended in PBS containing 6 M urea. To this was added 10 mM DTT (25 L of a 200 mM stock in water) and the beads were incubated at 65 C. for 15 mins. 20 mM iodoacetamide (25 L of a 400 mM stock in water) was then added and allowed to react at 37 C. for 30 mins with shaking. The bead mixture was diluted with 900 L PBS, pelleted by centrifugation (1,400 g, 3 min), and resuspended in 200 L 2M urea (DPBS) containing trypsin and CaCl.sub.2 as described above. The beads were separated from the digest by centrifugation (1,000 g, 1 min), washed (21 mL PBS and 21 mL water) and then transferred to fresh eppendorfs with 1 mL water. The washed beads were washed once further in 150 L TEV buffer (50 mM Tris, pH 8, 0.5 mM EDTA, 1 mM DTT) by centrifugation (1,400 g, 3 min) and the resuspended in 150 L TEV buffer. 5 L TEV protease (80 M) was added and the reactions were rotated overnight at 29 C. The TEV digest was separated from the beads by centrifugation (1,400 g, 3 min) and the beads were washed once with water (100 L). The samples were then acidified to a final concentration of 5% (v/v) formic acid and stored at 80 C. prior to analysis.

    [0213] The resulting probe-modified peptides were collected for MS analysis, which was performed as described above with differences in the salt bumps applied in the chromatographic gradients which in this case were 0%, 30%, 60%, 90% and 100% NH.sub.4OAc (500 M). The protein identification searches of the MS data were performed with the following changes applied to identify the peptides modified with the corresponding fragment probe and the cleaved TEV tag. All amino acids were considered as possible residues for modification. To facilitate the computational searches, sets of up to 3 amino acids were searched using ProLuCID and filtered with DTASelect as described above. The mass of the modification used to search for probe-modified peptides was +665.4013 m/z for 8, +667.3264 m/z for 4, +665.3285 m/z for 3, +678.3602 m/z for 6, +680.4122 m/z for 9, +679.4179 m/z for 13, +755.3867 m/z for 2, +655.4170 m/z for 14, and +669.3598 m/z for 15, which are the masses for the corresponding probe plus the light TEV-tag and an additional+6.0138 m/z for the heavy counterpart. The isoTOP ratios for probe labeled peptides were quantified using the in-house software CIMAGE.

    Example 11Analysis of Probe Labeled Peptides

    [0214] For protein mapping experiments, fragment probe-modified peptides were expected to show a ratio of heavy and light signals of 1.0 (0.5<ratio<2.0) and were required to have been designated an enriched target by the corresponding probe in whole-protein capture experiments. For each protein in the site-of-labeling dataset, the UniProtKB accession number was used to map and collect relevant structures from the RCSB Protein Data Bank (PDB) fulfilling the following criteria: structures determined by X-ray crystallography, wild-type protein, Homo sapiens as the sole source organism. For proteins with multiple available structures, custom R scripts were used to further filter the PDB files, privileging higher sequence coverage for isoTOP peptides (see Tables 1-3 for selected PDB accessions). Fpocket 2.0 was used to detect potential binding pockets for the resultant structures with all parameters set at recommended default. Pockets with volume less than 500 .sup.3 were removed from output prior to further analysis. Residues surrounding fpocket predicted binding pockets for each protein were collected to determine the number of residues overlapping with isoTOP peptides. For structures with multiple chains, the average number of overlapping residues for all chains possessing isoTOP peptide was used. Custom Python scripts were used to compile functional site annotations using the UniProtKB/Swiss-Prot Protein Knowledge database (release-2016_06). Relevant UniProt entries were searched for available functional residues, specifically for annotations regarding enzyme catalytic residues (active sites), substrate binding sites, and metal-binding sites. At the isoTOP peptide level, the distances between all possible atom pairs, consisting of one atom from isoTOP peptide and the other atom from a functional site, were calculated and the minimum distance was designated as the spatial distance between isoTOP peptide and functional sites. Annotated FFF-labeled peptides and corresponding analyses shown in Table1-3.

    Example 12PPAR Luciferase Reporter Assay

    [0215] HEK293T cells were transiently co-transfected using Polyethylenimine (Sigma) with a UAS-Luciferase reporter and a vector expressing the heterologous GAL4 DNA binding domain (DBD) or a GAL4 DNA binding domain::PPAR ligand binding domain (LBD) chimeric protein, and full-length PTGR2. 24 hr after transfection, cells were treated either with vehicle (DMSO), 15k-PGE.sub.2 (20 M), or fragment compounds. Rosiglitazone (2 M), a synthetic PPAR ligand, was used as control. 16 hr after incubation, cells were lysed in Cell Culture Lysis Reagent (Promega) and luciferase activity measured using the Luciferase Assay System (Promega).

    Example 13Oxygen Consumption Rate Measurements

    [0216] Palmitate-BSA oxidation measurements were performed using the Seahorse XFe96 Extracellular Flux Analyzer. Briefly, HSC5 cells were plated at 4.010.sup.4 cells/well and incubated for 24 hr in a 37 C., 5% CO.sub.2 incubator. One hour prior to the XF assay, media was changed to 1 Krebs-Henseleit buffer (111 mM NaCl, 4.7 mM KCl, 2 mM MgSO.sub.4, 1.2 mM Na.sub.2HPO.sub.4, pH 7.4) with 2.5 mM glucose, 0.5 mM carnitine, and 5 mM HEPES. 20 min after media exchange, cells were treated with either vehicle (DMSO), 24 (100 M) or 21 (100, 50, 20 and 5 M respectively). After 40 min, cells were given palmitate:BSA (667 M and 167 M respectively) or BSA alone and the XF assay was started. Perturbation compounds (oligomycin 4 M, FCCP 4 M, RAA 2 M) were prepared in 1KH buffer and injected from the reagent ports automatically onto wells.

    Example 14Adipocyte Phenotypic Screen

    [0217] 3T3-L1 preadipocytes were induced to differentiate in the presence of 50 M of each fragment probe. Rosiglitazone (2 M) was used as a positive control. Media was replaced every two days and compounds refreshed. On day 8 of differentiation, cells were fixed with 4% PFA and stained with the fluorescent lipid stain Nile red (AdipoRed) and Hoechst for nuclei counterstain. Cells were imaged using a Celigo S Cell Imaging Cytometer (Nexcelom Bioscience) and compounds promoting increased lipid accumulation (i.e. fluorescence) identified. Hits were validated at two concentrations (10 M and 50 M) in 12-well plate format. To prepare primary brown preadipocytes, interscapular fat depots of neonatal mice were digested for 40 min at 37 C. with 1.5 mg/mL collagenase type I in 61.5 mM NaCl, 2.5 mM KCl, 0.65 mM CaCl.sub.2, 2.5 mM glucose, 50 mM Hepes, 50 g/mL penicillin-streptomycin and 2% (wt/vol) BSA. Cells were next filtered through a 100 m cell strainer, plated in DMEM supplemented with 20 mM Hepes, 20% FBS, and penicillin/streptomycin, and grown to confluency. Cells were induced to differentiate in DMEM with 10% FBS, dexamethasone (1 M), IBMX (0.5 mM), insulin (1 g/ml), triiodothyronine (1 nM), and either DMSO (0.1%), 25 (10 M), or rosiglitazone (2 M). Two days later, media was switched and differentiating cells were maintained in DMEM, 10% FBS, insulin, triiodothyronine, and experimental compounds. Media was refreshed every 2 days. Human mesenchymal stem cells were maintained in DMEM supplemented with 10% FBS and grown to confluence. Two days after confluence, cells were induced to differentiate in media containing DMEM supplemented with 10% FBS, dexamethasone (1 M), IBMX (0.5 mM), insulin (1 g/ml), indomethacin (125 M), and either DMSO (0.1%), 25 (10 M), or rosiglitazone (2 M) for 2 days. Media and compounds were refreshed every 2 days, alternating complete differentiation media with maintenance media (DMEM 10% FBS supplemented only with insulin) for 18 days.

    Example 15RNAseq Analysis

    [0218] For RNA-seq, 0.6-110.sup.6 cells were collected in Trizol (Invitrogen) and total RNA was extracted using Direct-Zol RNA extraction kit (Zymo Research). PolyA+RNA was fragmented and prepared into strand-specific libraries using the Illumina True-seq stranded RNA kit (Illumina) and analyzed on an Illumina HiSeq 2500 sequencer. Libraries were sequenced using single-end 50 bp reads at a depth of 10-15 million reads per library. Single-end sequencing reads were mapped to the mouse reference genome (mm9, NCBI37) using STAR (version 2.3.0.c, default parameters). Only reads that aligned uniquely to a single genomic location were used for downstream analysis (MAPQ>10). Gene expression values were calculated for read counts on exons of annotated RefSeq genes using HOMER. Differentially expressed genes between GFP- and PGRMC2-overexpressing cells were calculated from three replicates per condition using EdgeR and a threshold of adjusted p-value<0.05 was used to call differentially expressed genes. Gene expression values are shown as read counts normalized to 107 mapped reads. Differentially expressed genes were used for pathway analysis. Gene ontology functional enrichment analysis was performed using Ingenuity Pathway Analysis (Qiagen). Heatmaps were generated using RStudio software (package gplots). RNA-seq data have been deposited in the GEO repository under accession number GSE90731.

    Example 16Cell Viability Assay

    [0219] Cells were seeded in white-opaque 96-well plates in full growth media at a density of 6,000 cells/well (100 L) and were allowed to grow for 14 hrs at 37 C. in a humidified 5% CO.sub.2 atmosphere. The cells were then treated with compounds or DMSO (1% DMSO final for all wells) in triplicate and incubated at 37 C. in a humidified 5% CO.sub.2 atmosphere for 45 min. Note, all photoaffinity probe incubations for MS- and gel-based experiments were performed for 30 min. Cell viability was determined using the luciferase-based CellTiter-Glo Luminescent Cell Viability Assay (Promega).

    Example 17Cloning and Transient Overexpression of Proteins in HEK293T Cells

    [0220] Full-length genes encoding proteins of interest were PCR amplified from a cDNA library derived from low-passage HEK293T cells. Gene products were cloned into the pRK5 vector with a C-terminal FLAG tag using Sall (N-terminal) and NotI (C-terminal) restriction sites. All clone sequences were verified. To recombinantly overexpress proteins used in in situ treatments, HEK293T cells were grown to 40-60% confluency under standard growth conditions in 6-well (for gel-based experiments) or 10 cm tissue culture plates (for MS-based experiments) and transiently transfected with 1-3 g of desired construct (6-well plates) or 5 g (10 cm plates) using polyethyleneimine MAX (MW 40,000, PEI; Polysciences, Inc.). Mock transfected cells were transfected with a vector containing METAP2 for 48 hr. Human SLC25A20 in a pCMV6-Entry vector with a C-terminal DDK tag was purchased from Origene. Empty pCMV-Entry vector was used as mock control for experiments with SLC25A20. The pRK5 vector was a gift from David Sabatini (MIT).

    Example 18Lentiviral Infection

    [0221] 3T3-L1 preadipocytes were infected overnight at 70% confluency in 10 cm Petri dishes with lentiviruses expressing a non-targeting scramble shRNA or two different shRNAs against mouse PGRMC2. Two days after infection, cells were re-plated into 12-well plates and grown to confluence. Two days after confluence, cells were induced to differentiate in presence of dexamethasone (1 M), IBMX (0.5 mM), insulin (1 g/ml) and either DMSO (0.1%), test compound (10 M), or Rosiglitazone (2 M). Cells were stained at day 7 of differentiation with Nile Red and Hoechst, imaged and harvested for RNA and protein extraction. For rescue experiments, scramble and PGRMC2 knockdown cells were co-infected with lentiviruses over-expressing human VS-tagged PGRMC2. 3T3-L1 preadipocytes stably overexpressing GFP or hPGRMC2 were selected with blasticidin (20 g/ml) for 10 days and maintained in culture in 10% BCS.

    Example 19Confocal Imaging of PGRMC2

    [0222] For immunostaining, cells were grown on gelatin-coated cover glasses, fixed in 4% PFA, permeabilized in 0.5% Triton-PBS and blocked with 5% FBS-PBS solution. Rabbit anti-PGRMC2 (Bethyl Labs) and mouse KDEL monoclonal antibody (clone 10C3, Enzo Life Sciences) were diluted at 0.4 g/ml and 1 ug/ml using blocking buffer and samples were incubated overnight at 4 C. in a humidified chamber. Alexafluor-488 anti-rabbit and alexafluor-568 anti-mouse secondary antibodies were diluted to 1:500 dilution in blocking buffer and samples incubated for 1 hour at RT. Nuclei and actin filaments were stained by Hoechst and Acti-stain 670 phalloidin dyes, respectively. Cells were washed 3 times with PBS for 10 minutes after each incubation. Images were acquired with a Zeiss LSM 710 laser scanning confocal microscope and analyzed with IMARIS (Bitplane Inc.) and Adobe Photoshop CS3 (Adobe Systems Incorporated) software.

    Example 20Western Blot Analysis

    [0223] After scanning for fluorescence, proteins were transferred to a nitrocellulose membrane in Towbin buffer, the membrane was blocked for 1 hr at ambient temperature with 5% nonfat dry milk (w/v) or 5% BSA in Tris-buffered saline with Tween 20 (TBST) and incubated with primary antibodies in the same solution overnight at 4 C. The blots were washed (35 min, TBST), incubated with secondary antibodies (IRDye 800CW or HRP-conjugated anti-mouse and anti-rabbit) in milk or BSA for 1 hr at ambient temperature, washed (35 min, TBST), rinsed in water and visualized on a LICOR Odyssey Scanner or resolved by film exposure.

    Example 21Gene Expression Analysis

    [0224] Total RNA was isolated from cells using Direct-Zol RNA MiniPrep Plus (Zymo Research). Taqman-based quantitative real-time PCR was performed using the SuperScript III Platinum One-Step qRT-PCR reagent (Thermo Fisher Scientific). Samples were run in triplicate as multiplexed reactions and normalized to an internal control (36B4; acidic ribosomal phosphoprotein PO mRNA).

    Example 22In Vitro LCMS-Based Activity Assay for PTGR2

    [0225] Aliquots (1 L) of test compounds dissolved in DMSO were transferred to 1.5 mL eppendorf tubes followed by addition of recombinant human PTGR2 (44 L, 200 nM final concentration) in freshly prepared reaction buffer (Tris Buffer, 1 mM EDTA, 50 M TCEP, 300 M NADPH). The resulting mixture was vortexed and then incubated at 37 C. for 20 min. Next, a 5 L solution of 15-keto-PGE.sub.2 substrate (20 M final concentration) in reaction buffer was added and the reaction was allowed to proceed for 30 min at 37 C. Reactions were quenched by the addition of 0.5% AcOH in ethyl acetate (800 L), water (300 L) and 100 L, of internal standard PGE.sub.2-d.sub.4 (30 pmol/sample) dissolved in 1:1 methanol/water. Phases were separated by centrifugation and the organic layer was collected and dried under a stream of N.sub.2, then stored at 80 C. until analysis. Directly prior to analysis, samples were reconstituted in 100 L of MeCN:H.sub.2O (1:1, v/v) and analyzed by LC/MS/MS. All conditions were performed in triplicate and repeated at least three independent times.

    TABLE-US-00001 LCMS Conditions for prostaglandin measurements Instrument Agilent 6460 Triple Quadrupole LC/MS system Column Kinetex 5 m C18 100 A, 50 4.6 mm column Injection 15 L Gas temperature 350 C. Gas flow 9 L/min nebulizer 35 psi capillary 4000 V positive/4000 V negative MRM scan type 300 delta EMV (+) Mobile Phase A 70:30:0.1 H.sub.2O/Acetonitrile/Formic acid Mobile Phase B 50:50:0.1 Isopropyl Alcohol/Acetonitrile/Formic Acid

    [0226] The following MS parameters were used to measure the indicated metabolites by MRM (precursor ion, product ion, collision energy, polarity): PGE.sub.2-d.sub.4 (355, 275, 18), 13,14-dihydro-15-keto-PGE.sub.2 (351, 333, 18) and 15-keto-PGE.sub.2 (349, 161, 20). 15-keto-PGE.sub.2 and 13,14-dihydro-15-keto-PGE.sub.2 levels were quantified by determining peak areas in relation to internal standard PGE.sub.2-d.sub.4. Non-deuterated 15-keto-PGE.sub.2 and 13,14-dihydro-15-keto-PGE.sub.2 standards were used to confirm retention time and fragmentation.

    Chromatography Method:

    [0227]

    TABLE-US-00002 Time (min) B (%) Flow rate (mL/min) 0.0 0 0.6 1.0 0 0.6 2.0 20 0.6 4.0 20 0.6 7.0 75 0.6 7.2 100 0.6 11.0 100 0.6 11.1 0 0.6 13.0 0 0.6
    *To minimize carryover, LC solvents were cycled between 100% Mobile Phase A and 100% Mobile Phase B over 5 min after each run.

    Example 23LCMS Analysis of Acylcarnitines in HSC-5 Cells

    [0228] HSC-5 cells were seeded in 10 cm plates and grown to 90% confluency. Media was aspirated, cells were washed carefully with DPBS (3 mL) and resuspended in freshly-prepared serum-free IMDM media containing test compound(s) or vehicle. After incubation at 37 C. for 3 hr, the media was removed and cells were washed with cold DPBS (23 mL). Cells were scraped in 4 mL cold DPBS, transferred to a falcon tube and centrifuged at 2000 rpm for 8 min, and resuspended in 1 mL cold DPBS. Cells were lysed using a probe sonicator, and 1 mL of lysates normalized to 1.5 mg/mL were transferred to 2-dram glass vials. MeCN (3 mL) containing acyl carnitine internal standard mix (Cambridge Isotope Laboratories) was added to lysates and vigorously vortexed. Internal standards include .sup.2H.sub.9-carnitine (2.28 nmol); .sup.2H.sub.3-acetyl carnitine (C2, 570 pmol); .sup.2H.sub.3 propionyl carnitine (C3, 120 pmol); .sup.2H.sub.3 butryl carnitine (C4, 120 pmol); .sup.2H.sub.9 isovaleryl carnitine (C5, 120 pmol); .sup.2H.sub.3 octanoyl carnitine (C8, 120 pmol); .sup.2H.sub.9 myristoyl carnitine (C14, 120 pmol); .sup.2H.sub.3 palmitoyl carnitine (C16, 240 pmol). Samples were centrifuged at 1000 rpm for 5 min to pellet insoluble precipitate, and the remaining eluent carefully transferred to fresh 2-dram vials to avoid disturbing the precipitate. The eluent was concentrated under a stream of N.sub.2, and samples were stored at 80 C. until analysis. Directly prior to analysis, samples were reconstituted in 500 uL of MeCN:H.sub.2O (1:1, v/v) and analyzed by LC/MS/MS. The indicated acyl carnitines were quantified by measuring the area under the peak relative to an internal standard (.sup.2H.sub.3 palmitoyl carnitine for C16, C18 and C18:1; .sup.2H.sub.9 myristoyl carnitine for C12 and C14; .sup.2H.sub.3 octanoyl carnitine for C5DC/C10-OH and C4DC; .sup.2H.sub.9 isovaleryl carnitine for C5 and C7).

    TABLE-US-00003 LCMS Conditions for acyl carnitine measurements Instrument Agilent 6460 Triple Quadrupole LC/MS system Column Kinetex 5 m C18 100 A, 50 4.6 mm column Injection 15 L Gas temperature 350 C. Gas flow 9 L/min nebulizer 35 psi capillary 4000 V positive/4000 V negative MRM scan type 300 delta EMV (+) Mobile Phase A 95:5:0.1 H.sub.2O/Methanol/Formic Acid Mobile Phase B 60:35:5:0.1 Isopropyl Alcohol/Methanol/H.sub.2O/Formic Acid

    Chromatography Method:

    [0229]

    TABLE-US-00004 Time (min) % B Flow (mL/min) 0 0 0.1 5 0 0.1 5.01 0 0.4 7 0 0.4 30 100 0.4 30.01 100 0.5 38 100 0.5 38.01 0 0.5 42 0 0.5 46 100 0.5 50 100 0.5 54 0 0.5 57 0 0.5 57.01 0 0.4 59 0 0.1
    *To minimize carryover, LC solvents were cycled between 100% Mobile Phase A and 100% Mobile Phase B over 5 min after each run.

    TABLE-US-00005 Transition Table: Acyl Carnitine Precursor .fwdarw. product ion C12 344.2 .fwdarw. 85.1 C14 372.3 .fwdarw. 85.1 C16 400.3 .fwdarw. 85.1 C18:1 426.3 .fwdarw. 85.1 C18 428.3 .fwdarw. 85.1 C4DC 318.2 .fwdarw. 85.1 C5 246.1 .fwdarw. 85.1 C10-OH 332.2 .fwdarw. 85.1 C7 274.1 .fwdarw. 85.1 D3 acetyl 207.1 .fwdarw. 85.1 D3 butyryl 235.1 .fwdarw. 85.1 D3 octanoyl 291.2 .fwdarw. 85.1 D3 palmitoyl 403.3 .fwdarw. 85.1 D3 propionyl 221.1 .fwdarw. 85.1 D9 isovaleryl 255.1 .fwdarw. 85.1 D9 myristoyl 381.3 .fwdarw. 85.1

    Example 24Quantification and Statistical Analysis

    [0230] All data fitting and statistical analysis performed using GraphPad Prism version 6.00 for Windows, GraphPad Software, La Jolla Calif. USA, www.graphpad.com. Statistical values including the exact n and stasticial significance are also reported. Probe binding blockade and PTGR2 inhibition curves are plotted as meanSD (n=3 or 4 per group) for a representative biological replicate using a variable slope (four parameter) non-linear fit. Gene expression data are presented as meanSD (n=3 per group). HSC5 metabolite data are shown as meanSD (n=3 per group). Statistical significance was defined as P<0.05 and determined by 2-tailed Student t tests, or two-way ANOVA with Bonferroni's post-tests.

    Example 25Data and Software Availability

    [0231] Data Resources: The RNA-seq data reported has been deposited in the NCBI under the ID code GEO: GSE90731.

    [0232] Software: All custom scripts used have been deposited to GitHub (https://github.com/Chymichead/FBDDinCell).

    Example 26Profiling Small-Molecule Fragment-Protein Interactions in Human Cells

    [0233] A small library of 14 fully functionalized fragment (FFF) probes were synthesized as described in Example 30 with each member possessing a variable small-molecule fragment conjugated to a constant tag bearing an alkyne and photoactivatable diazirine group (FIG. 1A). The variable fragment groups had an average molecular weight of 176 Da and were selected because they represent structural motifs found in many biologically active natural products and clinically approved drugs (FIG. 1B). The FFF probes were initially assessed using gel-based profiling (FIG. 1D) by treating HEK293T cells with each fragment probe (20 M, 30 min), followed by exposure to UV light (10 min, 4 C.), cell lysis, coupling to a rhodamine (Rh)-azide tag using copiper-catalyzed azide alkyne cycloaddition (CuAAC) chemistry, and separation and visualization of fragment-modified proteins by SDS-PAGE coupled with in-gel fluorescence scanning Despite the structural simplicity and small size of the variable fragment groups, each probe produced marked and differential concentration-dependent protein labeling in HEK293T cells (FIG. 1C, FIG. 1E, and FIG. 1F). Negligible protein labeling was observed in the absence of UV light (FIG. 1C and FIG. 1E), exemplifying that the fragment-protein interactions correspond to reversible binding events that were converted to covalent adducts by photoreactivity. Exposure of cells to UV light from 5-60 min produced equivalent protein labeling (FIG. 1G), while washing cells prior to UV exposure substantially decrease FFF probe labeling for most, but not all proteins (FIG. 1H). Finally, a fragment-less probe bearing a methyl group (1) produced much less protein labeling, exemplifying that the variable group of FFF probes is critical for protein binding and further that 1 serves as a useful control probe for the chemical proteomic mapping of fragment-protein interactions in cells.

    Example 27a Global Analysis of Fragment-Protein Interactions in Cells

    [0234] Fragment-binding proteins in human cells were globally mapped by quantitative chemical proteomics following the general protocol shown in FIG. 1A. Each FFF probe was initially compared to control probe 1 in pairwise experiments using isotopically light and heavy amino acid-labeled HEK293T cells, where proteins strongly enriched by the test FFF probe over 1 (light:heavy ratios>5) were designated as test probe targets. Adhering to the general principles of FBLD, where a relatively small number of fragments are screened at high concentrations against proteins, 11 FFF probes (2-4, 6, 8-9, 11-15) were analyzed at 200 M each (30 min incubation; n=2-3 per probe) in HEK293T cells, with a subset of probes also being evaluated in K562 cells. Under these conditions, FFF probes displayed little to no cytotoxicity (FIG. 2K) and interacted with an extensive array of proteins. To minimize false-positives, proteins were only designated as fragment targets if they were detected with at least three unique, quantifiable peptides and enriched (>five-fold over 1, FIG. 2L) by more than one FFF probe, or, if enriched by only one probe, then required to be quantified in at least three independent experiments. Control experiments were also conducted with representative probes to confirm that targets were enriched in a UV-dependent manner and showed SILAC ratios of 1.0 in experiments where heavy and light cells were treated with equal concentrations of the same FFF probe (FIG. 2M, FIG. 2N).

    [0235] In aggregate, more than 2000 protein targets were identified for the FFF probes, which individually displayed a broad range of protein enrichments (FIG. 2A, FIG. 2O). When tested at lower concentrations (20 M), FFF probes enriched fewer protein targets (FIG. 2O, FIG. 2P), confirming that the extent of proteome engagement depends on probe concentration. A review of expression-based proteomics data generated in HEK293T cells revealed that the protein targets of FFF probes spanned more than five orders of magnitude in abundance and this range bracketed the median protein abundance value in HEK293T cells (FIG. 2Q), exemplifying, along with other analyses (FIG. 2R, FIG. 2S), that FFF probes enriched proteins across a broad range of expression.

    [0236] To more quantitatively assess the structure-activity relationships (SARs) emerging from the initial FFF probe experiments, additional studies were performed comparing the relative protein interaction profiles of FFF probes, wherein isotopically light and heavy cells were treated with two different probes (probe-vs-probe comparisons) and processed as shown in FIG. 1A. These experiments exemplified that proteins preferentially enriched by one FFF probe relative to another in probe-vs-probe comparisons were also often preferentially enriched by the same probe in original comparisons to control 1 (FIG. 2B-FIG. 2F). The probe-vs-probe comparisons also revealed that most of the proteins showing broad interaction potential across the fragment library in probe-vs-control 1 experiments (light gray sub-bars, FIG. 2C) still exhibited preferential interactions with one or a subset of FFF probes (FIG. 2G-FIG. 2J).

    [0237] The fragment interactions profiles were verified for representative proteins by recombinant expression in HEK293T cells. It was found that the fragment interaction profile for each recombinant protein, as measured by gel-based profiling (FIG. 1D), matched that of its endogenous form as determined by quantitative MS-based proteomics, with each target showing a strong preference for a distinct fragment probe (FIG. 2T, FIG. 2U).

    Example 28Types of Proteins and Protein Sites Targeted by Fragments

    [0238] The fragment probes targeted both membrane and soluble proteins (FIG. 3H), and only a small fraction (17%) of these proteins had known ligands as estimated by their presence in the DrugBank database (FIG. 3A). This subset of previously liganded proteins was mainly enzymes (FIG. 3B). In contrast, the much larger subset of fragment probe targets (83%) not represented in DrugBank showed a broader functional distribution, with a reduced fractional representation of enzymes counterbalanced by expanded coverage of channels/transporters/receptors, transcription factors/regulators, and uncategorized proteins (FIG. 3B). A greater percentage of targets enriched by low (20 M, 24%) versus high (200 M, 12%) concentrations of fragments were found in DrugBank (FIG. 3A), exemplifying that the capacity to screen higher concentrations of fragment probes expanded the scope of newly discovered ligandable proteins in human cells.

    [0239] Considering that the chemical proteomic results provided the first evidence of ligandability for many protein targets, the fragment binding sites on these proteins were aimed to be identified next. Determining the sites of photoreactive probe binding to proteins is technically challenging, but the simple structures of FFF probes, along with the implementation of advanced chemical proteomic methods for isotopically labeling small-molecule probe-modified peptides is advantageous. Using these methods, over 800 unique peptides modified by one or more FFF probes were identified that collectively derived from 443 proteins (FIG. 3I and Tables 1-3) in HEK293T cells. Fragment-modified peptides were found in both membrane and soluble proteins (FIG. 3I), and, while many proteins were targeted by multiple FFF probes at the same site (FIG. 3J), in the substantial majority of cases, only a single fragment-modified peptide was identified per protein (FIG. 3C).

    [0240] Using the pocket-detection algorithm fpocket, for the 186 proteins harboring fragment-modified peptides for which crystal structures were also available (FIG. 3I), it was found that the vast majority of fragment-modified peptides (80%) overlapped directly and substantially with predicted ligand-binding pocket residues (FIG. 3D and FIG. 3K and Tables 1-3). For proteins possessing multiple distinct fragment-modified peptides, it was found that these peptides often mapped to a shared predicted pocket (FIG. 3L). For proteins with annotated functional residues (e.g., active site residues; 77 total proteins), approximately 60% of the probe-modified peptides were within 6 angstroms of a functional residue (FIG. 3M).

    [0241] Many of the proteins with mapped fragment-binding sites and crystal structures corresponded to enzymes (FIG. 3N), but non-enzymes of note included: i) the 14-3-3 adapter protein YWHAE, which was modified by probe 13 on a peptide (aa 197-215) that lines the primary interaction cleft for binding the oncoprotein myeloid leukaemia factor 1 (MLF1) (FIG. 3E); and ii) the proapoptotic effector protein BAX, which was also modified by probe 13 on a peptide (aa 66-79) within a groove that binds the BH3-domain containing activators Bim and Bid (FIG. 3F). Among the enzymes with mapped fragment-binding sites, the cysteine protease cathepsin B (CTSB) was targeted by probe 9 at an active-site proximal peptide (aa 315-332), and this interaction was blocked by the CTSB inhibitor Z-FA-FMK (FIG. 3G). Fragment-modified peptides at allosteric or secondary ligand-binding sites were also identified, including, for instance, a pocket on -galactosidase (GLA) proposed to constitute a site for pharmacological chaperoning (FIG. 3O). Lastly, little overlap (<15%) was found between FFF targets and proteins liganded by cysteine-reactive electrophilic fragments (FIG. 3P). Even if this analysis was restricted to proteins that contained IA-reactive, the overlap between FFF targets and electrophilic fragments targets remained modest (28%) (FIG. 3P). These results exemplify that reversible and irreversible fragments interact with largely distinct subsets of the human proteome.

    Example 29Functional Characterization of Fragment-Protein Interactions

    [0242] FBLD typically identifies low-affinity (high M to mM) hit compounds that often require substantial, structure-guided medicinal chemistry optimization to improve potency and selectivity. As an alternative and complementary approach to structure-based ligand development, the proteome-wide, cell-based fragment screens are adapted to identify higher potency ligand-protein interactions. This goal is accomplished by screening focused libraries of small molecules containing representative fragment cores elaborated with additional binding substituents for competitive blockade of FFF probe-protein interactions in cells (FIG. 4A). Elaborated competitor molecules were purchased or synthesized for three FFF probes3, 6, and 8 (FIG. 4B and FIG. 4I-FIG. 4K)and treated cells with these competitors (17 total, each screened versus DMSO as a control) in eight-fold excess over the corresponding FFF probe (160 M competitor, 20 M FFF probe), after which FFF-modified proteins enriched and identified as shown in FIG. 4A. A total of 100 competed targetsdefined as proteins that displayed substantial reductions (>3-fold) in signal in small-molecule competitor (heavy) versus DMSO (light) treated cellswere identified (FIG. 4C-FIG. 4F, FIG. 4L). Competed proteins showed widely varied SARs that ranged from broad interactions with several (>5) competitors to preferential binding to a single competitor (FIG. 4D).

    [0243] Another 215 competed targets were mapped in experiments where a subset of the competitors (five total) was tested against higher concentrations of the corresponding FFF probes (200 M) (FIG. 4M). A greater representation of DrugBank proteins was noted for competed targets identified with low (20 M) versus high (200 M) concentrations of FFF probes (43% and 20%, respectively) (FIG. 4E). These results exemplify that performing small-molecule competition studies with higher concentrations of FFF probes, where a much greater proportion of probe targets are enriched and quantified (FIG. 2O), increases not only the total number of identified competed protein targets, but also the fraction of these targets that represent heretofore unliganded proteins. Finally, the competed protein targets exemplified a broad functional class distribution generally matching that found for the greater collection of FFF targets (FIG. 4F), exemplifying that high-occupancy small-molecule interactions were not biased toward a specific category of protein in human cells.

    [0244] For determining if the discovered small-molecule ligands affected protein functions, one enzyme (PTGR2) and one transporter (SLC25A20) were selected for which distinct high-occupancy ligands were identified in competitor profiling experiments (FIG. 4G, FIG. 4H). These proteins also have important roles in human metabolism, but lack selective, cell-active inhibitors. Gel-based competitor profiling of recombinant PTGR2 and SLC25A20 (FIG. 5H) exemplified the preferential binding of ligands determined by MS-based proteomics (20 for PTGR2 and 21 for SLC25A20; FIG. 4G, FIG. 4H). Competitor molecules containing only the fragment head groups of FFF probes did not appreciably block probe labeling of PTGR2 and SLC25A20 (FIG. 5I). These results exemplify that chemical proteomics discover weak fragment-protein interactions in cells and, through competitive profiling of structurally elaborated fragment analogues, efficiently identify compounds that display superior protein binding.

    [0245] PTGR2, or prostaglandin reductase 2, catalyzes the NADPH-dependent reduction of 15-keto-PGE2 to 13,14-dihydro-15-keto-PGE2 and regulates adipogenesis through restricting 15-keto-PGE2 activity as a natural ligand for the nuclear receptor PPAR. The only reported inhibitor of PTGR2 is the NSAID drug indomethacin, which exhibits a very weak in vitro IC50 value of 200 M. Probe 8 modified two active site-proximal peptides in PTGR2, and these reactions were sensitive to competition by 20 (FIG. 5A), which also inhibited PTGR2-mediated reduction of 15-keto-PGE2 with an IC50 value of 79 M (FIG. 5B). A screen of structural analogues of 20 exemplified that substitution of the lactam ring with a phenyl group and conversion of the piperidine core to a piperazine furnished 22 (FIG. 5C and FIG. 5J), which showed substantially increased potency (>20-fold) in assays measuring either competition of 8-labeling (FIG. 5C) or 15-keto-PGE2 reductase activity (IC50=0.6 M; FIG. 5B) of recombinant PTGR2. An inactive analogue 23 was also identified, which did not affect labeling of PTGR2 by 8 (FIG. 5C and FIG. 5J) or PTGR2 catalytic activity (FIG. 5B).

    [0246] Compound 22, but not 23, blocked FFF 8 labeling of endogenous PTGR2 in HEK293T cells with good potency (complete inhibition at 5 M and 80% inhibition at 500 nM) and excellent selectivity (FIG. 5K-FIG. 5M). 22 did not cross-react with ZADH2 (FIG. 5L), a sequence-related homologue of PTGR2 that was a principal off-target of 20 (FIG. 4G). Addition of 22 also produced a concentration-dependent rescue of 15-keto-PGE2-dependent PPAR transcriptional activity in cells recombinantly expressing PTGR2 (FIG. 5D); in contrast, the inactive control compound 23 showed no effect (FIG. 5D). Neither 22 nor 23 directly modulated PPAR (FIG. 5N). The IC.sub.50 value displayed by 22 for inhibition of PTGR2 in cells was 0.7 M (FIG. 5O), which meets the criterion for in situ activity of chemical probes put forth by the Structural Genomics Consortium.

    [0247] SLC25A20 is a multi-pass transmembrane protein that transports long-chain acylcarnitines into the mitochondrial matrix, where these lipids provide fatty acid substrates for (3-oxidation. There are no selective small-molecule probes to study SLC25A20 function in human cells. The quantitative MS experiments exemplified SLC25A20 as a primary target of the elaborated coumarin-based competitor 21 (FIG. 4H), and this interaction was confirmed for recombinant SLC25A20 in HEK293T cells, where 21 blocked FFF probe 3 labeling of SLC25A20 with an IC.sub.50 of 10 M (FIG. 5E). The coumarin-based compound 24 was identified as an inactive control (FIG. 5E, FIG. 5P, and FIG. 5Q).

    [0248] Compound 21 (0.2-100 M, 3 h), but not the inactive control 24 (100 M), produced a strong, concentration-dependent increase in long-chain (C16, C18, C18:1) acylcarnitines in human squamous cell carcinoma (HSC5) cells, with significant effects being observed for 21 at concentrations (20-50 M; FIG. 5F), where 21 also substantially blocked probe 3 labeling of SLC25A20 in cells as measured by quantitative MS-based proteomics (FIG. 5Q, FIG. 5R). No changes were found in short- or medium-chain acylcarnitines (<C16), which are thought to cross the mitochondrial membranes without conversion to acylcarnitine esters. HSC5 cells treated with 21, but not 24 showed impaired capacity to oxidize palmitate (FIG. 5G and FIG. 5S). These results exemplify that 21 acts as a selective, cell-active inhibitor of SLC25A20, leading to disruption of mitochondrial long-chain acylcarnitine transport and FAO.

    Example 30Chemical Synthesis

    Materials

    [0249] Purchased starting materials were used as received unless otherwise noted. All moisture sensitive reactions were performed in an inert, dry atmosphere of nitrogen in flame dried glassware. Reagent grade solvents were used for extractions and flash chromatography. All amines used in probe library synthesis are available from commercial vendors. All fragment-based competitors were synthesized or purchased through Sigma Aldrich Market Select vendors. Reaction progress was checked by analytical thin-layer chromatography (TLC, Merck silica gel 60 F-254 plates). The plates were monitored either with UV illumination, or by charring with anisaldehyde (2.5% p-anisaldehyde, 1% AcOH, 3.5% H.sub.2SO.sub.4 (conc.) in 95% EtOH) or ninhydrin (0.3% ninhydrin (w/v), 97:3 EtOH-AcOH) stains. Flash column chromatography was performed using silica gel (F60, 40-63 um, 60A). Preparative thin layer chromotography (PTLC) was carried out using glass backed PTLC plates 1000-2000 m thickness (Analtech). The solvent compositions reported for all chromatographic separations are on a volume/volume (v/v) basis. .sup.1H-NMR spectra were recorded at either 400, 500 or 600 MHz and are reported in parts per million (ppm) on the 6 scale relative to CDCl.sub.3 ( 7.26) as an internal standard. Data are reported as follows: chemical shift, multiplicity (s=singlet, d=doublet, t=triplet, q=quartet, br=broad, m=multiplet), coupling constants (Hz), and integration. .sup.13C-NMR spectra were recorded at either 100 or 125 MHz and are reported in parts per million (ppm) on the scale relative to CDCl.sub.3 ( 77.00). Mass spectrometry data were collected on a HP1100 single-quadrupole instrument (ESI; low resolution) or an Agilent ESI-TOF instrument (HRMS).

    Synthesis of 3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanoic Acid (30-3)

    [0250] ##STR00031##

    ##STR00032##

    [0251] Ethyl 4-oxooct-7-ynoate (30-1) was synthesized following similar procedures previously reported. A solution of crude pent-4-ynal (17.2 g, 210 mmol) and ethyl acrylate (45.5 mL, 420 mmol, 2 equiv) in dioxane (250 mL) was added dropwise over a period of 4 h to a suspension of thiazolium salt catalyst (7.88 g, 29.2 mmol, 0.14 equiv), triethylamine (20.4 mL, 147 mmol, 0.7 equiv) and ethyl acrylate (45.5 mL) in dioxane (300 mL) at 80 C. under an atmosphere of nitrogen. The mixture was stirred and heated at 80 C. for 54 h and then volatiles removed by rotary evaporation. The residue was resuspended in methylene chloride (600 mL) and washed with aqueous 10% H.sub.2SO.sub.4 (150 mL), saturated aqueous NaHCO.sub.3 (250 mL) and brine (250 mL), then dried over anhydrous Na.sub.2SO.sub.4 and volatiles removed by rotary evaporation. Crude 30-1 was purified by flash column chromatography (100% hexanes.fwdarw.5%.fwdarw.10%.fwdarw.15%.fwdarw.20% ethyl acetate in hexanes), resulting in 30-1 as a light brown oil (10.7 g, 28%). .sup.1H NMR (400 MHz, CDCl.sub.3) 4.20 (q, J=7.1, 2H), 2.86-2.76 (m, 4H), 2.68 (t, J=6.5, 2H), 2.54 (td, J=2.6, 7.3, 2H), 2.04 (t, J=2.7, 1H), 1.33 (td, J=2.2, 7.2, 4H). MS (ESI) calc'd for [M+H]+C.sub.10H.sub.15O.sub.3.sup.+ 183.1, found 183.1.

    ##STR00033##

    4-Oxooct-7-ynoic Acid (30-2)

    [0252] To a solution of 30-1 (9.46 g, 52 mmol) in methanol (400 mL), added LiOH (6.2 g, 260 mmol, 5 equiv) and water (4.8 mL, 267 mmol, 5.1 equiv) and let resulting solution stir at room temperature for 15 h when TLC (3:1 hexanes/ethyl acetate) indicated the complete consumption of starting material. The solution was carefully acidified with aqueous HCl (6 M) until a pH of 3 was achieved. The resulting solution was then extracted with methylene chloride and the combined organic layers were dried over anhydrous Na.sub.2SO.sub.4 and volatiles were removed by rotary evaporation, resulting in 30-2 as a brown solid (7.6 g, 95%), which was used without further purification. .sup.1H NMR (400 MHz, CDCl.sub.3) 2.90-2.57 (m, 6H), 2.48 (td, J=2.5, 7.3, 2H), 1.98 (t, J=2.5, 1H). MS (ESI) calc'd for [MH]C.sub.8H.sub.9O.sub.3.sup. 153.0, found 153.0.

    ##STR00034##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)propanoic Acid (30-3)

    [0253] A dried round bottom flask containing 30-2 (3.1 g, 20 mmol) cooled to 0 C. was charged with 7N NH.sub.3 in methanol (195 mL) and resulting solution was stirred at 0 C. under an atmosphere of nitrogen for 3 h. At this time, a solution of hydroxylamine-O-sulfonic acid (3.2 g, 28.2 mmol, 1.4 equiv) in anhydrous methanol (25 mL) was added dropwise via addition funnel at 0 C. The resulting solution was stirred at 0 C. for an additional 1 h and then allowed to warm to room temperature over 14 h. Resulting suspension was evaporated to dryness and resuspended in methanol (30 mL) and solid was filtered and washed several times with methanol. The combined filtrate was evaporated and resuspended in anhydrous methanol (180 mL), then cooled to 0 C. (protected from light). Diisopropylethylamine (7.8 mL) was added, followed by iodine (portion-wise), until a dark brown color persisted for more than 30 min, indicating total oxidation of diaziridine. The solution was then diluted with ethyl acetate (200 mL) and washed with aq. 1N HCl (200 mL), saturated aqueous Na.sub.2S.sub.2O.sub.3 (3200 mL or until organic phase clarified) and brine. Combined aqueous phases were washed once with ethyl acetate and all organic layers were combined, then dried over anhydrous Na.sub.2SO.sub.4 and volatiles removed by rotary evaporation. Crude 30-3 was purified by flash column chromatography (100% hexanes.fwdarw.2%.fwdarw.5%.fwdarw.10%.fwdarw.20% ethyl acetate in hexanes), resulting in 30-3 as a colorless oil (889 mg, 27%). .sup.1H NMR (400 MHz, CDCl.sub.3) 2.18 (t, J=7.7, 2H), 2.06-1.98 (m, 3H), 1.81 (t, J=7.7, 2H), 1.66 (t, J=7.4, 2H). .sup.13C NMR (101 MHz, CDCl.sub.3) 178.63, 82.56, 69.37, 32.16, 28.21, 27.72, 27.46, 13.21. MS (ESI) calc'd for [MH]C.sub.8H.sub.9N.sub.2O.sub.2.sup. 165.1, found 165.1. Characterization matches that previously reported by Li et al Angew Chem Int Ed. (2013) 52, 8551-6.

    ##STR00035##

    [0254] General Procedure 1: Coupling Procedure for the Synthesis of Simple Fragment-Based Probes

    [0255] To a 4 mL vial containing 3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanoic acid (30-3, 1 eq.) in DCM, commercially available amine (1.1 eq.), DIPEA (3.0 eq.) EDC-HCl (1.5 eq.), and HOBt (1.5 eq.) were added. Reaction mixtures were stirred at room temperature for 4 h to overnight when TLC indicated reaction completed. The crude samples were diluted with DCM and washed first with saturated aqueous NH.sub.4Cl (10 mL) and saturated aqueous NaHCO.sub.3 (10 mL), then dried over anhydrous Na.sub.2SO.sub.4 and volatiles removed by rotary evaporation. Crude products were purified by PTLC or flash column chromatography.

    [0256] General Procedure 2: Coupling Procedure for the Synthesis of Photoaffinity Probe Library Used in Phenotypic Screening

    [0257] A 4 mL vial was charged with 3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanoic acid (10 mg, 0.060 mmol) or propionic acid (0.060 mmol), commercially available amine (0.060 mmol, 1 eq.), DIPEA (0.032 mL, 0.181 mmol, 3.0 eq.), HATU (34.3 mg, 0.090 mmol, 1.5 eq.) and DMF (1 mL). Reaction mixtures were stirred at room temperature for 4 h. The crude samples were diluted with methanol to a total volume of 1.6 mL then purified by reverse phase HPLC using following conditions:

    TABLE-US-00006 LC/MS conditions for Library Characterization Column Xbridge Prep C18 19 150 mm, 10 m Flow Rate 15 ml/min Mobile Phase A 10 mM ammonium acetate in water Mobile Phase B Acetonitrile Gradient 10% B to 100% B over 20 min followed by a 3 min wash at 100% B and 2 min equilibration at 10% B.

    ##STR00036##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-methylpropanamide (1)

    [0258] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 7:3.fwdarw.1:1) to afford 1 as a colorless sticky solid (6 mg, 93%). .sup.1H NMR (400 MHz, CDCl.sub.3) 5.56 (brs, 1H), 2.82 (d, J=2.2 Hz, 2H), 2.08-1.98 (m, 3H), 1.94 (m, 2H), 1.90-1.83 (m, 2H), 1.66 (t, J=7.4 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 172.12, 83.09, 69.57, 32.79, 30.58, 28.83, 28.25, 26.80, 13.68. HRMS (ESI-TOF) calcd for C.sub.9H.sub.14N.sub.3O 180.1131 (M+H.sup.+), found 180.1131.

    ##STR00037##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-(2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)propanamide (2)

    [0259] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 2 as a white sticky solid (22 mg, 76%). .sup.1H NMR (400 MHz, CDCl.sub.3) 9.18 (s, 1H), 7.56-7.30 (m, 8H), 7.22-7.10 (m, 2H), 5.53 (d, J=7.9 Hz, 1H), 2.29-2.13 (m, 2H), 2.07-1.97 (m, 3H), 1.87 (t, J=7.4 Hz, 2H), 1.68 (t, J=7.4 Hz, 2H). .sup.13C NMR (101 MHz, CDCl.sub.3) 171.34, 168.74, 138.54, 137.36, 132.21, 131.45, 130.69, 129.87, 128.25, 127.61, 124.18, 121.46, 82.76, 69.26, 67.13, 32.30, 30.37, 28.30, 27.87, 13.33. HRMS (ESI-TOF) calcd for C.sub.23H.sub.22N.sub.5O.sub.2 400.1768 (M+H.sup.+), found 400.1768.

    ##STR00038##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-(2-oxo-2H-chromen-6-yl)propanamide (3)

    [0260] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:2) to afford 3 as a yellow sticky solid (12.8 mg, 57%). .sup.1H NMR (400 MHz, CDCl.sub.3) 8.01 (d, J=2.2 Hz, 1H), 7.69 (d, J=9.6 Hz, 1H), 7.62 (br s, 1H), 7.42 (dd, J=8.9, 2.5 Hz, 1H), 7.29 (d, 7.7 Hz, 1H), 6.44 (d, J=9.6 Hz, 1H), 2.16 (t, J=7.5 Hz, 2H), 2.04 (td, J=7.4, 2.6 Hz, 2H), 2.01-1.92 (m, 3H), 1.75 1.62 (m, 2H). .sup.13C NMR (101 MHz, CDCl.sub.3) 169.69, 160.82, 150.48, 143.49, 134.28, 123.57, 119.04, 118.58, 117.20, 82.67, 69.33, 32.44, 31.16, 28.09, 27.80, 13.29. HRMS (ESI-TOF) calcd for C.sub.17H.sub.16N.sub.3O.sub.3 310.1186 (M+H.sup.+), found 310.1186.

    ##STR00039##

    N-(Benzo[b]thiophen-5-ylmethyl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (4)

    [0261] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 4 as a off-white sticky solid (12.3 mg, 44%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.84 (d, J=8.3 Hz, 1H), 7.73 (s, 1H), 7.46 (d, J=5.4 Hz, 1H), 7.30 (d, J=5.4 Hz, 1H), 7.26 (d, J=8.0 Hz, 1H), 5.80 (br s, 1H), 4.54 (d, J=5.7 Hz, 2H), 2.03-1.95 (m, 5H), 1.91 1.86 (m, 2H), 1.64 (t, J=7.5 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 171.27, 140.32, 139.41, 134.65, 127.61, 124.71, 124.06, 123.22, 83.10, 69.62, 44.23, 32.82, 30.73, 28.75, 13.70. HRMS (ESI-TOF) calcd for C.sub.17H.sub.18N.sub.3OS 312.1165 (M+H.sup.+), found 312.1167.

    ##STR00040##

    N-(Benzofuran-5-ylmethyl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (5)

    [0262] General Procedure 1. Purified by PTLC (Hexane/EtOAc, 3:1) to afford 5 as a off-white sticky solid (10.8 mg, 76%). .sup.1H NMR (400 MHz, CDCl.sub.3) 7.63 (d, J=2.2 Hz, 1H), 7.54-7.49 (m, 1H), 7.46 (d, J=8.5 Hz, 1H), 7.21 (dd, J=8.5, 1.8 Hz, 1H), 6.74 (dd, J=2.2, 1.0 Hz, 1H), 5.75 (brs, 1H), 4.51 (d, J=5.7 Hz, 2H), 2.06-1.83 (m, 7H), 1.65 (t, J=7.4 Hz, 2H). HRMS (ESI-TOF) calcd for C.sub.17H.sub.18N.sub.3O.sub.2 296.1393 (M+H.sup.+), found 296.1392.

    ##STR00041##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-(1-methyl-2-oxo-1,2,3,4-tetrahydroquinolin-7-yl)propanamide (6)

    [0263] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 6 as a light brown sticky solid (33 mg, 56%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.43 (d, 2.4 Hz, 1H), 7.35 (brs, 1H), 7.29 (dd, J=8.7, 2.5 Hz, 1H), 6.91 (d, J=8.7 Hz, 1H), 3.33 (s, 3H), 2.99-2.89 (m, 2H), 2.76-2.65 (m, 2H), 2.19 (t, J=7.5, 6.7 Hz, 2H), 2.12 (td, J=7.4, 2.6 Hz, 2H), 2.07 (t, J=2.6 Hz, 1H), 2.02 (t, J=7.5 Hz, 2H), 1.76 (t, J=7.5 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 170.59, 169.79, 137.62, 133.17, 127.38, 120.28, 119.32, 115.38, 83.09, 69.69, 32.87, 31.99, 31.58, 29.98, 28.61, 28.23, 25.88, 13.71. HRMS (ESI-TOF) calcd for C.sub.18H.sub.21N.sub.4O.sub.2 325.1659 (M+H.sup.+), found 325.1658.

    ##STR00042##

    N-((1H-Indol-5-yl)methyl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (7)

    [0264] General Procedure 1. Purified by PTLC (Hexane/EtOAc, 3:1) to afford 7 as an off-white sticky solid (12.2 mg, 57%). .sup.1H NMR (500 MHz, CDCl.sub.3) 8.31 (brs, 1H), 7.57-7.50 (m, 1H), 7.36 (d, J=8.3 Hz, 1H), 7.22 (dd, J=3.2, 2.4 Hz, 1H), 7.11 (dd, J=8.3, 1.7 Hz, 1H), 6.53-6.51 (m, 1H), 5.71 (brs, 1H), 4.50 (d, J=5.4 Hz, 2H), 2.00 (td, J=7.4, 2.6 Hz, 2H), 1.98-1.92 (m, 3H), 1.89-1.84 (m, 2H), 1.64 (t, J=7.4 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 171.11, 135.68, 129.70, 128.47, 125.34, 122.74, 120.65, 111.79, 102.96, 83.14, 69.61, 44.83, 32.78, 30.79, 28.86, 13.70. HRMS (ESI-TOF) calcd for C.sub.17H.sub.19N.sub.4O 295.1553 (M+H.sup.+), found 295.1555.

    ##STR00043##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-1-(4-phenylpiperidin-1-yl)propan-1-one (8)

    [0265] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 8 as an off-white sticky solid (19.7 mg, 88%). .sup.1H NMR (400 MHz, CDCl.sub.3) 7.31 (t, J=7.5 Hz, 2H), 7.25-7.16 (m, 3H), 4.85-4.69 (m, 1H), 3.92-3.83 (m, 1H), 3.10 (apparent td, J=13.3, 2.7 Hz, 1H), 2.73 (apparent tt, J=12.2, 3.7 Hz, 1H), 3.62 (apparent td, J=13.3, 2.8 Hz, 1H), 2.13-2.08 (m, 2H), 2.05 (td, J=7.5, 2.7 Hz, 2H), 1.98 (t, J=2.6 Hz, 1H), 1.92-1.84 (m, 2H), 1.69 (t, J=7.5 Hz, 2H) (rotomeric isomers present). .sup.13C NMR (101 MHz, CDCl.sub.3) 169.33, 145.08, 128.59, 126.70, 126.54, 82.80, 69.12, 46.09, 42.75, 42.55, 33.81, 32.80, 32.57, 28.08, 26.99, 13.34. HRMS (ESI-TOF) calcd for C.sub.19H.sub.23N.sub.3O 310.1914 (M+H.sup.+), found 310.1916.

    ##STR00044##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-(4-(piperidin-4-yl)phenyl)propanamide (9)

    [0266] Followed General Procedure 1 for amide bond coupling. Crude 9 was then re-dissolved in DCM (1 mL) and TFA (0.3 mL) was carefully added. The resulting mixture was evaporated and crude 9 was purified by PTLC (DCM/MeOH, 6:1) yielding 9 as a white solid (22 mg, 67%, 2 steps). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.44 (d, J=8.1 Hz, 2H), 7.18 (d, J=8.2 Hz, 2H), 7.13 (s, 1H), 3.45 (d, J=12.7 Hz, 2H), 3.00-2.89 (m, 2H), 2.76-2.65 (m, 3H), 2.12 (t, J=7.5 Hz, 2H), 2.04 (td, J=7.5, 2.6 Hz, 2H), 2.02-1.91 (m, 3H), 1.68 (t, J=7.4 Hz, 2H). HRMS (ESI-TOF) calcd for C.sub.19H.sub.25N.sub.4O 325.2023 (M+H.sup.+), found 325.2023.

    ##STR00045##

    N-([1,1-Biphenyl]-4-ylmethyl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (10)

    [0267] General Procedure 1. Purified by PTLC (Hexane/EtOAc, 4:1) to afford 10 as a white sticky solid (18.5 mg, 78%). .sup.1H NMR (400 MHz, CDCl.sub.3) 7.61-7.52 (m, 4H), 7.44 (t, J=7.5 Hz, 2H), 7.38-7.33 (m, 4H), 5.77 (br s, 1H), 4.47 (d, J=5.7 Hz, 2H), 2.09-1.94 (m, 5H), 1.94-1.85 (m, 2H), 1.66 (t, J=7.4 Hz, 2H). .sup.13C NMR (101 MHz, CDCl.sub.3) 170.92, 140.63, 137.05, 128.80, 128.32, 127.48, 127.39, 127.06, 82.70, 69.22, 43.47, 32.42, 30.32, 28.34, 27.86, 13.31. HRMS (ESI-TOF) calcd for C.sub.21H.sub.22N.sub.3O 332.1757 (M+H.sup.+), found 332.1755.

    ##STR00046##

    1-(4-Benzhydrylpiperazin-1-yl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propan-1-one (11)

    [0268] General Procedure 1. Purified by PTLC (DCM/MeOH, 20:1) to afford 11 as an off-white sticky residue (12 mg, 75%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.43-7.38 (m, 4H), 7.31-7.24 (m, 4H), 7.22-7.16 (m, 2H), 4.23 (s, 1H), 3.66-3.54 (m, 2H), 3.48-3.34 (m, 2H), 2.36 (apparent t, J=5.0 Hz, 4H), 2.06-1.98 (m, 4H), 1.96 (t, J=2.7 Hz, 1H), 1.85-1.80 (m, 2H), 1.65 (t, J=7.4 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 169.84, 142.47, 129.01, 128.25, 127.58, 69.52, 52.34, 51.93, 45.96, 42.33, 32.93, 28.41, 27.22, 13.71. HRMS (ESI-TOF) calcd for C.sub.25H.sub.29N.sub.4O 401.2336 (M+H.sup.+), found 401.2335.

    ##STR00047##

    3-(3-(But-3-yn-1-yl)-3H-diazirin-3-yl)-N-(4-((4-methylpiperazin-1-yl)methyl)phenyl)propanamide (12)

    [0269] General Procedure 1. Purified by PTLC (DCM/MeOH, 9:1) to afford 12 as an off-white sticky solid (16 mg, 76%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.51 (s, 1H), 7.45 (d, J=8.1 Hz, 2H), 7.25 (d, J=8.3 Hz, 2H), 3.47 (s, 2H), 2.36 (s, 3H), 2.12 (t, J=7.5 Hz, 2H), 2.02 (td, J=7.4, 2.7 Hz, 2H), 1.98 (t, J=2.6 Hz, 1H), 1.92 (t, J=7.5 Hz, 2H), 1.67 (t, J=7.4 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 169.83, 137.24, 130.20, 120.29, 83.11, 62.59, 55.21, 52.68, 45.93, 32.84, 31.64, 28.63, 28.26, 13.71. HRMS (ESI-TOF) calcd for C.sub.20H.sub.28N.sub.5O 354.2288 (M+H.sup.+), found 354.2289.

    ##STR00048##

    1-(2-Benzylpiperidin-1-yl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propan-1-one (13)

    [0270] .sup.1H NMR (500 MHz, CDCl.sub.3) General Procedure 1. Purified by PTLC (Hexane/EtOAc, 1:1) to afford 13 as an off-white sticky solid (9 mg, 77%). 7.35-7.15 (m, 3H), 7.11 (apparent d, J=7.4 Hz, 2H), 5.14-4.95 (m, 0.5H), 4.68-4.57 (m, 0.5H), 4.13-3.97 (m, 0.5H), 3.63-3.50 (m, 0.5H), 3.21-3.02 (m, 1H), 2.89-2.69 (m, 2H), 2.09-1.87 (m, 4H), 1.83-1.24 (m, 11H). .sup.13C NMR (126 MHz, CDCl.sub.3) 169.99, 139.08, 139.01, 129.61, 129.46, 129.19, 128.73, 127.17, 126.63, 83.19, 69.49, 69.42, 55.55, 50.01, 41.70, 37.16, 37.04, 36.10, 32.88, 32.70, 29.92, 28.49, 28.46, 28.18, 27.78, 26.86, 26.47, 26.45, 25.89, 19.67, 19.27, 13.72, 13.70. Note: rotomeric isomers observed. HRMS (ESI-TOF) calcd for C.sub.20H.sub.26N.sub.3O 324.2070 (M+H.sup.+), found 324.2068.

    ##STR00049##

    N-((3s,5s,7s)-Adamantan-1-yl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (14)

    [0271] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 10:1.fwdarw.6:1.fwdarw.3:1) to afford 14 as a colorless sticky solid (14.7 mg, 68%). .sup.1H NMR (500 MHz, CDCl.sub.3) 5.08 (brs, 1H), 2.15 (m, 3H), 2.04-1.95 (m, 9H), 1.88-1.75 (m, 4H), 1.72-1.59 (m, 8H). .sup.13C NMR (126 MHz, CDCl.sub.3) 170.46, 83.17, 69.52, 52.41, 42.02, 36.74, 32.89, 31.69, 29.86, 29.84, 28.73, 13.71. HRMS (ESI-TOF) calcd for C.sub.28H.sub.26N.sub.3O 300.2070 (M+H.sup.+), found 300.2067.

    ##STR00050##

    N-(2-(Benzo[d][1,3]dioxol-5-yl)ethyl)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamide (15)

    [0272] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 15 as a white solid (20.2 mg, 71%). .sup.1H NMR (500 MHz, CDCl.sub.3) 6.74 (d, J=7.9 Hz, 1H), 6.67 (d, J=1.7 Hz, 1H), 6.62 (dd, J=7.9, 1.7 Hz, 1H), 5.93 (s, 2H), 5.43 (d, J=7.4 Hz, 1H), 3.45 (td, J=6.9, 5.8 Hz, 2H), 2.72 (t, J=6.9 Hz, 2H), 2.01 (td, J=7.4, 2.7 Hz, 2H), 1.96 (t, J=2.6 Hz, 1H), 1.90 1.78 (m, 4H), 1.62 (t, J=7.4 Hz, 2H). .sup.13C NMR (126 MHz, CDCl.sub.3) 171.37, 148.27, 146.65, 132.85, 122.01, 109.43, 108.79, 101.34, 83.10, 69.59, 41.21, 35.71, 32.81, 30.74, 28.72, 13.69. HRMS (ESI-TOF) calcd for C.sub.17H.sub.20N.sub.3O.sub.3 314.1499 (M+H.sup.+), found 314.1500.

    ##STR00051##

    (S)-2-(3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)propanamido)-4-methyl-N-(naphthalen-2-yl)pentanamide (25)

    [0273] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:1) to afford 25 as a white solid (27 mg, 53%). .sup.1H NMR (500 MHz, CDCl.sub.3) 9.39 (s, 1H), 8.20 (d, J=2.2 Hz, 1H), 7.70-7.63 (m, 1H), 7.63-7.54 (m, 2H), 7.41 (dd, J=8.8, 2.1 Hz, 1H), 7.37-7.30 (m, 2H), 6.94 (d, J=7.9 Hz, 1H), 4.80 (td, J=8.3, 5.6 Hz, 1H), 2.09-1.94 (m, 2H), 1.93 (t, J=2.6 Hz, 1H), 1.91-1.70 (m, 7H), 1.51 (t, J=7.4 Hz, 2H), 1.00 (dd, J=12.9, 6.1 Hz, 6H). .sup.13C NMR (125 MHz, CDCl.sub.3) 172.64, 171.84, 135.71, 134.08, 131.04, 129.03, 128.02, 126.74, 125.37, 120.43, 117.39, 83.02, 69.65, 53.48, 41.31, 32.56, 30.42, 28.65, 28.13, 25.35, 23.40, 22.59, 13.59. HRMS (ESI-TOF) calcd for C.sub.24H.sub.29N.sub.4O.sub.2 405.2285 (M+H.sup.+), found 405.2285.

    ##STR00052##

    (S)-3-(3-(but-3-yn-1-yl)-3H-diazirin-3-yl)-N-(1-((4-methoxynaphthalen-2-yl)amino)-1-oxopropan-2-yl)propanamide (26)

    [0274] General Procedure 1. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 9:1.fwdarw.4:1.fwdarw.2:1) to afford 26 as a white solid (147 mg, 73%). .sup.1H NMR (500 MHz, CDCl.sub.3) 8.86 (s, 1H), 8.29-8.14 (m, 1H), 7.79-7.63 (m, 2H), 7.50 (ddd, J=8.2, 6.7, 1.4 Hz, 1H), 7.44 (ddd, J=8.2, 6.8, 1.3 Hz, 1H), 7.17 (d, J=1.8 Hz, 1H), 6.39 (d, J=7.5 Hz, 1H), 4.83 (p, J=7.1 Hz, 1H), 4.02 (s, 3H), 2.21-2.03 (m, 5H), 2.02-1.93 (m, 2H), 1.71 (t, J=7.2 Hz, 2H), 1.61 (d, J=7.0 Hz, 3H). .sup.13C NMR (125 MHz, CDCl.sub.3) 172.31, 171.22, 156.39, 136.00, 134.77, 127.54, 124.74, 123.51, 122.22, 109.59, 99.18, 82.97, 69.77, 55.92, 50.34, 32.66, 30.70, 28.76, 28.18, 18.39, 13.62. HRMS (ESI-TOF) calcd for C.sub.22H.sub.25N.sub.4O.sub.3 393.1921 (M+H.sup.+), found 393.1923.

    General Procedure 3:

    [0275] ##STR00053##

    [0276] To a solution of N-butanoyl-L-leucine (Effenberger et al., 2015) (1 equiv) in DCM (0.06M relative to acid), added commercially available amine (1.1 equiv), DIPEA (2.2 equiv) EDC-HCl (1.2 equiv) and HOBt (1.2 equiv) were added. Reaction mixtures were stirred at room temperature for 4 h to overnight when TLC indicated reaction completed. The crude samples were diluted with DCM and washed first with saturated aqueous NH.sub.4Cl and saturated aqueous NaHCO.sub.3, then dried over anhydrous Na.sub.2SO.sub.4 and volatiles removed by rotary evaporation. Crude products were purified by PTLC or flash column chromatography.

    ##STR00054##

    (S)-2-butyramido-4-methyl-N-((S)-1, 2, 3, 4-tetrahydronaphthalen-1-yl)pentanamide (29)

    [0277] General Procedure 3. Purified by PTLC (Hexane/EtOAc, 1:1) to afford 29 as an off-white solid (24 mg, 73%). .sup.1H NMR (400 MHz, CDCl.sub.3) 7.23-7.04 (m, 4H), 6.39 (d, J=8.8 Hz, 1H), 5.99 (d, J=8.3 Hz, 1H), 5.16-5.08 (m, 1H), 4.44 (td, J=8.4, 5.4 Hz, 1H), 2.77 (qd, J=16.9, 8.7 Hz, 2H), 2.16 (td, J=7.3, 1.4 Hz, 2H), 2.08-1.93 (m, 1H), 1.91-1.39 (m, 8H), 1.03-0.81 (m, 9H). .sup.13C NMR (125 MHz, CDCl.sub.3) 173.37, 171.79, 137.83, 136.59, 129.52, 128.83, 127.71, 126.68, 52.03, 48.02, 41.91, 38.87, 30.49, 29.59, 25.28, 23.27, 22.76, 20.46, 19.48, 14.09. HRMS (ESI-TOF) calcd for C.sub.20H.sub.31N.sub.2O.sub.2 331.2380 (M+H.sup.+), found 331.2383.

    ##STR00055##

    (S)N-(2-(benzo[d][1,3]dioxol-5-yl)ethyl)-2-butyramido-4-methylpentanamide (30)

    [0278] General Procedure 3. Purified by SiO.sub.2 flash chromatography (Hexane/EtOAc, 3:2) to afford 30 as a white solid (181 mg, 75%). .sup.1H NMR (500 MHz, CDCl.sub.3) 6.73 (d, J=7.9 Hz, 1H), 6.69-6.64 (m, 1H), 6.62 (dd, J=7.9, 1.7 Hz, 1H), 6.45-6.34 (m, 1H), 6.06 (t, J=7.9 Hz, 1H), 5.92 (s, 2H), 4.39 (td, J=8.3, 6.1 Hz, 1H), 3.49 (dq, J=13.5, 6.9 Hz, 1H), 3.38 (dq, J=13.3, 6.8 Hz, 1H), 2.71 (t, J=7.1 Hz, 2H), 2.15 (t, J=7.5 Hz, 2H), 1.70-1.41 (m, 5H), 0.97-0.85 (m, 9H). .sup.13C NMR (125 MHz, CDCl.sub.3) 173.43, 172.46, 148.18, 146.60, 132.80, 122.02, 109.46, 108.72, 101.29, 51.89, 41.55, 41.20, 38.82, 35.70, 25.18, 23.17, 22.69, 19.44, 14.08. HRMS (ESI-TOF) calcd for C.sub.19H.sub.29N.sub.2O.sub.4 349.2122 (M+H.sup.+), found 349.2124.

    General Procedure 4:

    [0279] ##STR00056##

    [0280] To commercially available amine (1.0 equiv) in DCM (0.1 M), added DIPEA (1.1 equiv) followed by the slow addition of butanoyl chloride (1.0 equiv). Resulting mixture was allowed to stir at room temperature until amine was fully consumed, as indicated by TLC. The crude mixture was diluted with DCM, washed first with saturated aqueous NH.sub.4Cl and saturated aqueous NaHCO.sub.3, then dried over anhydrous Na.sub.2SO.sub.4 and volatiles removed by rotary evaporation. Crude products were purified by PTLC.

    ##STR00057##

    (S)-2-butyramido-4-methyl-N-(naphthalen-2-yl)pentanamide (27)

    [0281] General Procedure 4. Purified by PTLC (DCM/MeOH, 20:1) to afford 27 as a white solid (15 mg, 58%). .sup.1H NMR (400 MHz, CDCl.sub.3) 9.41 (s, 1H), 8.26-8.09 (m, 1H), 7.69-7.54 (m, 3H), 7.42 (dd, J=8.8, 2.1 Hz, 1H), 7.38-7.29 (m, J=7.1, 3.5 Hz, 2H), 6.62 (d, J=8.0 Hz, 1H), 4.83 (td, J=8.3, 5.9 Hz, 1H), 2.22 (apparent td, J=7.3, 2.9 Hz, 2H), 1.92-1.57 (m, 5H), 0.99 (dd, J=12.4, 6.1 Hz, 6H), 0.90 (t, J=7.4 Hz, 3H). .sup.13C NMR (125 MHz, CDCl.sub.3) 174.40, 171.36, 135.78, 134.13, 131.00, 128.96, 128.00, 127.85, 126.69, 125.26, 120.40, 117.15, 53.08, 40.96, 38.78, 25.33, 23.34, 22.67, 19.53, 14.04. HRMS (ESI-TOF) calcd for C.sub.20H.sub.26N.sub.2O.sub.2 327.2067 (M+H.sup.+), found 327.2069.

    ##STR00058##

    (S)N-(1-((4-methoxynaphthalen-2-yl)amino)-1-oxopropan-2-yl)butyramide (28)

    [0282] General Procedure 4. Purified by PTLC (DCM/MeOH, 9:1) to afford 28 as a colorless solid (22.7 mg, 68%). .sup.1H NMR (500 MHz, CDCl.sub.3) 9.36 (s, 1H), 8.12 (dd, J=8.2, 1.4 Hz, 1H), 7.69-7.64 (m, 1H), 7.62 (d, J=8.1 Hz, 1H), 7.40 (ddd, J=8.2, 6.7, 1.4 Hz, 1H), 7.34 (ddd, J=8.2, 6.8, 1.3 Hz, 1H), 7.10 (d, J=1.8 Hz, 1H), 6.56 (d, J=7.5 Hz, 1H), 4.91 (p, J=7.1 Hz, 1H), 3.91 (s, 3H), 2.27 (apparent td, J=7.4, 3.1 Hz, 2H), 1.78-1.68 (m, 2H), 1.55 (d, J=6.9 Hz, 3H), 0.96 (t, J=7.4 Hz, 3H). .sup.13C NMR (125 MHz, CDCl.sub.3) 173.23, 170.49, 155.47, 135.40, 133.97, 126.67, 123.75, 122.56, 121.34, 108.54, 98.25, 55.04, 49.29, 38.06, 18.74, 17.78, 13.23. HRMS (ESI-TOF) calcd for C.sub.18H.sub.23N.sub.2O.sub.3 315.1703 (M+H.sup.+), found 315.1703.

    ##STR00059##

    1-(4-phenylpiperidin-1-yl)butan-1-one (49)

    [0283] General Procedure 4. Purified by SiO.sub.2 flash chromatography (Hexanes/EtOAc, 10:1.fwdarw.3:1) to afford 49 as a white solid (110 mg, 77%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.31 (t, J=7.6 Hz, 2H), 7.24-7.16 (m, 3H), 4.81 (ddd, J=13.5, 4.2, 2.2 Hz, 1H), 3.99 (ddt, J=13.8, 4.2, 2.2 Hz, 1H), 3.12 (td, J=13.1, 2.6 Hz, 1H), 2.73 (tt, J=12.2, 3.7 Hz, 1H), 2.68-2.56 (m, 1H), 2.44-2.25 (m, 2H), 2.00-1.83 (m, 2H), 1.75-1.52 (m, 4H), 0.99 (t, J=7.4 Hz, 3H). HRMS (ESI-TOF) calcd for C.sub.13H.sub.14NO.sub.3 232.0968 [M+H.sup.+], found 232.0967.

    ##STR00060##

    N-(2-oxo-2H-chromen-6-yl)butyramide (50)

    [0284] General Procedure 4. Purified by SiO.sub.2 flash chromatography (Hexanes/EtOAc, 10:1.fwdarw.3:1) to afford 50 as a light yellow solid (116 mg, 81%). NMR (400 MHz, CDCl.sub.3) 8.07 (d, J=2.5 Hz, 1H), 7.69 (d, J=9.5 Hz, 1H), 7.52 (brs, 1H), 7.42 (dd, J=8.9, 2.6 Hz, 1H), 7.28 (d, J=2.4 Hz, 1H), 6.44 (d, J=9.6 Hz, 1H), 2.39 (t, J=7.4 Hz, 2H), 1.79 (h, J=7.4 Hz, 2H), 1.03 (t, J=7.4 Hz, 3H). HRMS (ESI-TOF) calcd for C.sub.15H.sub.22NO 232.1696 [M+H.sup.+], found 232.1696.

    ##STR00061##

    1-(4-(2-Methoxyphenyl)piperazin-1-yl)-2-phenylethan-1-one (22)

    [0285] To a mixture of 1-(2-methoxyphenyl)piperazine (30 mg, 0.156 mmol) in anhydrous CH.sub.2Cl.sub.2 (1.5 mL) and pyridine (0.5 mL) was added phenylacetylchloride (23 mg, 0.172 mmol, 1.1 equiv). The reaction mixture was stirred at room temperature for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 2/1) providing the title compound 22 as a colorless oil (46 mg, 96%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.33 (t, J=7.5 Hz, 2H), 7.29-7.22 (m, 3H), 7.02 (td, J=7.7, 1.5 Hz, 1H), 6.93-6.81 (m, 3H), 3.85-3.83 (m, 5H), 3.79 (s, 2H), 3.64-3.59 (m, 2H), 3.00 (t, J=5.1 Hz, 2H), 2.85 (t, J=5.0 Hz, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 40.66, 41.58, 46.00, 50.02, 50.37, 54.99, 110.86, 117.95, 120.58, 123.08, 126.39, 128.16, 128.33, 134.67, 140.20, 151.78, 169.08. HRMS (ESI-TOF) calcd for C.sub.19H.sub.23N.sub.2O.sub.2 311.1754 [M+H.sup.+], found 311.1753.

    ##STR00062##

    1-(Benzylsulfonyl)-4-(2-methoxyphenyl)piperidine (23)

    [0286] To a mixture of 4-(2-methoxyphenyl)piperidine (50 mg, 0.26 mmol) and N,N-diisopropylethylamine (DIPEA, 0.100 mL, 0.58 mmol) in anhydrous THF (3.0 mL) was added benzylsulfonyl chloride (55 mg, 0.28 mmol, 1.1 equiv.) under N.sub.2. The reaction mixture was stirred at 50 C. for 12 h. The reaction mixture was poured into a separatory funnel with brine (10 mL) and extracted with EtOAc (210 mL). The combined organic layers were then dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure. The remaining residue was purified by SiO.sub.2 flash chromatography (Hexanes/EtOAc, 5/1) providing the title compound 23 as a slightly beige powder (50 mg, 56%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.46-7.35 (m, 5H), 7.19 (ddd, J=8.3, 7.4, 1.7 Hz, 1H), 7.10 (dd, J=7.6, 1.7 Hz, 1H), 6.93 (td, J=7.5, 1.1 Hz, 1H), 6.85 (dd, J=8.2, 1.1 Hz, 1H), 4.24 (s, 2H), 3.83-3.75 (m, 5H), 2.96 (tt, J=12.1, 3.5 Hz, 1H), 2.72 (td, J=12.4, 2.5 Hz, 2H), 1.80-1.73 (m, 2H), 1.64 (qd, J=12.6, 4.2 Hz, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 169.48, 152.18, 140.60, 135.07, 128.73, 128.56, 126.79, 123.48, 120.98, 118.35, 111.26, 55.39, 50.77, 50.42, 46.40, 41.98, 41.06. HRMS (ESI-TOF) calcd for C.sub.19H.sub.24NO.sub.3S 346.1471 (M+H.sup.+), found 346.1472.

    ##STR00063##

    N-(2-(4-(2-methoxyphenyl)piperidin-1-yl)-2-oxoethyl)acetamide (51)

    [0287] 4-(2-methoxyphenyl)piperidine (50 mg, 0.26 mmol), acetylglycine (46 mg, 0.39 mmol, 1.5 equiv.) and N,N-diisopropylethylamine (DIPEA, 0.137 mL, 0.58 mmol, 3.0 equiv.) in anhydrous DMF (1.0 mL) were added EDC (75 mg, 0.39 mmol, 1.5 equiv.) and HOAt (53 mg, 0.39 mmol, 1.5 equiv.). The reaction mixture was stirred at room temperature for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (CH.sub.2Cl.sub.2/MeOH, 9/1) providing the title compound 51 as a colorless oil (40 mg, 53%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.21 (ddd, J=8.2, 7.4, 1.7 Hz, 1H), 7.10 (dd, J=7.6, 1.8 Hz, 1H), 6.93 (td, J=7.5, 1.1 Hz, 1H), 6.87 (dd, J=8.2, 1.1 Hz, 1H), 6.67 (brs, 1H), 4.77-4.71 (m, 1H), 4.16-4.09 (m, 1H), 4.05 (dd, J=17.3, 3.8 Hz, 1H), 3.83-3.81 (m, 4H), 3.24-3.12 (m, 2H), 2.75 (td, J=12.9, 2.8 Hz, 1H), 2.05 (s, 3H), 1.94-1.85 (m, 2H), 1.68-1.52 (m, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 23.07, 31.26, 32.12, 35.43, 41.40, 43.13, 45.30, 55.28, 110.42, 120.70, 126.38, 127.40, 132.74, 156.66, 166.03, 170.09. HRMS (ESI-TOF) calcd for C.sub.16H.sub.23N.sub.2O.sub.3 291.1703 (M+H.sup.+), found 291.1704.

    ##STR00064##

    1-(4-(2-Methoxyphenyl)piperidin-1-yl)-2-(piperidin-1-yl)ethan-1-one (52)

    [0288] To a mixture of 4-(2-methoxyphenyl)piperidine (350 mg, 1.83 mmol) and triethylamine (0.643 mL, 4.57 mmol, 2.5 equiv.) in anhydrous CH.sub.2Cl.sub.2 (3.5 mL) was slowly added chloroacetyl chloride (0.175 mL, 2.20 mmol, 1.2 equiv.) under N.sub.2 at 0 C. The reaction mixture was stirred at room temperature for 1 h and diluted with EtOAc (10 mL). The mixture was washed with 1N aqueous HCl (110 mL) and brine. The organic layer was then dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure to afford a crude compound as a dark brown oil which was used to next reaction without further purification.

    [0289] To a mixture of the oil (100 mg, 0.37 mmol) and triethylamine (0.156 mL, 1.12 mmol, 3.0 equiv.) in CH.sub.3CN (1 mL) was added piperidine (0.110 mL, 1.12 mmol, 3.0 equiv.) under N.sub.2. The reaction mixture was stirred at room temperature for 1 h and then quenched with H.sub.2O (1 mL). The product was extracted with EtOAc (210 mL). The combined organic layers were then dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure. The remaining residue was purified by SiO.sub.2 flash chromatography (Hexanes/EtOAc, 3/1, 3% Et.sub.3N) providing the title compound 52 as a pale yellow oil (84 mg, 71% in 2 steps). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.20 (ddd, J=8.2, 7.4, 1.7 Hz, 1H), 7.12 (dd, J=7.6, 1.7 Hz, 1H), 6.93 (td, J=7.5, 1.2 Hz, 1H), 6.87 (dd, J=8.2, 1.1 Hz, 1H), 4.77-4.70 (m, 1H), 4.32-4.25 (m, 1H), 3.83 (s, 3H), 3.25 (d, J=13.3 Hz, 1H), 3.22-3.14 (m, 1H), 3.12-3.04 (m, 3H), 2.65 (td, J=12.9, 2.7 Hz, 1H), 2.47-2.41 (m, 4H), 1.87-1.83 (m, 1H), 1.66 (qd, J=12.6, 4.1 Hz, 1H), 1.61-1.53 (m, 5H), 1.45-1.41 (m, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 24.01, 24.04, 26.03, 31.72, 32.59, 35.61, 42.84, 46.71, 54.32, 54.42, 55.26, 62.61, 109.95, 110.38, 120.66, 126.47, 126.49, 127.15, 133.53, 156.74, 168.41. HRMS (ESI-TOF) calcd for C.sub.19H.sub.29N.sub.2O.sub.2 317.2223 (M+H.sup.+), found 317.2226.

    ##STR00065##

    1-(4-(2-Methoxyphenyl)piperidin-1-yl)-2-morpholinoethan-1-one (53)

    [0290] 4-(2-methoxyphenyl)piperidine (30 mg, 0.16 mmol), morpholin-4-ylacetic acid (27 mg, 0.19 mmol, 1.2 equiv.) and DIPEA (0.084 mL, 0.48 mmol, 3.0 equiv.) in anhydrous DMF (1.0 mL) were added EDC (45 mg, 0.23 mmol, 1.5 equiv.) and HOAt (32 mg, 0.23 mmol, 1.5 equiv.). The reaction mixture was stirred at room temperature for 2 days. H.sub.2O (1 mL) was added to the reaction mixture and product was extracted with EtOAc (21 mL). The combined organic layers were concentrated under reduced pressure. The remaining residue was purified by PTLC (EtOAc/MeOH, 5/1) providing the title compound 53 as a colorless oil (35 mg, 70%). .sup.1H NMR (400 MHz, CDCl.sub.3) 7.21 (td, J=7.8, 1.7 Hz, 1H), 7.11 (dd, J=7.6, 1.7 Hz, 1H), 6.98-6.84 (m, 2H), 4.74 (d, J=12.9 Hz, 1H), 4.18 (d, J=13.4 Hz, 1H), 3.83 (s, 3H), 3.74 (t, J=4.7 Hz, 4H), 3.28 (d, J=13.5 Hz, 1H), 3.24-3.07 (m, 3H), 2.72-2.61 (m, 1H), 2.60-2.47 (m, 4H), 1.88 (t, J=14.4 Hz, 2H), 1.69-1.59 (m, 2H). HRMS (ESI-TOF) calcd for C.sub.18H.sub.27N.sub.2O.sub.3 319.2016 (M+H.sup.+), found 319.2017.

    ##STR00066##

    1-(2-(4-(2-Methoxyphenyl)piperidin-1-yl)-2-oxoethyl)pyridin-2(1H)-one (54)

    [0291] 4-(2-methoxyphenyl)piperidine (50 mg, 0.26 mmol), (2-oxo-2H-pyridin-1-yl)-acetic acid (48 mg, 0.31 mmol, 1.2 equiv.) and triethylamine (0.054 mL, 0.39 mmol, 1.5 equiv.) in anhydrous DMF (1.0 mL) were added EDC (76 mg, 0.39 mmol, 1.5 equiv.) and HOAt (53 mg, 0.39 mmol, 1.5 equiv.). The reaction mixture was stirred at room temperature for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (EtOAc/MeOH, 6/1) providing the title compound 54 as a colorless oil (39 mg, 46%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.39-7.30 (m, 2H), 7.20 (ddd, J=8.2, 7.4, 1.7 Hz, 1H), 7.12 (dd, J=7.5, 1.7 Hz, 1H), 6.93 (td, J=7.5, 1.1 Hz, 1H), 6.87 (dd, J=8.2, 1.1 Hz, 1H), 6.58 (ddd, J=9.2, 1.4, 0.7 Hz, 1H), 6.21 (td, J=6.7, 1.4 Hz, 1H), 4.86 (d, J=15.2 Hz, 1H), 4.80-4.69 (m, 2H), 4.15-4.04 (m, 1H), 3.83 (s, 3H), 3.31-3.16 (m, 2H), 2.75 (td, J=13.0, 2.9 Hz, 1H), 1.97-1.90 (m, 1H), 1.90-1.83 (m, 1H), 1.72-1.58 (m, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 30.90, 31.84, 34.98, 42.98, 45.82, 48.40, 54.87, 105.52, 109.56, 109.96, 120.22, 120.29, 126.06, 126.91, 132.51, 138.06, 139.59, 156.27, 161.96, 164.46. HRMS (ESI-TOF) calcd for C.sub.19H.sub.23N.sub.2O.sub.3 327.1703 (M+H.sup.+), found 327.1705.

    ##STR00067##

    1-(4-(2-Methoxyphenyl)piperidin-1-yl)-2-phenylethan-1-on (55)

    [0292] To a mixture of 4-(2-methoxyphenyl)piperidine (30 mg, 0.16 mmol) and triethylamine (0.073 mL, 0.24 mmol, 1.5 equiv.) in anhydrous CH.sub.2Cl.sub.2 (1.0 mL) was added phenylacetyl chloride (26 mg, 0.17 mmol, 1.1 equiv.) under N.sub.2 at 0 C. The reaction mixture was stirred at room temperature for 1 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 2/1) providing the title compound 55 as a white solid (15 mg, 31%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.36-7.27 (m, 3H), 7.27-7.14 (m, 3H), 7.03 (dd, J=7.5, 1.7 Hz, 1H), 6.94-6.82 (m, 2H), 4.81 (d, J=13.1 Hz, 1H), 3.97 (d, J=13.4 Hz, 1H), 3.80 (s, 3H), 3.78 (s, 2H), 3.17-3.04 (m, 2H), 2.67 (td, J=12.9, 2.8 Hz, 1H), 1.83 (d, J=13.5 Hz, 1H), 1.73 (d, J=13.3 Hz, 1H), 1.59 (td, J=12.7, 4.3 Hz, 1H), 1.31 (qd, J=12.6, 4.1 Hz, 1H). HRMS (ESI-TOF) calcd for C.sub.20H.sub.24NO.sub.2 310.1801 (M+H.sup.+), found 310.1801.

    ##STR00068##

    4-(2-Methoxyphenyl)-N-phenylpiperidine-1-carboxamide (56)

    [0293] To a solution of 4-(2-methoxyphenyl)piperidine (50 mg, 0.26 mmol) in anhydrous DMF (1.0 mL) was added sodium hydride (in 60% oil, 12.5 mg, 0.31 mmol, 1.2 equiv.) under N.sub.2 at 0 C. The mixture was stirred at 0 C. for 15 min. Phenylisocyanate (37 mg, 0.31 mmol, 1.2 equiv.) in anhydrous DMF (0.5 mL) was added to the mixture. The reaction was then allowed to warm to room temperature. After stirring at room temperature for 1 h, the reaction was quenched with saturated aqueous NH.sub.4Cl and the product was extracted with EtOAc (210 mL). The combined organic layers were then dried over anhydrous Na.sub.2SO.sub.4 and concentrated under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 1/1) providing the title compound 56 as an off-white powder (71 mg, 89%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.41-7.36 (m, 2H), 7.36-7.25 (m, 2H), 7.24-7.13 (m, 2H), 7.03 (tt, J=7.4, 1.2 Hz, 1H), 6.94 (td, J=7.5, 1.1 Hz, 1H), 6.88 (dd, J=8.1, 1.1 Hz, 1H), 6.39 (brs, 1H), 4.24-4.18 (m, 2H), 3.84 (s, 3H), 3.17 (tt, J=12.1, 3.5 Hz, 1H), 3.03 (td, J=13.0, 2.6 Hz, 2H), 1.92-1.86 (m, 2H), 1.76-1.66 (m, 2H). .sup.13C NMR (151 MHz, CDCl.sub.3) 31.26, 34.92, 44.81, 54.85, 76.31, 76.81, 76.91, 76.99, 109.94, 119.33, 119.36, 120.24, 120.25, 122.45, 122.49, 126.06, 126.79, 128.40, 128.43, 154.45, 156.27. HRMS (ESI-TOF) calcd for C.sub.19H.sub.23N.sub.2O.sub.2 311.1754 (M+H.sup.+), found 311.1753.

    ##STR00069##

    2-Phenyl-1-(4-(2-(trifluoromethyl)phenyl)piperidin-1-yl)ethan-1-one (57)

    [0294] To a mixture of 4-(2-(trifluoromethyl)phenyl)piperidine hydrochloride (40 mg, 0.15 mmol) in anhydrous CH.sub.2Cl.sub.2 (1.5 mL) and pyridine (0.5 mL) was added phenylacetylchloride (26 mg, 0.17 mmol, 1.1 equiv.) under N.sub.2 at 0 C. The reaction mixture was stirred at room temperature for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 2/1) providing the title compound 57 as a colorless oil (40 mg, 77%). .sup.1H NMR (600 MHz, CDCl.sub.3) 7.61 (dd, J=7.9, 1.2 Hz, 1H), 7.51-7.45 (m, 1H), 7.38-7.22 (m, 7H), 4.88-4.81 (m, 1H), 4.02-3.96 (m, 1H), 3.84-3.75 (m, 2H), 3.15-3.04 (m, 2H), 2.65 (td, J=13.0, 2.8 Hz, 1H), 1.82 (d, J=13.3 Hz, 1H), 1.69 (d, J=13.2 Hz, 1H), 1.63 (qd, J=12.6, 4.2 Hz, 1H), 1.31 (qd, J=12.6, 4.1 Hz, 1H). .sup.13C NMR (151 MHz, CDCl.sub.3) 32.46, 33.25, 37.85, 40.91, 42.24, 46.50, 125.05, 125.42, 125.46, 125.91, 126.40, 127.37, 127.55, 128.21, 128.34, 131.65, 134.85, 143.64, 168.99. HRMS (ESI-TOF) calcd for C.sub.20H.sub.21F.sub.3NO 348.1570 (M+H.sup.+), found 348.1572.

    ##STR00070##

    1-(4-(3-Methoxyphenyl)piperidin-1-yl)-2-phenylethan-1-one (58)

    [0295] To a mixture of 4-(2-(trifluoromethyl)phenyl)piperidine hydrochloride (40 mg, 0.15 mmol) in anhydrous CH.sub.2Cl.sub.2 (1.5 mL) and pyridine (0.5 mL) was added phenylacetylchloride (26 mg, 0.17 mmol, 1.1 equiv.) under N.sub.2 at 0 C. The reaction mixture was stirred at room temperature for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 2/1) providing the title compound 58 as a colorless oil (40 mg, 44%). .sup.1H NMR (500 MHz, CDCl.sub.3) 7.37-7.28 (m, 3H), 7.28-7.17 (m, 3H), 6.78-6.69 (m, 2H), 6.67-6.65 (m, 1H), 4.81 (d, J=13.3 Hz, 1H), 3.98 (d, J=13.7 Hz, 1H), 3.83-3.73 (m, 4H), 3.10-3.01 (m, 1H), 2.70-2.59 (m, 2H), 1.87 (d, J=13.5 Hz, 1H), 1.74 (d, J=14.7 Hz, 1H), 1.65-1.56 (m, 1H), 1.38-1.23 (m, 2H). HRMS (ESI-TOF) calcd for C.sub.20H.sub.24NO.sub.2 310.1801 (M+H.sup.+), found 310.1801.

    ##STR00071##

    General Procedure 5:

    [0296] To a mixture of 1-phenylacetyl-piperazin hydrochloride (30 mg, 0.13 mmol), phenylboronic acid (2.0 equiv.) and triethylamine (0.092 mL, 0.66 mmol, 5.0 equiv.) in C1CH.sub.2CH.sub.2C1 (1.0 mL) was added Cu(OAc).sub.2 (48 mg, 0.17 mmol, 2.0 equiv.). The reaction mixture was stirred at 50 C. for 12 h before removing the solvent under reduced pressure. The remaining residue was purified by PTLC (Hexanes/EtOAc, 1/1) providing the title compound.

    ##STR00072##

    2-phenyl-1-(4-phenylpiperazin-1-yl)ethan-1-one (59)

    [0297] (10 mg, colorless oil, 27%): .sup.1H NMR (500 MHz, CDCl.sub.3) 7.36-7.30 (m, 3H), 7.30-7.21 (m, 4H), 6.92-6.85 (m, 3H), 3.84-3.77 (m, 4H), 3.63-3.57 (m, 2H), 3.17-3.11 (m, 2H), 2.99-2.95 (m, 2H). HRMS (ESI-TOF) calcd for C.sub.18H.sub.21N.sub.2O 281.1648 (M+H.sup.+), found 281.1649.

    ##STR00073##

    1-(4-(4-methoxyphenyl)piperazin-1-yl)-2-phenylethan-1-one (60)

    [0298] (7.2 mg, colorless oil, 18%): .sup.1H NMR (500 MHz, CDCl.sub.3) 7.36-7.29 (m, 3H), 7.29-7.25 (m, 4H), 6.88-6.79 (m, 2H), 3.83-3.74 (m, 7H), 3.62-3.56 (m, 2H), 3.01 (t, J=5.2 Hz, 2H), 2.87-2.83 (m, 2H). HRMS (ESI-TOF) calcd for C.sub.19H.sub.23N.sub.2O.sub.2 311.1754 (M+H.sup.+), found 311.1755.

    ##STR00074##

    1-(4-(4-methoxyphenyl)piperazin-1-yl)-2-phenylethan-1-one (61)

    [0299] (1.6 mg, white solid, 3.0%): .sup.1H NMR (500 MHz, CDCl.sub.3) 7.38-7.24 (m, 6H), 7.21-7.17 (m, 2H), 3.86-3.78 (m, 4H), 3.63 (t, J=5.2 Hz, 2H), 3.26 (t, J=5.3 Hz, 2H), 3.08 (t, J=5.1 Hz, 2H). HRMS (ESI-TOF) calcd for C.sub.20H.sub.19F.sub.6N.sub.2O 417.1396 (M+H.sup.+), found 417.1397.

    ##STR00075##

    1-(4-(2-phenoxyphenyl)piperazin-1-yl)-2-phenylethan-1-one (62)

    [0300] (3.3 mg, colorless oil, 6.8%): .sup.1H NMR (500 MHz, CDCl.sub.3) 7.34-7.20 (m, 6H), 7.13-6.85 (m, 8H), 3.72 (s, 2H), 3.60 (t, J=5.1 Hz, 2H), 3.40-3.34 (m, 2H) 3.02 (t, J=5.1 Hz, 2H), 2.87 (t, J=5.0 Hz, 2H). HRMS (ESI) calcd for C.sub.24H.sub.25N.sub.2O.sub.2 373.191 (M+H.sup.+), found 373.1909.

    [0301] Tables 1-3 illustrate proteins and binding sites described herein.

    TABLE-US-00007 TABLE1 Accession Labeled # ProteinName Peptide PeptideSequence Probes Family Q9NUJ1 ABHD10Abhydrolase 285-300 ADIQLLVYTIDDLID 3 Enzymes domain-containingprotein10, K mitochondrial Q9NUJ1 ABHD10Abhydrolase 209-223 YSEEGVYNVQYSFIK 131415 Enzymes domain-containingprotein10, 348 mitochondrial Q99798 ACO2Aconitatehydratase, 32-50 VAMSHFEPNEYIHYD 6 Enzymes mitochondrial LLEK P24666 ACP1Lowmolecularweight 42-59 VDSAATSGYEIGNPP 13 Enzymes phosphotyrosineprotein DYR phosphatase P68133 ACTA1Actin,alphaskeletal 241-256 SYELPDGQVITIGNE 1339 Adapter, muscle R Scaffolding, Modulator Proteins P68133 ACTA1Actin,alphaskeletal 71-86 YPIEHGIITNWDDME 13 Adapter, muscle K Scaffolding, Modulator Proteins P62736 ACTA2Actin,aorticsmooth 241-256 SYELPDGQVITIGNE 139 Adapter, muscle R Scaffolding, Modulator Proteins P62736 ACTA2Actin,aorticsmooth 71-86 YPIEHGIITNWDDME 13 Adapter, muscle K Scaffolding, Modulator Proteins P60709 ACTBActin,cytoplasmic1 148-177 TTGIVMDSGDGVTH 1413 Adapter, TVPIYEGYALPHAIL Scaffolding, R Modulator Proteins P60709 ACTBActin,cytoplasmic1 197-206 GYSFTTTAER 3 Adapter, Scaffolding, Modulator Proteins P60709 ACTBActin,cytoplasmic1 216-238 LCYVALDFEQEMAT 13143 Adapter, AASSSSLEK 98 Scaffolding, Modulator Proteins P60709 ACTBActin,cytoplasmic1 239-254 SYELPDGQVITIGNE 13143 Adapter, R 98 Scaffolding, Modulator Proteins P60709 ACTBActin,cytoplasmic1 96-113 VAPEEHPVLLTEAPL 14313 Adapter, NPK Scaffolding, Modulator Proteins Q562R1 ACTBL2Beta-actin-like 240-255 SYELPDGQVITIGNE 13 Adapter, protein2 R Scaffolding, Modulator Proteins Q562R1 ACTBL2Beta-actin-like 97-114 VAPDEHPILLTEAPL 13 Adapter, protein2 NPK Scaffolding, Modulator Proteins Q96019 ACTL6AActin-likeprotein 25-34 AGYAGEDCPK 3 Transcription 6A factors, Regulators P12814 ACTN1Alpha-actinin-1 237-254 AIMTYVSSFYHAFSG 13 Adapter, AQK Scaffolding, Modulator Proteins P12814 ACTN1Alpha-actinin-1 377-387 GYEEWLLNEIR 13 Adapter, Scaffolding, Modulator Proteins O43707 ACTN4Alpha-actinin-4 256-273 AIMTYVSSFYHAFSG 13 Channels, AQK Transporters, Receptors O43707 ACTN4Alpha-actinin-4 396-406 GYEEWLLNEIR 13 Channels, Transporters, Receptors O43707 ACTN4Alpha-actinin-4 470-494 VEQIAAIAQELNELD 14 Channels, YYDSHNVNTR Transporters, Receptors O43707 ACTN4Alpha-actinin-4 792-805 ACLISLGYDVENDR 14 Channels, Transporters, Receptors Q8NI60 ADCK3Chaperoneactivityof 277-295 LGQMLSIQDDAFINP 14 Enzymes bc1complex-like, HLAK mitochondrial P55263 ADKAdenosinekinase 209-224 IFTLNLSAPFISQFYK 2 Enzymes P30520 ADSSAdenylosuccinate 431-441 FIEDELQIPVK 14 Enzymes synthetaseisozyme2 Q53H12 AGKAcylglycerolkinase, 283-304 LASYWAQPQDALSQ 14 Enzymes mitochondrial EVSPEVWK O00116 AGPS 587-603 GISDPLTVFEQTEAA 1314 Enzymes Alkyldihydroxyace- AR tonephosphatesynthase, peroxisomal O43865 AHCYL1Putative 250-261 GIVEESVTGVHR 6 Transcription adenosylhomo- factors, cysteinase2 Regulators Q96HN2 AHCYL2Putative 331-342 GIVEESVTGVHR 6 Enzymes adenosylhomocysteinase3 O95433 AHSA1Activatorof90kDa 225-246 VFTTQELVQAFTHAP 4 Chaperones heatshockproteinATPase ATLEADR homolog1 O95433 AHSA1Activatorof90kDa 322-328 YYFEGIK 4 Chaperones heatshockproteinATPase homolog1 O95831 AIFM1Apoptosis-inducing 475-510 PYWHQSMFWSDLGP 3246 Enzymes factor1,mitochondrial DVGYEAIGLVDSSLP TVGVFAK P54886 ALDH18A1Delta-1- 650-662 FASYLTFSPSEVK 14 Enzymes pyrroline-5-carboxylate synthase Q3SY69 ALDH1L2Mitochondrial10- 152-172 AGFSVFWADDGLDT 6 Enzymes formyltetrahydrofolate GPILLQR dehydrogen P49419 ALDH7A1Alpha- 139-162 ILVEGVGEVQEYVDI 138 Enzymes aminoadipicsemialdehyde CDYAVGLSR dehydrogenase Q9UJX3 ANAPC7Anaphase- 407-424 LDCYEGLIECYLASN 3 Uncategorized promotingcomplexsubunit7 SIR P39687 ANP32AAcidicleucine-rich 117-132 SLDLFNCEVTNLNDY 13 Transcription nuclearphosphoprotein32 R factors, familymemberA Regulators Q92688 ANP32BAcidicleucine-rich 117-132 SLDLFNCEVTNLNDY 13 Chaperones nuclearphosphoprotein32 R familymemberB Q10567 AP1B1AP-1complexsubunit 902-913 LTNGIWVLAELR 13 Channels, beta-1 Transporters, Receptors Q9BZZ5 API5Apoptosisinhibitor5 182-196 VLEDVTGEEFVLFM 4 Uncategorized K Q9BZZ5 API5Apoptosisinhibitor5 131-148 GTLGGLFSQILQGEDI 4 Uncategorized VR Q9BZZ5 API5Apoptosisinhibitor5 211-237 QQLVELVAEQADLE 4 Uncategorized QTFNPSDPDCVDR Q9BUR5 APOOApolipoproteinO 173-182 GYIVIEDLWK 1442 Channels, Transporters, Receptors P84077 ARF1ADP-ribosylation 39-59 LGEIVTTIPTIGFNVE 1332 Channels, factor1 TVEYK 8 Transporters, Receptors P61204 ARF3ADP-ribosylation 39-59 LGEIVTTIPTIGFNVE 1332 Channels, factor3 TVEYK 8 Transporters, Receptors P18085 ARF4ADP-ribosylation 39-59 LGEIVTTIPTIGFNVE 1332 Channels, factor4 TVEYK 8 Transporters, Receptors P84085 ARF5ADP-ribosylation 39-59 LGEIVTTIPTIGFNVE 13342 Channels, factor5 TVEYK 8 Transporters, Receptors P40616 ARL1ADP-ribosylation 163-178 GTGLDEAMEWLVET 1413 Transcription factor-likeprotein1 LK factors, Regulators P40616 ARL1ADP-ribosylation 37-59 LQVGEVVTTIPTIGFN 13 Transcription factor-likeprotein1 VETVTYK factors, Regulators O43681 ASNA1ATPaseASNA1 131-153 MMQEAMSAFPGIDE 14 Enzymes AMSYAEVMR Q9NVI7 ATAD3AATPasefamily 287-294 AFVTDWDK 46 Enzymes AAAdomain-containing protein3A P31939 ATICBifunctionalpurine 178-194 AFTHTAQYDEAISDY 13 Enzymes biosynthesisproteinPURH FR P05023 ATP1A1Sodium/potassium- 360-377 NLEAVETLGSTSTICS 1314 Channels, transportingATPasesubunit DK Transporters, alpha Receptors P05023 ATP1A1Sodium/potassium- 894-911 WINDVEDSYGQQWT 9 Channels, transportingATPasesubunit YEQR Transporters, alpha Receptors P16615 ATP2A2 335-352 SLPSVETLGCTSVICS 14 Channels, Sarcoplasmic/endoplasmic DK Transporters, reticulumcalciumATPase Receptors P20020 ATP2B1Plasmamembrane 824-840 EASDIILTDDNFTSIV 14 Channels, calcium-transportingATPase K Transporters, 1 Receptors P23634 ATP2B4Plasmamembrane 812-828 EASDIILTDDNFTSIV 14 Channels, calcium-transportingATPase K Transporters, 4 Receptors P25705 ATP5A1ATPsynthase 104-123 GMSLNLEPDNVGVV 14313 Channels, subunitalpha,mitochondrial VFGNDK Transporters, Receptors P25705 ATP5A1ATPsynthase 442-463 EVAAFAQFGSDLDA 13143 Channels, subunitalpha,mitochondrial ATQQLLSR 298 Transporters, Receptors P06576 ATP5BATPsynthasesubunit 144-155 IMNVIGEPIDER 26 Channels, beta,mitochondrial Transporters, Receptors P06576 ATP5BATPsynthasesubunit 226-239 AHGGYSVFAGVGER 6 Channels, beta,mitochondrial Transporters, Receptors P06576 ATP5BATPsynthasesubunit 242-259 EGNDLYHEMIESGVI 96 Channels, beta,mitochondrial NLK Transporters, Receptors P06576 ATP5BATPsynthasesubunit 295-310 DQEGQDVLLFIDNIF 6 Channels, beta,mitochondrial R Transporters, Receptors P06576 ATP5BATPsynthasesubunit 352-387 GSITSVQAIYVPADD 1496 Channels, beta,mitochondrial LTDPAPATTFAHLDA Transporters, TTVLSR Receptors P06576 ATP5BATPsynthasesubunit 388-406 AIAELGIYPAVDPLD 13143 Channels, beta,mitochondrial STSR 268 Transporters, Receptors P06576 ATP5BATPsynthasesubunit 407-422 IMDPNIVGSEHYDVA 14 Channels, beta,mitochondrial R Transporters, Receptors P06576 ATP5BATPsynthasesubunit 433-451 SLQDIIAILGMDELSE 146 Channels, beta,mitochondrial EDK Transporters, Receptors P06576 ATP5BATPsynthasesubunit 463-480 FLSQPFQVAEVFTGH 6 Channels, beta,mitochondrial MGK Transporters, Receptors P06576 ATP5BATPsynthasesubunit 95-109 LVLEVAQHLGESTV 136 Channels, beta,mitochondrial R Transporters, Receptors P36542 ATP5C1ATPsynthase 116-126 SEVATLTAAGK 6 Channels, subunitgamma,mitochondrial Transporters, Receptors P24539 ATP5F1ATPsynthase 116-126 YGPFVADFADK 14 Channels, subunitb,mitochondrial Transporters, Receptors P24539 ATP5F1ATPsynthase 56-70 YGLIPEEFFQFLYPK 1442 Channels, subunitb,mitochondrial 13 Transporters, Receptors P24539 ATP5F1ATPsynthase 71-90 TGVTGPYVLGTGLIL 13 Channels, subunitb,mitochondrial YALSK Transporters, Receptors P21281 ATP6V1B2V-typeproton 437-457 AVVGEEALTSDDLL 14 Channels, ATPasesubunitB,brain YLEFLQK Transporters, isoform Receptors P21281 ATP6V1B2V-typeproton 83-93 SGQVLEVSGSK 13 Channels, ATPasesubunitB,brain Transporters, isoform Receptors P36543 ATP6V1E1V-typeproton 200-212 LDLIAQQMMPEVR 13 Channels, ATPasesubunitE1 Transporters, Receptors P46379 BAG6Largeproline-rich 332-344 LLGNTFVALSDLR 8 Chaperones proteinBAG6 Q07812 BAXApoptosisregulator 66-78 IGDELDSNMELQR 13 Uncategorized BAX O75934 BCAS2Pre-mRNA-splicing 137-151 VYNENLVHMIEHAQ 4 Uncategorized factorSPF27 K Q13867 BLMHBleomycinhydrolase 203-218 GEISATQDVMMEEIF 13 Enzymes R Q13867 BLMHBleomycinhydrolase 111-124 CYFFLSAFVDTAQR 14 Enzymes P35613 BSGBasigin 283-300 SELHIENLNMEADPG 13144 Uncategorized QYR P35613 BSGBasigin 228-243 SSEHINEGETAMLVC 2 Uncategorized K Q4ZIN3 C19orf6Membralin 254-271 LLLDEFLGYDDILMS 9 Uncategorized SVK Q07021 C1QBPComplement 247-276 GVDNTFADELVELST 13143 Transcription component1Q ALEHQEYITFLEDLK 9 factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 155-174 VEEQEPELTSTPNFV 13143 Transcription component1Q VEVIK 9 factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 105-119 MSGGWELELNGTEA 9 Transcription component1Q K factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 181-207 ALVLDCHYPEDEVG 139 Transcription component1Q QEDEAESDIFSIR factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 81-91 AFVDFLSDEIK 9 Transcription component1Q factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 129-154 ITVTFNINNSIPPTFD 9 Transcription component1Q GEEEPSQGQK factors, subcomponent-bindingprotein Regulators Q07021 C1QBPComplement 208-220 EVSFQSTGESEWK 39 Transcription component1Q factors, subcomponent-bindingprotein Regulators P62158 CALM3Calmodulin 128-149 EADIDGDGQVNYEE 13 Adapter, FVQMMTAK Scaffolding, Modulator Proteins P62158 CALM3Calmodulin 39-75 SLGQNPTEAELQDMI 14 Adapter, NEVDADGNGTIDFPE Scaffolding, FLTMMAR Modulator Proteins P27797 CALRCalreticulin 323-351 SGTIFDNFLITNDEAY 1396 Chaperones AEEFGNETWGVTK P27797 CALRCalreticulin 99-111 HEQNIDCGGGYVK 6 Chaperones P27824 CANXCalnexin 235-274 THLYTLILNPDNSFEI 6 Chaperones LVDQSVVNSGNLLN DMTPPVNPSR P07384 CAPN1Calpain-1catalytic 175-193 LVFVHSAEGNEFWS 14 Enzymes subunit ALLEK Q96A33 CCDC47Coiled-coildomain- 197-212 LNQENEHIYNLWCS 42 Uncategorized containingprotein47 GR Q96A33 CCDC47Coiled-coildomain- 375-392 DMEALLPLMNMVIY 6 Uncategorized containingprotein47 SIDK Q96ER9 CCDC51Coiled-coildomain- 86-96 YEEFVGLNEVR 14 Uncategorized containingprotein51 P78371 CCT2T-complexprotein1 294-322 QLIYNYPEQLFGAAG 14 Chaperones subunitbeta VMAIEHADFAGVER P78371 CCT2T-complexprotein1 502-516 QVLLSAAEAAEVILR 143 Chaperones subunitbeta P78371 CCT2T-complexprotein1 90-111 VQDDEVGDGTTSVT 14 Chaperones subunitbeta VLAAELLR P49368 CCT3T-complexprotein1 439-449 AVAQALEVIPR 14 Chaperones subunitgamma P49368 CCT3T-complexprotein1 86-127 TQDEEVGDGTTSVII 14 Chaperones subunitgamma LAGEMLSVAEHFLE QQMHPTVVISAYR P50991 CCT4T-complexprotein1 175-193 VVSQYSSLLSPMSVN 2 Chaperones subunitdelta AVMK P50991 CCT4T-complexprotein1 453-481 AFADAMEVIPSTLAE 1442 Chaperones subunitdelta NAGLNPISTVTELR P48643 CCT5T-complexprotein1 294-323 ETGANLAICQWGFD 6 Chaperones subunitepsilon DEANHLLLQNNLPA VR P48643 CCT5T-complexprotein1 324-340 WVGGPEIELIAIATG 14313 Chaperones subunitepsilon GR 6 P48643 CCT5T-complexprotein1 450-478 AFADALEVIPMALSE 146 Chaperones subunitepsilon NSGMNPIQTMTEVR P48643 CCT5T-complexprotein1 97-126 SQDDEIGDGTTGVV 13146 Chaperones subunitepsilon VLAGALLEEAEQLL 9 DR P40227 CCT6AT-complexprotein1 400-424 NAIDDGCVVPGAGA 9 Chaperones subunitzeta VEVAMAEALIK Q99832 CCT7T-complexprotein1 85-106 SQDAEVGDGTTSVT 13 Chaperones subuniteta LLAAEFLK P50990 CCT8T-complexprotein1 441-450 FAEAFEAIPR 8 Chaperones subunittheta Q16543 CDC37Hsp90co-chaperone 287-307 LGPGGLDPVEVYESL 8 Chaperones Cdc37 PEELQK Q96JB5 CDK5RAP3CDK5regulatory 351-367 NQFLDELMELEIFLA 3 Adapter, subunit-associatedprotein3 QR Scaffolding, Modulator Proteins Q07065 CKAP4Cytoskeleton- 312-326 STLQTMESDIYTEVR 13149 Adapter, associatedprotein4 8 Scaffolding, Modulator Proteins P12277 CKBCreatinekinaseB-type 224-236 TFLVWVNEEDHLR 3 Enzymes P12277 CKBCreatinekinaseB-type 342-358 LGFSEVELVQMVVD 313 Enzymes GVK P12277 CKBCreatinekinaseB-type 367-381 LEQGQAIDDLMPAQ 13 Enzymes K P12277 CKBCreatinekinaseB-type 14-32 FPAEDEFPDLSAHNN 3 Enzymes HMAK P12277 CKBCreatinekinaseB-type 157-172 LAVEALSSLDGDLA 13 Enzymes GR P12277 CKBCreatinekinaseB-type 253-265 FCTGLTQIETLFK 13 Enzymes P12532 CKMT1BCreatinekinaseU- 257-269 SFLIWVNEEDHTR 3 Enzymes type,mitochondrial O75503 CLN5Ceroid-lipofuscinosis 74-96 YTFCPTGSPIPVMEG 9 Uncategorized neuronalprotein5 DDDIEVFR Q9H078 CLPBCaseinolyticpeptidase 630-650 VVNQLAAAYEQDLL 14 Enzymes Bproteinhomolog PGGCTLR Q16740 CLPPPutativeATP- 215-226 QSLQVIESAMER 6 Enzymes dependentClpprotease proteolyticsubunit O96005 CLPTM1Cleftlipandpalate 325-346 SPWNFLGDELYEQS 13142 Uncategorized transmembraneprotein1 DEEQDSVK 6 O96005 CLPTM1Cleftlipandpalate 548-562 ALNTFIDDLFAFVIK 2 Uncategorized transmembraneprotein1 P53618 COPB1Coatomersubunit 262-279 YEAAGTLVTLSSAPT 13 Channels, beta AIK Transporters, Receptors Q9BT78 COPS4COP9signalosome 154-170 LYLEDDDPVQAEAYI 1315 Uncategorized complexsubunit4 NR Q5HYK3 COQ52-methoxy-6- 258-279 LYDLYSFQVIPVLGE 142 Enzymes polypreny1-1,4-benzoquinol VIAGDWK methylase, Q7KZN9 COX15Cytochromecoxidase 296-313 MGESWIPEDLFTFSPI 14 Uncategorized assemblyproteinCOX15 LR homolo P20674 COX5ACytochromec 73-87 GINTLVTYDMVPEPK 13143 Adapter, oxidasesubunit5A, 29 Scaffolding, mitochondrial Modulator Proteins P23786 CPT2CarnitineO- 363-382 DGSTAVHFEHSWGD 1513 Enzymes palmitoyltransferase2, GVAVLR mitochondrial P23786 CPT2CarnitineO- 478-495 QYGQTVATYESCST 4 Enzymes palmitoyltransferase2, AAFK mitochondrial Q9H3G5 CPVLProbableserine 281-292 QNWFEAFEILDK 49 Enzymes carboxypeptidaseCPVL Q9H3G5 CPVLProbableserine 320-331 CTEPEDQLYYVK 139 Enzymes carboxypeptidaseCPVL Q9H3G5 CPVLProbableserine 195-208 NNDFYVTGESYAGK 9 Enzymes carboxypeptidaseCPVL P55060 CSE1LExportin-2 32-52 FLESVEGNQNYPLLL 143 Channels, LTLLEK Transporters, Receptors P55060 CSE1LExportin-2 396-418 FFEGPVTGIFSGYVN 14 Channels, SMLQEYAK Transporters, Receptors P48729 CSNK1A1CaseinkinaseI 84-106 DYNVLVMDLLGPSL 14 Enzymes isoformalpha EDLFNFCSR P67870 CSNK2BCaseinkinaseII 112-134 VYCENQPMLPIGLSD 14 Uncategorized subunitbeta IPGEAMVK Q12996 CSTF3Cleavagestimulation 440-464 YGDIPEYVLAYIDYL 13 Uncategorized factorsubunit3 SHLNEDNNTR Q12996 CSTF3Cleavagestimulation 319-330 LFSDEAANIYER 1314 Uncategorized factorsubunit3 P35222 CTNNB1Cateninbeta-1 648-661 NEGVATYAAAVLFR 1413 Adapter, Scaffolding, Modulator Proteins P07858 CTSBCathepsinB 315-331 GQDHCGIESEVVAGI 1342 Enzymes PR 9 P07339 CTSDCathepsinD 236-253 DPDAQPGGELMLGG 9 Enzymes TDSK P07339 CTSDCathepsinD 288-309 EGCEAIVDTGTSLMV 131415 Enzymes GPVDEVR 4698 P07339 CTSDCathepsinD 314-331 AIGAVPLIQGEYMIP 14153 Enzymes CEK 24136 98 O43169 CYB5BCytochromeb5type 138-144 YYTSESK 42 Adapter, B Scaffolding, Modulator Proteins P00387 CYB5R3NADH-cytochrome 235-241 LWYTLDR 3 Enzymes b5reductase3 Q6UW02 CYP20A1CytochromeP450 397-413 TFSSLGFSGTQECPEL 1443 Enzymes 20A1 R P61962 DCAF7DDB1-andCUL4- 82-96 GVYPDLLATSGDYL 14 Uncategorized associatedfactor7 R Q13561 DCTN2Dynactinsubunit2 380-395 ENLATVEGNFASIDE 136 Adapter, R Scaffolding, Modulator Proteins Q9H773 DCTPP1dCTP 90-109 AALQEELSDVLIYLV 144 Enzymes pyrophosphatase1 ALAAR Q92841 DDX17ProbableATP- 406-417 LIQLMEEIMAEK 13142 Transcription dependentRNAhelicase 9 factors, DDX17 Regulators Q92841 DDX17ProbableATP- 536-547 VLEEANQAINPK 3 Transcription dependentRNAhelicase factors, DDX17 Regulators Q16698 DECR12,4-dienoyl-CoA 299-315 FDGGEEVLISGEFND 6 Enzymes reductase,mitochondrial LR Q15392 DHCR24Delta(24)-sterol 334-352 SIFWELQDIIPFGNNPI 3152 Enzymes reductase FR Q15392 DHCR24Delta(24)-sterol 428-444 GNEAELYIDIGAYGE 13148 Enzymes reductase PR Q9H2U1 DHX36ProbableATP- 754-770 SDHLTVVNAFEGWE 6 Transcription dependentRNAhelicase EAR factors, DHX36 Regulators Q08211 DHX9ATP-dependentRNA 448-456 ISAVSVAER 3 Transcription helicaseA factors, Regulators Q08211 DHX9ATP-dependentRNA 121-141 AENNSEVGASGYGV 8 Transcription helicaseA PGPTWDR factors, Regulators Q9NR28 DIABLODiablohomolog, 124-140 MNSEEEDEVWQVIIG 13 Uncategorized mitochondrial AR P09622 DLDDihydrolipoyl 450-482 VLGAHILGPGAGEM 14413 Enzymes dehydrogenase,mitochondrial VNEAALALEYGASC EDIAR Q9NVH1 DNAJC11DnaJhomolog 207-226 GWGELEFGAGDLQG 146 Chaperones subfamilyCmember11 PLFGLK O00115 DNASE2Deoxyribonuclease- 173-202 QLTYTYPWVYNYQL 9 Enzymes 2-alpha EGIFAQEFPDLENVV K P42892 ECE1Endothelin-converting 434-453 FCVSDTENNLGFALG 1413 Enzymes enzyme1 PMFVK Q13011 ECH1Delta(3,5)-Delta(2,4)- 197-211 EVDVGLAADVGTLQ 131415 Enzymes dienoyl-CoAisomerase, R 3468 mitochondrial Q13011 ECH1Delta(3,5)-Delta(2,4)- 149-158 YQETFNVIER 6 Enzymes dienoyl-CoAisomerase, mitochondrial Q13011 ECH1Delta(3,5)-Delta(2,4)- 113-131 MFTAGIDLMDMASD 6 Enzymes dienoyl-CoAisomerase, ILQPK mitochondrial Q9NTX5 ECHDC1Ethylmalonyl-CoA 272-283 ELYLEEALQNER 9 Enzymes decarboxylase P68104 EEF1A1Elongationfactor1- 135-146 EHALLAYTLGVK 13 Transcription alpha1 factors, Regulators P26641 EEF1GElongationfactor1- 379-400 GQELAFPLSPDWQV 13 Uncategorized gamma DYESYTWR P26641 EEF1GElongationfactor1- 58-85 VPAFEGDDGFCVFES 3 Uncategorized gamma NAIAYYVSNEELR P13639 EEF2Elongationfactor2 457-481 YVEPIEDVPCGNIVG 3 Transcription LVGVDQFLVK factors, Regulators P13639 EEF2Elongationfactor2 740-765 LMEPIYLVEIQCPEQ 3 Transcription VVGGIYGVLNR factors, Regulators P13639 EEF2Elongationfactor2 768-785 GHVFEESQVAGTPM 3 Transcription FVVK factors, Regulators P60228 EIF3EEukaryotictranslation 173-191 LASEILMQNWDAAM 2 Uncategorized initiationfactor3subunit EDLTR O00303 EIF3FEukaryotictranslation 193-210 EAPNPIHLTVDTSLQ 36 Enzymes initiationfactor3subunit NGR O00303 EIF3FEukaryotictranslation 279-297 IQDALSTVLQYAEDV 39 Enzymes initiationfactor3subunit LSGK O15372 EIF3HEukaryotictranslation 207-220 NSHLINVLMWELEK 2 Uncategorized initiationfactor3subunit Q9Y262 EIF3LEukaryotictranslation 404-419 GDPQVYEELFSYSCP 13 Uncategorized initiationfactor3subunit K Q9Y262 EIF3LEukaryotictranslation 243-262 QLEVYTSGGDPESVA 1314 Uncategorized initiationfactor3subunit GEYGR P60842 EIF4A1Eukaryoticinitiation 69-82 GYDVIAQAQSGTGK 14139 Transcription factor4A-I factors, Regulators P60842 EIF4A1Eukaryoticinitiation 178-190 MFVLDEADEMLSR 13 Transcription factor4A-I factors, Regulators Q14240 EIF4A2Eukaryoticinitiation 70-83 GYDVIAQAQSGTGK 13 Transcription factor4A-II factors, Regulators Q15056 EIF4HEukaryotictranslation 97-109 EALTYDGALLGDR 9 Transcription initiationfactor4H factors, Regulators P55010 EIF5Eukalyotictranslation 274-288 AMGPLVLTEVLFNE 14324 Transcription initiationfactor5 K 136 factors, Regulators Q15717 ELAVL1ELAV-likeprotein1 20-37 TNLIVNYLPQNMTQ 1342 Transcription DELR factors, Regulators Q9NXB9 ELOVL2Elongationofvery 42543 AFDDEINAFLDNMFG 149 Enzymes longchainfattyacids PR protein P50402 EMDEmerin 212-221 APGAGLGQDR 4 Adapter, Scaffolding, Modulator Proteins P50402 EMDEmerin 89-103 GYNDDYYEESYFTT 68 Adapter, R Scaffolding, Modulator Proteins P07099 EPHX1Epoxidehydrolase1 329-338 FSTWTNTEFR 36 Enzymes P84090 ERHEnhancerofrudimentary 18-34 TYADYESVNECMEG 13 Uncategorized homolog VCK P38117 ETFBElectrontransfer 36-51 HSMNPFCEIAVEEAV 3 Channels, flavoproteinsubunitbeta R Transporters, Receptors Q01844 EWSR1RNA-bindingprotein 269-292 QDHPSSMGVYGQES 2 Transcription EWS GGFSGPGENR factors, Regulators Q9UQ84 EXO1Exonuclease1 139-160 SQGVDCLVAPYEAD 1326 Enzymes AQLAYLNK 98 Q96CS3 FAF2FAS-associatedfactor2 249-277 LEGLIQPDDLINQLTF 6 Uncategorized IMDANQTYLVSER P16930 FAHFumarylacetoacetase 242-253 WEYVPLGPFLGK 14 Enzymes Q9NRY5 FAM114A2Protein 184-196 TMDVIAEGDPGFK 14 Uncategorized FAM114A2 Q9NSD9 FARSBPhenylalanine--tRNA 72-82 YDLLCLEGLVR 9 Enzymes ligasebetasubunit Q9NSD9 FARSBPhenylalanine--tRNA 518-530 IMQLLDVPPGEDK 2 Enzymes ligasebetasubunit P49327 FASNFattyacidsynthase 1350-1383 GHPLGDIVAFLTSTE 1413 Enzymes PQYGQGILSQDAWE SLFSR P37268 FDFT1Squalenesynthase 78-92 ALDTLEDDMTISVEK 15 Enzymes P22830 FECHFerrochelatase, 254-272 SEVVILFSAHSLPMS 4 Enzymes mitochondrial VVNR O95684 FGFR1OPFGFR1oncogene 39-50 AAVFLALEEQEK 14138 Adapter, partner Scaffolding, Modulator Proteins Q96AY3 FKBP10Peptidyl-prolylcis- 198-212 GGTYDTYVGSGWLI 13 Enzymes transisomeraseFKBP10 K Q02790 FKBP4Peptidyl-prolylcis- 190-206 FEIGEGENLDLPYGL 13 Chaperones transisomeraseFKBP4 ER Q96AE4 FUBP1Farupstreamelement- 593-620 MGQAVPAPTGAPPG 14 Transcription bindingprotein1 GQPDYSAAWAEYYR factors, Regulators Q96AE4 FUBP1Farupstreamelement- 272-284 IGGNEGIDVPIPR 6 Transcription bindingprotein1 factors, Regulators P35637 FUSRNA-bindingprotein 335-348 GEATVSFDDPPSAK 2 Transcription FUS factors, Regulators P10253 GAALysosomalalpha- 855-870 GELFWDDGESLEVL 9 Enzymes glucosidase ER P50395 GDI2RabGDPdissociation 119-137 VPSTEAEALASSLMG 1314 Uncategorized inhibitorbeta LFEK P50395 GDI2RabGDPdissociation 222-240 SPYLYPLYGLGELPQ 313 Uncategorized inhibitorbeta GFAR Q9H3K2 GHITMGrowthhormone- 218-240 AAWYTAGIVGGLST 14 Uncategorized inducibletransmembrane VAMCAPSEK protein P06280 GLAAlpha-galactosidaseA 241-252 SILDWTSFNQER 9 Enzymes P06280 GLAAlpha-galactosidaseA 68-82 LFMEMAELMVSEG 4 Enzymes WK P06280 GLAAlpha-galactosidaseA 50-67 FMCNLDCQEEPDSCI 9 Enzymes SEK P16278 GLB1Beta-galactosidase 286-299 TEAVASSLYDILAR 9 Enzymes Q04760 GLO1Lactoylglutathione 160-179 GLAFIQDPDGYWIEI 143 Enzymes lyase LNPNK Q9HC38 GLOD4Glyoxalasedomain- 71-96 TMVGFGPEDDHFVA 413 Uncategorized containingprotein4 ELTYNYGVGDYK P00367 GLUD1Glutamate 481-496 HGGTIPIVPTAEFQDR 6 Enzymes dehydrogenase1, mitochondrial P00367 GLUD1Glutamate 152-162 YSTDVSVDEVK 6 Enzymes dehydrogenase1, mitochondrial P49448 GLUD2Glutamate 152-162 YSTDVSVDEVK 6 Enzymes dehydrogenase2, mitochondrial Q9H4A6 GOLPH3Golgi 75-90 EGYTSFWNDCISSGL 14 Adapter, phosphoprotein3 R Scaffolding, Modulator Proteins Q9BQ67 GRWD1Glutamate-richWD 183-198 LLQVVEEPQALAAFL 3 Uncategorized repeat-containingprotein1 R Q9BQ67 GRWD1Glutamate-richWD 263-287 SVEDLQWSPTENTVF 13 Uncategorized repeat-containingprotein1 ASCSADASIR P09211 GSTP1GlutathioneS- 56-71 FQDGDLTLYQSNTIL 2 Enzymes transferaseP R P0C0S5 H2AFZHistoneH2A.Z 47-75 VGATAAVYSAAILE 3 Transcription YLTAEVLELAGNAS factors, K Regulators Q16836 HADHHydroxyacyl- 250-271 LGAGYPMGPFELLD 132 Enzymes coenzymeAdehydrogenase, YVGLDTTK mitochondrial P40939 HADHATrifunctional 112-125 TLQEVTQLSQEAQR 48 Enzymes enzymesubunitalpha, mitochondrial P12081 HARSHistidine--tRNA 170-193 EFYQCDFDIAGNFDP 15144 Enzymes ligase,cytoplasmic MIPDAECLK Q96CS2 HAUS1HAUSaugmin-like 94-108 YLNALVDSAVALET 14 Adapter, complexsubunit1 K Scaffolding, Modulator Proteins Q9NVX0 HAUS2HAUSaugmin-like 173-189 MDILVTEIEELAENI 14 Adapter, complexsubunit2 LK Scaffolding, Modulator Proteins P69905 HBA2Hemoglobinsubunit 18-32 VGAHAGEYGAEALE 4 Adapter, alpha R Scaffolding, Modulator Proteins P69905 HBA2Hemoglobinsubunit 94-100 VDPVNFK 4 Adapter, alpha Scaffolding, Modulator Proteins P53701 HCCSCytochromec-type 200-210 SWMGYELPFDR 4 Enzymes hemelyase Q7Z4Q2 HEATR3HEATrepeat- 224-250 SFSATALNMLESALL 42 Uncategorized containingprotein3 SPVSSMESLLLK P06865 HEXABeta-hexosaminidase 489-499 LTSDLTFAYER 9 Enzymes subunitalpha Q6NVY1 HIBCH3-hydroxyisobutyryl- 238-252 ENIASVLENYHTESK 6 Enzymes CoAhydrolase,mitochondrial P16403 HIST1H1CHistoneH1.2 65-75 ALAAAGYDVEK 8 Transcription factors, Regulators P01892 HLA-AHLAclassI 46-59 FIAVGYVDDTQFVR 14 Uncategorized histocompatibilityantigen,A- 2alpha Q8TCT9 HM13Minor 62-73 NASDMPETITSR 13142 Enzymes histocompatibilityantigen 48 H13 P30519 HMOX2Hemeoxygenase2 48-55 AENTQFVK 15143 Enzymes 4268 P30519 HMOX2Hemeoxygenase2 69-87 LATTALYFTYSALEE 14 Enzymes EMER P09651 HNRNPA1Heterogeneous 353-370 NQGGYGGSSSSSSYG 13143 Channels, nuclearribonucleoproteinA1 SGR 29 Transporters, Receptors P09651 HNRNPA1Heterogeneous 337-350 SSGPYGGGGQYFAK 32 Channels, nuclearribonucleoproteinA1 Transporters, Receptors P09651 HNRNPA1Heterogeneous 56-75 GFGFVTYATVEEVD 3 Channels, nuclearribonucleoproteinA1 AAMNAR Transporters, Receptors P09651 HNRNPA1Heterogeneous 233-265 GGGGYGGSGDGYN 8 Channels, nuclearribonucleoproteinA1 GFGNDGGYGGGGPG Transporters, YSGGSR Receptors P09651 HNRNPA1Heterogeneous 16-31 LFIGGLSFETTDESLR 1432 Channels, nuclearribonucleoproteinA1 Transporters, Receptors P09651 HNRNPA1Heterogeneous 131-140 IEVIEIMTDR 398 Channels, nuclearribonucleoproteinA1 Transporters, Receptors Q32P51 HNRNPA1L2Heterogeneous 285-298 SSGPYGGGGQYFAK 324 Channels, nuclearribonucleoproteinA1- Transporters, like2 Receptors Q32P51 HNRNPA1L2Heterogeneous 131-140 IEVIEIMTDR 349 Channels, nuclearribonucleoproteinA1- Transporters, like2 Receptors Q32P51 HNRNPA1L2Heterogeneous 16-31 LFIGGLSFETTDESLR 14342 Channels, nuclearribonucleoproteinA1- Transporters, like2 Receptors P22626 HNRNPA2B1Heterogeneous 130-137 DYFEEYGK 6 Channels, nuclearribonucleoproteins Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 138-147 IDTIEIITDR 13 Channels, nuclearribonucleoproteins Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 191-200 QEMQEVQSSR 6 Channels, nuclearribonucleoproteins Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 229-238 GGSDGYGSGR 36 Channels, nuclearribonucleoproteins Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 239-266 GFGDGYNGYGGGPG 13143 Channels, nuclearribonucleoproteins GGNFGGSPGYGGGR 268 Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 23-38 LFIGGLSFETTEESLR 1332 Channels, nuclearribonucleoproteins 69 Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 267-317 GGYGGGGPGYGNQ 1329 Channels, nuclearribonucleoproteins GGGYGGGYDNYGG 6 Transporters, A2/B1 GNYGSGNYNDFGNY Receptors NQQPSNYGPMK P22626 HNRNPA2B1Heterogeneous 326-350 NMGGPYGGGNYGP 1432 Channels, nuclearribonucleoproteins GGSGGSGGYGGR 1386 Transporters, A2/B1 Receptors P22626 HNRNPA2B1Heterogeneous 42472 TLETVPLER 6 Channels, nuclearribonucleoproteins Transporters, A2/B1 Receptors P51991 HNRNPA3Heterogeneous 152-161 IETIEVMEDR 96 Transcription nuclearribonucleoproteinA3 factors, Regulators P51991 HNRNPA3Heterogeneous 355-376 SSGSPYGGGYGSGG 13143 Transcription nuclearribonucleoproteinA3 GSGGYGSR 246 factors, Regulators P51991 HNRNPA3Heterogeneous 37-52 LFIGGLSFETTDDSLR 4 Transcription nuclearribonucleoproteinA3 factors, Regulators P07910 HNRNPCHeterogeneous 100-130 SAAEMYGSVTEHPSP 134 Transcription nuclearribonucleoproteins SPLLSSSFDLDYDFQ factors, C1/C2 R Regulators P07910 HNRNPCHeterogeneous 136-142 MYSYPAR 43 Transcription nuclearribonucleoproteins factors, C1/C2 Regulators P07910 HNRNPCHeterogeneous 51-61 GFAFVQYVNER 213 Transcription nuclearribonucleoproteins factors, C1/C2 Regulators P07910 HNRNPCHeterogeneous 65-73 AAVAGEDGR 4 Transcription nuclearribonucleoproteins factors, C1/C2 Regulators P07910 HNRNPCHeterogeneous 74-89 MIAGQVLDINLAAEP 43213 Transcription nuclearribonucleoproteins K factors, C1/C2 Regulators Q14103 HNRNPDHeterogeneous 184-197 IFVGGLSPDTPEEK 136 Transcription nuclearribonucleoproteinD0 factors, Regulators P52597 HNRNPFHeterogeneous 151-167 ITGEAFVQFASQELA 4213 Transcription nuclearribonucleoproteinF EK 9 factors, Regulators P52597 HNRNPFHeterogeneous 53-68 QSGEAFVELGSEDDV 6 Transcription nuclearribonucleoproteinF K factors, Regulators P52597 HNRNPFHeterogeneous 99-114 HSGPNSADSANDGF 6 Transcription nuclearribonucleoproteinF VR factors, Regulators P52597 HNRNPFHeterogeneous 125-150 EEIVQFFSGLEIVPNG 36 Transcription nuclearribonucleoproteinF ITLPVDPEGK factors, Regulators P52597 HNRNPFHeterogeneous 300-316 ATENDIYNFFSPLNP 1332 Transcription nuclearribonucleoproteinF VR 46 factors, Regulators P52597 HNRNPFHeterogeneous 317-326 VHIEIGPDGR 6 Transcription nuclearribonucleoproteinF factors, Regulators P31943 HNRNPH1Heterogeneous 125-150 EEIVQFFSGLEIVPNG 26 Transcription nuclearribonucleoproteinH ITLPVDFQGR factors, Regulators P31943 HNRNPH1Heterogeneous 151-167 STGEAFVQFASQEIA 13143 Transcription nuclearribonucleoproteinH EK 68 factors, Regulators P31943 HNRNPH1Heterogeneous 234-259 GAYGGGYGGYDDY 3213 Transcription nuclearribonucleoproteinH NGYNDGYGFGSDR 68 factors, Regulators P31943 HNRNPH1Heterogeneous 263-275 DLNYCFSGMSDHR 6 Transcription nuclearribonucleoproteinH factors, Regulators P31943 HNRNPH1Heterogeneous 276-294 YGDGGSTFQSTTGH 6 Transcription nuclearribonucleoproteinH CVHMR factors, Regulators P31943 HNRNPH1Heterogeneous 300-316 ATENDIYNFFSPLNP 13143 Transcription nuclearribonucleoproteinH VR 26 factors, Regulators P31943 HNRNPH1Heterogeneous 317-326 VHIEIGPDGR 36 Transcription nuclearribonucleoproteinH factors, Regulators P31943 HNRNPH1Heterogeneous 356-375 YVELFLNSTAGASGG 36 Transcription nuclearribonucleoproteinH AYEHR factors, Regulators P31943 HNRNPH1Heterogeneous 99-114 HTGPNSPDTANDGF 6 Transcription nuclearribonucleoproteinH VR factors, Regulators P55795 HNRNPH2Heterogeneous 151-167 STGEAFVQFASQEIA 13143 Transcription nuclearribonucleoproteinH2 EK 86 factors, Regulators P55795 HNRNPH2Heterogeneous 234-259 GAYGGGYGGYDDY 86 Transcription nuclearribonucleoproteinH2 GGYNDGYGFGSDR factors, Regulators P55795 HNRNPH2Heterogeneous 263-275 DLNYCFSGMSDHR 6 Transcription nuclearribonucleoproteinH2 factors, Regulators P55795 HNRNPH2Heterogeneous 300-316 ATENDIYNFFSPLNP 6 Transcription nuclearribonucleoproteinH2 MR factors, Regulators P55795 HNRNPH2Heterogeneous 317-326 VHIEIGPDGR 6 Transcription nuclearribonucleoproteinH2 factors, Regulators P55795 HNRNPH2Heterogeneous 99-114 HTGPNSPDTANDGF 6 Transcription nuclearribonucleoproteinH2 VR factors, Regulators P31942 HNRNPH3Heterogeneous 139-169 GGDGYDGGYGGFD 6 Transcription nuclearribonucleoproteinH3 DYGGYNNYGYGND factors, GFDDR Regulators P31942 HNRNPH3Heterogeneous 206-222 ATENDIANFFSPLNPI 246 Transcription nuclearribonucleoproteinH3 R factors, Regulators P31942 HNRNPH3Heterogeneous 262-287 YIELFLNSTPGGGSG 14426 Transcription nuclearribonucleoproteinH3 MGGSGMGGYGR factors, Regulators P31942 HNRNPH3Heterogeneous 288-301 DGMDNQGGYGSVG 86 Transcription nuclearribonucleoproteinH3 R factors, Regulators P31942 HNRNPH3Heterogeneous 324-343 GGGGSGGYYGQGG 2 Transcription nuclearribonucleoproteinH3 MSGGGWR factors, Regulators P31942 HNRNPH3Heterogeneous 56-67 STGEAFVQFASK 6 Transcription nuclearribonucleoproteinH3 factors, Regulators P61978 HNRNPKHeterogeneous 423-433 IDEPLEGSEDR 4 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 397-405 DLAGSIIGK 43 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 415-422 HESGASIK 4313 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 434-456 IITITGTQDQIQNAQY 13143 Transcription nuclearribonucleoproteinK LLQNSVK 2498 factors, Regulators P61978 HNRNPKHeterogeneous 70-86 TDYNASVSVPDSSGP 84 Transcription nuclearribonucleoproteinK ER factors, Regulators P61978 HNRNPKHeterogeneous 87-102 ILSISADIETIGEILK 4 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 104-139 IIPTLEEGLQLPSPTA 13143 Transcription nuclearribonucleoproteinK TSQLPLESDAVECLN 42 factors, YQHYK Regulators P61978 HNRNPKHeterogeneous 180-191 LFQECCPHSTDR 13 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 208-219 IILDLISESPIK 1442 Transcription nuclearribonucleoproteinK 139 factors, Regulators P61978 HNRNPKHeterogeneous 222-246 AQPYDPNFYDETYD 4 Transcription nuclearribonucleoproteinK YGGFTMMFDDR factors, Regulators P61978 HNRNPKHeterogeneous 279-286 DYDDMSPR 4 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 317-325 GGDLMAYDR 2 Transcription nuclearribonucleoproteinK factors, Regulators P61978 HNRNPKHeterogeneous 378-396 GSYGDLGGPIITTQV 14324 Transcription nuclearribonucleoproteinK TIPK 1398 factors, Regulators P14866 HNRNPLHeterogeneous 108-136 GLIDGVVEADLVEAL 1439 Transcription nuclearribonucleoproteinL QEFGPISYVVVMPK factors, Regulators P14866 HNRNPLHeterogeneous 399-411 VFNVFCLYGNVEK 2 Transcription nuclearribonucleoproteinL factors, Regulators P14866 HNRNPLHeterogeneous 47-56 YYGGGSEGGR 3 Transcription nuclearribonucleoproteinL factors, Regulators P52272 HNRNPMHeterogeneous 346-362 MGGMEGPFGGGME 1426 Transcription nuclearribonucleoproteinM NMGR factors, Regulators P52272 HNRNPMHeterogeneous 532-543 MVPAGMGAGLER 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 202-214 LGSTVFVANLDYK 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 323-345 GIGMGNIGPAGMGM 326 Transcription nuclearribonucleoproteinM EGIGFGINK factors, Regulators P52272 HNRNPMHeterogeneous 437-443 MGLVMDR 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 457-471 MGPLGLDHMASSIER 36 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 544-550 MGPVMDR 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 551-557 MATGLER 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 571-578 MGANSLER 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 592-606 MGPAMGPALGAGIE 26 Transcription nuclearribonucleoproteinM R factors, Regulators P52272 HNRNPMHeterogeneous 699-707 FESPEVAER 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 95-110 VGEVTYVELLMDAE 13143 Transcription nuclearribonucleoproteinM GK 269 factors, Regulators P52272 HNRNPMHeterogeneous 113-120 GCAVVEFK 6 Transcription nuclearribonucleoproteinM factors, Regulators P52272 HNRNPMHeterogeneous 486-496 MGAGMGFGLER 6 Transcription nuclearribonucleoproteinM factors, Regulators O43390 HNRNPRHeterogeneous 147-171 YGGPPPDSVYSGVQP 6 Transcription nuclearribonucleoproteinR GIGTEVFVGK factors, Regulators O43390 HNRNPRHeterogeneous 316-339 VWGNVVTVEWADP 6 Transcription nuclearribonucleoproteinR VEEPDPEVMAK factors, Regulators O43390 HNRNPRHeterogeneous 347-359 NLATTVTEEILEK 6 Transcription nuclearribonucleoproteinR factors, Regulators O43390 HNRNPRHeterogeneous 428-441 STAYEDYYYHPPPR 26 Transcription nuclearribonucleoproteinR factors, Regulators Q99714 HSD17B103-hydroxyacyl- 42672 GLVAVITGGASGLGL 32 Enzymes CoAdehydrogenasetype-2 ATAER Q53GQ0 HSD17B12Estradiol17-beta- 182-206 GAILNISSGSGMLPVP 142 Enzymes dehydrogenase12 LLTIYSATK Q53GQ0 HSD17B12Estradiol17-beta- 36-64 VWGVGNEAGVGPG 1442 Enzymes dehydrogenase12 LGEWAVVTGSTDGI GK P51659 HSD17B4Peroxisomal 169-183 LGLLGLANSLAIEGR 3 Enzymes multifunctionalenzymetype2 P51659 HSD17B4Peroxisomal 385-403 SMMGGGLAEIPGLSI 14 Enzymes multifunctionalenzymetype2 NFAK P51659 HSD17B4Peroxisomal 622-633 LQSTFVFEEIGR 14 Enzymes multifunctionalenzymetype2 P07900 HSP90AA1Heatshock 368-386 VFIMDNCEELIPEYL 13 Chaperones proteinHSP90-alpha NFIR P07900 HSP90AA1Heatshock 300-314 NPDDITNEEYGEFYK 13 Chaperones proteinHSP90-alpha P07900 HSP90AA1Heatshock 514-534 HGLEVIYMIEPIDEYC 13 Chaperones proteinHSP90-alpha VQQLK P08238 HSP90AB1Heatshock 360-378 VFIMDSCDELIPEYL 1413 Chaperones proteinHSP90-beta NFIR P08238 HSP90AB1Heatshock 507-526 GFEVVYMTEPIDEYC 1314 Chaperones proteinHSP90-beta VQQLK P08238 HSP90AB1Heatshock 686-719 LGLGIDEDEVAAEEP 1314 Chaperones proteinHSP90-beta NAAVPDEIPPLEGDE DASR P14625 HSP90B1Endoplasmin 664-671 AQAYQTGK 138 Chaperones P14625 HSP90B1Endoplasmin 117-135 LISLTDENALSGNEE 9 Chaperones LTVK P14625 HSP90B1Endoplasmin 271-285 YSQFINFPIYVWSSK 6 Chaperones P14625 HSP90B1Endoplasmin 494-503 LGVIEDHSNR 6 Chaperones P14625 HSP90B1Endoplasmin 52-67 EEEAIQLDGLNASQI 6 Chaperones R P08107 HSPA1BHeatshock70kDa 113-126 AFYPEEISSMVLTK 13 Chaperones protein1A/1B P08107 HSPA1BHeatshock70kDa 172-187 IINEPTAAAIAYGLDR 13 Chaperones protein1A/1B P08107 HSPA1BHeatshock70kDa 362-384 SINPDEAVAYGAAV 13 Chaperones protein1A/1B QAAILMGDK P08107 HSPA1BHeatshock70kDa 424-447 QTQIFTTYSDNQPGV 133 Chaperones protein1A/1B LIQVYEGER P08107 HSPA1BHeatshock70kDa 598-628 ELEQVCNPIISGLYQ 13 Chaperones protein1A/1B GAGGPGPGGFGAQG PK P11021 HSPA578kDaglucose- 602-617 IEWLESHQDADIEDF 6 Chaperones regulatedprotein K P11021 HSPA578kDaglucose- 82-96 NQLTSNPENTVFDAK 96 Chaperones regulatedprotein P11021 HSPA578kDaglucose- 475-492 DNHLLGTFDLTGIPP 6 Chaperones regulatedprotein APR P11021 HSPA578kDaglucose- 61-74 ITPSYVAFTPEGER 6 Chaperones regulatedprotein P11142 HSPA8Heatshockcognate 424-447 QTQTFTTYSDNQPGV 1314 Chaperones 71kDaprotein LIQVYEGER P11142 HSPA8Heatshockcognate 113-126 SFYPEEVSSMVLTK 1314 Chaperones 71kDaprotein P38646 HSPA9Stress-70protein, 266-284 STNGDTFLGGEDFDQ 138 Chaperones mitochondrial ALLR P10809 HSPD160kDaheatshock 345-352 VGEVIVTK 3 Chaperones protein,mitochondrial P10809 HSPD160kDaheatshock 206-218 TLNDELEIIEGMK 133 Chaperones protein,mitochondrial P10809 HSPD160kDaheatshock 222-233 GYISPYFINTSK 13 Chaperones protein,mitochondrial P10809 HSPD160kDaheatshock 251-268 ISSIQSIVPALEIANAH 313 Chaperones protein,mitochondrial R P10809 HSPD160kDaheatshock 371-387 IQEIIEQLDVTTSEYE 13 Chaperones protein,mitochondrial K P10809 HSPD160kDaheatshock 494-516 IMQSSSEVGYDAMA 138 Chaperones protein,mitochondrial GDFVNMVEK P10809 HSPD160kDaheatshock 97-121 LVQDVANNTNEEAG 138 Chaperones protein,mitochondrial DGTTTATVLAR Q9NSE4 IARS2Isoleucine--tRNA 818-832 SCQTALVEILDVIVR 1432 Enzymes ligase,mitochondrial 136 Q9NSE4 IARS2Isoleucine--tRNA 793-803 ELSNFYFSIIK 26 Enzymes ligase,mitochondrial P14735 IDEInsulin-degrading 312-324 NLYVTFPIPDLQK 4 Enzymes enzyme P48735 IDH2Isocitrate 244-251 WPLYMSTK 36 Enzymes dehydrogenase P13284 IFI30Gamma-interferon- 129-157 VEACVLDELDMELA 9 Enzymes induciblelysosomalthiol FLTIVCMEEFEDMER reductase Q9NZI8 IGF2BP1Insulin-likegrowth 509-525 TVNELQNLTAAEVV 313 Channels, factor2mRNA-binding VPR Transporters, protein Receptors Q12905 ILF2Interleukinenhancer- 329-356 ILGQEGDASYLASEIS 4 Transcription bindingfactor2 TWDGVIVTPSEK factors, Regulators Q12905 ILF2Interleukinenhancer- 81-103 INNVIDNLIVAPGTFE 134 Transcription bindingfactor2 VQIEEVR factors, Regulators A1L0T0 ILVBLAcetolactatesynthase- 557-577 EQVPSLGSNVACGL 13 Enzymes likeprotein AYTDYHK Q16891 IMMTMitochondrialinner 345-353 VQAAQSEAK 436 Uncategorized membraneprotein Q16891 IMMTMitochondrialinner 527-545 LSQEQVDNFTLDINT 13146 Uncategorized membraneprotein AYAR 8 Q16891 IMMTMitochondrialinner 548-564 GIEQAVQSHAVAEEE 1346 Uncategorized membraneprotein AR P12268 IMPDH2Inosine-5- 110-124 YEQGFITDPVVLSPK 13 Enzymes monophosphate dehydrogenase2 Q8TEX9 IPO4Importin-4 163-182 LLNETLGEVGSPGLL 4 Channels, FYSLR Transporters, Receptors O00410 IPO5Importin-5 721-735 VAAAESMPLLLECA 14213 Channels, R 8 Transporters, Receptors O95373 IPO7Importin-7 411-427 TMGFCYQILTEPNAD 13 Channels, PR Transporters, Receptors Q96P70 IPO9Importin-9 49-74 VLEVTEEFGVHLAEL 14 Channels, TVDPQGALAIR Transporters, Receptors O14654 IRS4Insulinreceptor 256-267 LCLTDEEVVFVR 14 Uncategorized substrate4 Q92945 KHSRPFarupstream 629-646 IGQQPQQPGAPPQQD 26 Transcription element-bindingprotein2 YTK factors, Regulators P52732 KIF11Kinesin-likeprotein 158-181 VSLLEIYNEELFDLL 6 Adapter, KIF11 NPSSDVSER Scaffolding, Modulator Proteins P52292 KPNA2Importinsubunit 203-227 YGAVDPLLALLAVP 1413 Channels, alpha-2 DMSSLACGYLR Transporters, Receptors P52292 KPNA2Importinsubunit 301-315 LLGASELPIVTPALR 13 Channels, alpha-2 Transporters, Receptors Q14974 KPNB1Importinsubunit 317-332 GALQYLVPILTQTLT 1413 Channels, beta-1 K Transporters, Receptors Q14974 KPNB1Importinsubunit 28-42 AAVENLPTFLVELSR 1413 Channels, beta-1 Transporters, Receptors Q14974 KPNB1Importinsubunit 526-537 SSAYESLMEIVK 1314 Channels, beta-1 Transporters, Receptors P13473 LAMP2Lysosome-associated 133-144 GILTVDELLAIR 149 Uncategorized membraneglycoprotein2 Q9P2J5 LARSLeucine--tRNAligase, 1007-1017 ILDLQLEFDEK 13 Enzymes cytoplasmic P00338 LDHAL-lactate 43-57 DLADELALVDVIEDK 9 Enzymes dehydrogenaseAchain P07195 LDHBL-lactate 234-244 MVVESAYEVIK 4 Enzymes dehydrogenaseBchain O95202 LETM1LETM1andEF-hand 452-463 VAEVEGEQVDNK 13144 Uncategorized domain-containingprotein1, 38 mit Q08380 LGALS3BPGalectin-3- 522-541 ALMLCEGLFVADVT 9 Uncategorized bindingprotein DFEGWK Q99538 LGMNLegumain 102-118 DYTGEDVTPQNFLA 9 Enzymes VLR P38571 LIPALysosomalacid 255-270 ELCGNLCFLLCGFNE 14 Enzymes lipase/cholesterylester R hydrolase P02545 LMNAPrelamin-A/C 63-72 ITESEEVVSR 6 Uncategorized P02545 LMNAPrelamin-A/C 172-180 LEAALGEAK 3 Uncategorized P02545 LMNAPrelamin-A/C 209-216 NIYSEELR 6 Uncategorized P02545 LMNAPrelamin-A/C 281-296 NSNLVGAAHEELQQ 6 Uncategorized SR P02545 LMNAPrelamin-A/C 352-366 MQQQLDEYQELLDI 136 Uncategorized K P20700 LMNB1Lamin-B1 321-330 IQELEDLLAK 6 Uncategorized P20700 LMNB1Lamin-B1 80-90 ALYETELADAR 13 Uncategorized P20700 LMNB1Lamin-B1 351-367 DQMQQQLNDYEQLL 148 Uncategorized DVK P20700 LMNB1Lamin-B1 210-220 SMYEEEINETR 13 Uncategorized P20700 LMNB1Lamin-B1 52-67 SLETENSALQLQVTE 13146 Uncategorized R 8 Q03252 LMNB2Lamin-B2 106-113 AELDEVNK 6 Uncategorized Q03252 LMNB2Lamin-B2 74-84 ALYESELADAR 13 Uncategorized Q03252 LMNB2Lamin-B2 139-150 SEVELAAALSDK 13 Uncategorized P36776 LONP1Lonprotease 598-632 GYQGDPSSALLELLD 136 Transcription homolog,mitochondrial PEQNANFLDHYLDV factors, PVDLSK Regulators Q96AG4 LRRC59Leucine-richrepeat- 268-292 VTELQQQPLCTSVNT 13142 Uncategorized containingprotein59 IYDNAVQGLR 8 P09960 LTA4HLeukotrieneA-4 366-386 LVVDLTDIDPDVAYS 1348 Enzymes hydrolase SVPYEK O00754 MAN2B1Lysosomalalpha- 291-305 ELVDYFLNVATAQG 14 Enzymes mannosidase R O00754 MAN2B1Lysosomalalpha- 614-638 ATFDPDTGLLMEIMN 9 Enzymes mannosidase MNQQLLLPVR Q9Y2E5 MAN2B2Epididymis-specific 642-664 AAVPAWEAVEMEIV 9 Enzymes alpha-mannosidase AGQLVTEIR Q15691 MAPRE1Microtubule- 223-241 NIELICQENEGENDP 13 Adapter, associatedproteinRP/EB VLQR Scaffolding, familymember Modulator Proteins Q8NI22 MCFD2Multiplecoagulation 103-126 EEGSEQAPLMSEDEL 14 Channels, factordeficiencyprotein2 INIIDGVLR Transporters, Receptors P49736 MCM2DNAreplication 797-807 VMLESFIDTQK 13 Transcription licensingfactorMCM2 factors, Regulators P33991 MCM4DNAreplication 502-516 AEINILLCGDPGTSK 15 Transcription licensingfactorMCM4 factors, Regulators P33991 MCM4DNAreplication 517-529 SQLLQYVYNLVPR 6 Transcription licensingfactorMCM4 factors, Regulators Q14566 MCM6DNAreplication 59-85 NTLVVSFVDLEQFNQ 14153 Transcription licensingfactorMCM6 QLSTTIQEEFYR 6 factors, Regulators Q14696 MESDC2LDLRchaperone 113-127 TLMMFVTVSGSPTE 2 Chaperones MESD K Q9H8H3 METTL7AMethyltransferase- 94-105 VTCIDPNPNFEK 13 Enzymes likeprotein7A P46013 MKI67AntigenKI-67 648-659 SGASEANLIVAK 8 Transcription factors, Regulators Q7Z7F7 MRPL5539Sribosomal 59-67 QDGSTIHIR 6 Uncategorized proteinL55,mitochondrial P43246 MSH2DNAmismatchrepair 848-871 ALELEEFQYIGESQG 14 Transcription proteinMsh2 YDIMEPAAK factors, Regulators P00403 MT-CO2Cytochromec 142-151 VVLPIEAPIR 6 Channels, oxidasesubunit2 Transporters, Receptors P03891 MT-ND2NADH-ubiquinone 264-272 WAIIEEFTK 14 Enzymes oxidoreductasechain2 Q9NZJ7 MTCH1Mitochondrialcarrier 65-103 MDGGSGGLGSGDNA 142 Channels, homolog1 PTTEALFVALGAGVT Transporters, ALSHPLLYVK Receptors Q86UE4 MTDHProteinLYRIC 42510 SWQDELAQQAEEGS 1442 Uncategorized AR 138 Q86UE4 MTDHProteinLYRIC 34-45 TELGLDLGLEPK 13144 Uncategorized 298 Q9UDX5 MTFP1Mitochondrialfission 21-33 YLGYANEVGEAFR 13142 Uncategorized processprotein1 9 Q9UDX5 MTFP1Mitochondrialfission 103-116 VCAASLYVLGTATR 14 Uncategorized processprotein1 Q6UB35 MTHFD1LMonofunctional 307-326 IHFGGLIEEDDVILLA 6 Enzymes C1-tetrahydrofolatesynthase, AALR mitochondrial Q13505 MTX1Metaxin-1 238-252 QGADTLAFMSLLEE 14342 Channels, K 68 Transporters, Receptors P35580 MYH10Myosin-10 1546-1562 TQLEELEDELQATED 1369 Adapter, AK Scaffolding, Modulator Proteins P35580 MYH10Myosin-10 1684-1701 SLEAEILQLQEELASS 14136 Adapter, ER Scaffolding, Modulator Proteins P35580 MYH10Myosin-10 1738-1758 IAQLEEELEEEQSNM 6 Adapter, ELLNDR Scaffolding, Modulator Proteins P35580 MYH10Myosin-10 1814-1822 ATISALEAK 6 Adapter, Scaffolding, Modulator Proteins P35580 MYH10Myosin-10 248-268 INFDVTGYIVGANIET 69 Adapter, YLLEK Scaffolding, Modulator Proteins P35580 MYH10Myosin-10 890-910 NILAEQLQAETELFA 13146 Adapter, EAEEMR 9 Scaffolding, Modulator Proteins P35579 MYH9Myosin-9 1539-1555 TQLEELEDELQATED 13 Adapter, AK Scaffolding, Modulator Proteins P35579 MYH9Myosin-9 1677-1694 SMEAEMIQLQEELA 13 Adapter, AAER Scaffolding, Modulator Proteins Q9BXJ9 NAA15N-alpha- 798-818 NLQTCMEVLEALYD 1442 Transcription acetyltransferase15,NatA GSLGDCK factors, auxiliarysubunit Regulators P54802 NAGLUAlpha-N- 566-580 QAVQELVSLYYEEA 9 Enzymes acetylglucosaminidase R P54802 NAGLUAlpha-N- 594-615 AGGVLAYELLPALD 1315 Enzymes acetylglucosaminidase EVLASDSR P43490 NAMPTNicotinamide 175-189 YLLETSGNLDGLEYK 131415 Enzymes phosphoribosyltransferase 368 P55209 NAP1L1Nucleosome 95-104 FYEEVHDLER 34136 Uncategorized assemblyprotein1-like1 98 P55209 NAP1L1Nucleosome 177-194 NVDLLSDMVQEHDE 6 Uncategorized assemblyprotein1-like1 PILK P55209 NAP1L1Nucleosome 56-72 LDGLVETPTGYIESLP 14429 Uncategorized assemblyprotein1-like1 R Q99733 NAP1L4Nucleosome 84-93 FYEEVHDLER 34136 Uncategorized assemblyprotein1-like4 98 P49321 NASPNuclearautoantigenic 503-526 SLQENEEEEIGNLEL 13148 Channels, spermprotein AWDMLDLAK Transporters, Receptors P49321 NASPNuclearautoantigenic 77-93 YGETANECGEAFFFY 13 Channels, spermprotein GK Transporters, Receptors Q9H0A0 NAT10N-acetyltransferase 600-625 ASGDLIPWTVSEQFQ 133 Enzymes 10 DPDFGGLSGGR Q09161 NCBP1Nuclearcap-binding 42-65 SACSLESNLEGLAGV 13143 Channels, proteinsubunit1 LEADLPNYK 2 Transporters, Receptors P28331 NDUFS1NADH-ubiquinone 312-325 GLLTYTSWEDALSR 14 Enzymes oxidoreductase75kDa subunit,mit Q9UMX5 NENFNeudesin 85-94 GAPYNALTGK 6 Adapter, Scaffolding, Modulator Proteins P55769 NHP2L1NHP2-likeprotein1 114-125 QQIQSIQQSIER 326 Transcription factors, Regulators Q9BPW8 NIPSNAP1ProteinNipSnap 255-268 GWDENVYYTVPLVR 46 Uncategorized homolog1 Q9Y3T9 NOC2LNucleolarcomplex 591-606 VSFGVSEQQAVEAW 2 Transcription protein2homolog EK factors, Regulators Q15233 NONONon-POUdomain- 127-135 VELDNMPLR 3 Transcription containingoctamer-binding factors, protein Regulators Q15233 NONONon-POUdomain- 257-270 FAQPGSFEYEYAMR 6 Transcription containingoctamer-binding factors, protein Regulators Q15233 NONONon-POUdomain- 296-304 LEMEMEAAR 6 Transcription containingoctamer-binding factors, protein Regulators Q15233 NONONon-POUdomain- 154-176 NLPQYVSNELLEEAF 13143 Transcription containingoctamer-binding SVFGQVER 269 factors, protein Regulators Q15233 NONONon-POUdomain- 177-184 AVVIVDDR 6 Transcription containingoctamer-binding factors, protein Regulators Q15233 NONONon-POUdomain- 326-336 MEELHNQEVQK 13 Transcription containingoctamer-binding factors, protein Regulators Q15233 NONONon-POUdomain- 435-456 FGQAATMEGIGAIGG 6 Transcription containingoctamer-binding TPPAFNR factors, protein Regulators P06748 NPM1Nucleophosmin 278-291 MTDQEAIQDLWQW 13 Chaperones R P06748 NPM1Nucleophosmin 33-45 VDNDENEHQLSLR 13 Chaperones P06748 NPM1Nucleophosmin 55-73 DELHIVEAEAMNYE 13 Chaperones GSPIK P06748 NPM1Nucleophosmin 81-101 MSVQPTVSLGGFEIT 13 Chaperones PPVVLR Q08J23 NSUN2tRNA(cytosine(34)- 603-618 LAQEGIYTLYPFINSR 36 Transcription C(5))-methyltransferase factors, Regulators Q9BV86 NTMT1N-terminalXaa-Pro- 167-185 DNMAQEGVILDDVD 13 Enzymes LysN-methyltransferase1 SSVCR Q02818 NUCB1Nucleobindin-1 54-69 YLQEVIDVLETDGHF 13142 Transcription R 436 factors, Regulators P80303 NUCB2Nucleobindin-2 60-69 QVIDVLETDK 4136 Transcription factors, Regulators Q9BQG2 NUDT12PeroxisomalNADH 143-166 ESHPATVFILFSDLNP 15 Enzymes pyrophosphataseNUDT12 LVTLGGNK A8MXV4 NUDT19Nucleoside 223-252 EPPPVYPDLAEVVGY 6 Enzymes diphosphate-linkedmoietyX QWSSPSEATESFLSK motif19,mitochondrial O75694 NUP155Nuclearpore 952-968 HGEPEEDIVGLQAFQ 13 Channels, complexproteinNup155 ER Transporters, Receptors Q12769 NUP160Nuclearpore 638-661 AAEQILEDMITIDVE 14 Channels, complexproteinNup160 NVMEDICSK Transporters, Receptors Q92621 NUP205Nuclearpore 1235-1252 VLVAEVNALQGMA 14 Channels, complexproteinNup205 AIGQR Transporters, Receptors P35658 NUP214Nuclearpore 770-783 TTLLEGFAGVEEAR 14 Channels, complexproteinNup214 Transporters, Receptors Q8NFH4 NUP37NucleoporinNup37 136-150 EGQEIASVSDDHTCR 139 Channels, Transporters, Receptors Q8N1F7 NUP93Nuclearporecomplex 539-545 FESTDPR 4 Channels, proteinNup93 Transporters, Receptors P61970 NUTF2Nucleartransport 91-106 ADEDPIMGFHQMFL 14 Channels, factor2 LK Transporters, Receptors Q6DKJ4 NXNNucleoredoxin 384-403 DYTNLPEAAPLLTIL 14 Enzymes DMSAR P04181 OATOrnithine 33-46 TVQGPPTSDDIFER 1413 Enzymes aminotransferase, mitochondrial P04181 OATOrnithine 332-351 VAIAALEVLEEENLA 1413 Enzymes aminotransferase, ENADK mitochondrial Q9NX40 OCIAD1OCIAdomain- 34-46 VFAECNDESFWFR 132 Uncategorized containingprotein1 O60313 OPA1Dynamin-like120kDa 801-818 CNEEHPAYLASDEIT 13 Enzymes protein,mitochondrial TVR P07237 P4HBProteindisulfide- 133-162 TGPAATTLPDGAAA 1439 Chaperones isomerase ESLVESSEVAVIGFFK P07237 P4HBProteindisulfide- 171-195 QFLQAAEAIDDIPFGI 9 Chaperones isomerase TSNSDVFSK P07237 P4HBProteindisulfide- 231-247 HNQLPLVIEFTEQTA 14213 Chaperones isomerase PK P11940 PABPC1Polyadenylate- 114-129 ALYDTFSAFGNILSC 14 Transcription bindingprotein1 K factors, Regulators P11940 PABPC1Polyadenylate- 51-67 SLGYAYVNFQQPAD 143 Transcription bindingprotein1 AER factors, Regulators P11940 PABPC1Polyadenylate- 581-604 ITGMLLEIDNSELLH 14 Transcription bindingprotein1 MLESPESLR factors, Regulators Q13310 PABPC4Polyadenylate- 51-67 SLGYAYVNFQQPAD 143 Transcription bindingprotein4 AER factors, Regulators Q13310 PABPC4Polyadenylate- 590-613 ITGMLLEIDNSELLH 14 Transcription bindingprotein4 MLESPESLR factors, Regulators Q13310 PABPC4Polyadenylate- 114-129 ALYDTFSAFGNILSC 14 Transcription bindingprotein4 K factors, Regulators P09874 PARP1Poly 762-779 VEMLDNLLDIEVAYS 36 Transcription LLR factors, Regulators P09874 PARP1Poly 954-1000 TTPDPSANISLDGVD 3 Transcription VPLGTGISSGVNDTS factors, LLYNEYIVYDIAQVN Regulators LK Q16822 PCK2Phosphoenolpyruvate 245-261 EIISFGSGYGGNSLLG 141513 Enzymes carboxykinase K P22061 PCMT1Protein-L- 179-197 LILPVGPAGGNQMLE 1432 Enzymes isoaspartate(D-aspartate) QYDK O-methyltransferase P12004 PCNAProliferatingcell 118-138 LMDLDVEQLGIPEQE 14 Transcription nuclearantigen YSCVVK factors, Regulators Q9UHG3 PCYOX1Prenylcysteine 267-280 SNLISGSVMYIEEK 149 Enzymes oxidase1 Q9UHG3 PCYOX1Prenylcysteine 292-304 MYEVVYQIGTETR 9 Enzymes oxidase1 Q9UHG3 PCYOX1Prenylcysteine 152-162 MHMWVEDVLDK 413 Enzymes oxidase1 Q9UHG3 PCYOX1Prenylcysteine 37-54 IAIIGAGIGGTSAAYY 14 Enzymes oxidase1 LR Q53EL6 PDCD4Programmedcell 246-256 DLPELALDTPR 13 Transcription deathprotein4 factors, Regulators P11177 PDHBPyruvate 53-68 VFLLGEEVAQYDGA 13143 Enzymes dehydrogenaseE1component YK 2 subunitbeta, P13667 PDIA4Proteindisulfide- 486-499 FAMEPEEFDSDTLR 9 Enzymes isomeraseA4 Q29RF7 PDS5ASisterchromatid 638-657 SIEGTADDEEEGVSP 13 Uncategorized cohesionproteinPDS5 DTAIR homologA Q99471 PFDN5Prefoldinsubunit5 20-37 NQLDQEVEFLSTSIA 2 Chaperones QLK P07737 PFN1Profilin-1 39-54 TFVNITPAEVGVLVG 13 Adapter, K Scaffolding, Modulator Proteins P07737 PFN1Profilin-1 76-89 DSLLQDGEFSMDLR 138 Adapter, Scaffolding, Modulator Proteins P00558 PGK1Phosphoglycerate 333-350 QIVWNGPVGVFEWE 3 Enzymes kinase1 AFAR O00264 PGRMC1Membrane- 106-119 FYGPEGPYGVFAGR 14243 Channels, associatedprogesterone 13 Transporters, receptorcomponent Receptors O00264 PGRMC1Membrane- 48-67 GDQPAASGDSDDDE 13142 Channels, associatedprogesterone PPPLPR 48 Transporters, receptorcomponent Receptors O15173 PGRMC2Membrane- 136-149 FYGPAGPYGIFAGR 4 Channels, associatedprogesterone Transporters, receptorcomponent Receptors P35232 PHBProhibitin 220-239 AAELIANSLATAGDG 9 Uncategorized LIELR P35232 PHBProhibitin 241-253 LEAAEDIAYQLSR 14 Uncategorized P35232 PHBProhibitin 42501 VFESIGK 13 Uncategorized Q99623 PHB2Prohibitin-2 38-48 ESVFTVEGGHR 26 Channels, Transporters, Receptors Q99623 PHB2Prohibitin-2 55-71 IGGVQQDTILAEGLH 3426 Channels, FR Transporters, Receptors Q99623 PHB2Prohibitin-2 225-236 IVQAEGEAEAAK 6 Channels, Transporters, Receptors O43175 PHGDHD-3- 295-308 CGEEIAVQFVDMVK 13 Enzymes phosphoglycerate dehydrogenase P48739 PITPNBPhosphatidylinositol 32-44 NETGGGEGIEVLK 143 Adapter, transferproteinbeta Scaffolding, isoform Modulator Proteins Q5JRX3 PITRM1Presequence 364-385 ALIESGLGTDFSPDV 14213 Enzymes protease,mitochondrial GYNGYTR 86 P14618 PKMPyruvatekinase 174-186 IYVDDGLISLQVK 29 Enzymes isozymesM1/M2 P14618 PKMPyruvatekinase 401-422 LAPITSDPTEATAVG 29 Enzymes isozymesM1/M2 AVEASFK Q8IV08 PLD3PhospholipaseD3 425-453 ATYIGTSNWSGNYFT 369 Enzymes ETAGTSLLVTQNGR P13797 PLS3Plastin-3 72-85 ISFDEFVYIFQEVK 14 Uncategorized Q10713 PMPCAMitochondrial- 443-451 PVIFEDVGR 1486 Enzymes processingpeptidase subunitalpha O75439 PMPCBMitochondrial- 406-424 TNMLLQLDGSTPICE 13 Enzymes processingpeptidase DIGR subunitbeta Q9Y2S7 POLDIP2Polymerasedelta- 166-199 ALYAIPGLDYVSHED 6 Uncategorized interactingprotein2 ILPYTSTDQVPIQHEL FER O00411 POLRMTDNA-directed 482-502 MLLQVLQALPAQGE 14326 Enzymes RNApolymerase, SFTTLAR mitochondrial P16435 PORNADPH--cytochrome 369-382 TALTYYLDITNPPR 1314 Enzymes P450reductase P62136 PPP1CASerine/threonine- 133-141 IYGFYDECK 2 Enzymes proteinphosphatasePP1- alphacat P62140 PPP1CBSerine/threonine- 132-140 IYGFYDECK 2 Enzymes proteinphosphatasePP1- betacata P62140 PPP1CBSerine/threonine- 43-59 EIFLSQPILLELEAPL 14 Enzymes proteinphosphatasePP1- K betacata P36873 PPP1CCSerine/threonine- 44-60 EIFLSQPILLELEAPL 14 Enzymes proteinphosphatasePP1- K gammacat P36873 PPP1CCSerine/threonine- 133-141 IYGFYDECK 2 Enzymes proteinphosphatasePP1- gammacat P50897 PPT1Palmitoyl-protein 75-101 TLMEDVENSFFLNV 131415 Enzymes thioestemse1 NSQVTTVCQALAK 4298 P32119 PRDX2Peroxiredoxin-2 120-127 TDEGIAYR 13 Enzymes P78527 PRKDCDNA-dependent 3030-3046 IWSEPFYQETYLPYM 14 Enzymes proteinkinasecatalytic IR subunit P78527 PRKDCDNA-dependent 758-782 LGLSYTPLAEVGLNA 14 Enzymes proteinkinasecatalytic LEEWSIYIDR subunit P78527 PRKDCDNA-dependent 380-391 DVDFMYVELIQR 13 Enzymes proteinkinasecatalytic subunit Q99873 PRMT1ProteinarginineN- 186-196 ATLYVTAIEDR 14 Enzymes methyltransferase1 Q9UMS4 PRPF19Pre-mRNA- 77-93 ALQDEWDAVMLHSF 4 Adapter, processingfactor19 TLR Scaffolding, Modulator Proteins P07602 PSAPProactivator 108-122 EIVDSYLPVILDIIK 13143 Adapter, polypeptide 24156 Scaffolding, 98 Modulator Proteins P07602 PSAPProactivator 263-275 EICALVGFCDEVK 14 Adapter, polypeptide Scaffolding, Modulator Proteins P07602 PSAPProactivator 311-323 SDVYCEVCEFLVK 1349 Adapter, polypeptide 8 Scaffolding, Modulator Proteins P07602 PSAPProactivator 430-438 QEILAALEK 26 Adapter, polypeptide Scaffolding, Modulator Proteins P07602 PSAPProactivator 439-449 GCSFLPDPYQK 149 Adapter, polypeptide Scaffolding, Modulator Proteins P07602 PSAPProactivator 450-478 QCDQFVAEYEPVLIE 1449 Adapter, polypeptide ILVEVMDPSFVCLK Scaffolding, Modulator Proteins P07602 PSAPProactivator 68-78 DVVTAAGDMLK 1449 Adapter, polypeptide Scaffolding, Modulator Proteins P25787 PSMA2Proteasomesubunit 144-159 PYLFQSDPSGAYFA 2 Enzymes alphatype-2 WK P25787 PSMA2Proteasomesubunit 19-39 LVQIEYALAAVAGG 3 Enzymes alphatype-2 APSVGIK P25789 PSMA4Proteasomesubunit 68-91 LNEDMACSVAGITSD 13143 Enzymes alphatype-4 ANVLTNELR 68 P20618 PSMB1Proteasomesubunit 129-146 FFPYYVYNIIGGLDE 13142 Enzymes betatype-1 EGK 15 P49721 PSMB2Proteasomesubunit 96-126 TPYHVNLLLAGYDE 26 Enzymes betatype-2 HEGPALYYMDYLAA LAK P49721 PSMB2Proteasomesubunit 42-62 ILLLCVGEAGDTVQF 6 Enzymes betatype-2 AEYIQK P49720 PSMB3Proteasomesubunit 100-115 FGPYYTEPVIAGLDP 131415 Enzymes betatype-3 K 36 P28070 PSMB4Proteasomesubunit 61-80 FEGGVVIAADMLGS 6 Enzymes betatype-4 YGSLAR P28074 PSMB5Proteasomesubunit 141-150 LLANMVYQYK 436 Enzymes betatype-5 P28074 PSMB5Proteasomesubunit 226-239 DAYSGGAVNLYHVR 6 Enzymes betatype-5 P28072 PSMB6Proteasomesubunit 80-118 SGSAADTQAVADAV 1436 Enzymes betatype-6 TYQLGFHSIELNEPPL VHTAASLFK O00231 PSMD1126Sproteasome 164-175 ALLVEVQLLESK 2 Uncategorized non-ATPaseregulatory subunit11 O00231 PSMD1126Sproteasome 227-246 TAYSYFYEAFEGYDS 24 Uncategorized non-ATPaseregulatory IDSPK subunit11 O00231 PSMD1126Sproteasome 298-304 SLADFEK 4 Uncategorized non-ATPaseregulatory subunit11 O43242 PSMD326Sproteasomenon- 242-256 HDADGQATLLNLLL 144 Uncategorized ATPaseregulatorysubunit3 R O43242 PSMD326Sproteasomenon- 426-440 LQLDSPEDAEFIVAK 14 Uncategorized ATPaseregulatorysubunit3 Q9UL46 PSME2Proteasomeactivator 132-145 IEDGNDFGVAIQEK 6 Uncategorized complexsubunit2 P61289 PSME3Proteasomeactivator 147-166 IEDGNNFGVSIQEET 14413 Uncategorized complexsubunit3 VAELR 8 P61289 PSME3Proteasomeactivator 167-181 TVESEAASYLDQISR 1348 Uncategorized complexsubunit3 P61289 PSME3Proteasomeactivator 22-36 ITSEAEDLVANFFPK 4 Uncategorized complexsubunit3 Q8WXF1 PSPC1Paraspeckle 229-247 PVIVEPMEQFDDEDG 146 Transcription component1 LPEK factors, Regulators P26599 PTBP1Polypyrimidinetract- 219-238 NNQFQALLQYADPV 14 Transcription bindingprotein1 SAQHAK factors, Regulators Q96EY7 PTCD3Pentatricopeptide 119-126 FIINSYPK 2 Transcription repeat-containingprotein3, factors, mit Regulators Q8N8N7 PTGR2Prostaglandin 93-106 GDFVTSFYWPWQTK 14 Enzymes reductase2 Q8N8N7 PTGR2Prostaglandin 262-278 DVPYPPPLSPAIEAIQ 1432 Enzymes reductase2 K Q9P035 PTPLAD13-hydroxyacyl- 133-146 LESEGSPETLTNLR 13 Enzymes CoAdehydratase3 Q9UHX1 PUF60Poly(U)-binding- 474-489 DIDDDLEGEVTEECG 1315 Transcription splicingfactorPUF60 K 1448 factors, Regulators Q5XKP0 QIL1ProteinQIL1 15-36 GSVAGGAVYLVYDQ 14 Uncategorized ELLGPSDK Q96PU8 QKIProteinquaking 192-205 MQLMELAILNGTYR 2 Channels, Transporters, Receptors P51149 RAB7ARas-relatedprotein 104-113 DEFLIQASPR 14 Adapter, Rab-7a Scaffolding, Modulator Proteins Q7Z6M1 RABEPKRab9effector 87-100 YEHASFIPSCTPDR 14 Uncategorized proteinwithkelchmotifs P11233 RALARas-relatedprotein 28-47 SALTLQFMYDEFVE 9 Transcription Ral-A DYEPTK factors, Regulators P54136 RARSArginine--tRNAligase, 528-540 GNTAAYLLYAFTR 14 Enzymes cytoplasmic Q96PK6 RBM14RNA-bindingprotein 224-238 ASYVAPLTAQPATY 6 Transcription 14 R factors, Regulators Q96PK6 RBM14RNA-bindingprotein 65-72 ALVVEMSR 6 Transcription 14 factors, Regulators P98179 RBM3PutativeRNA-binding 8-39 LFVGGLNFNTDEQA 1332 Transcription protein3 LEDHFSSFGPISEVVV 9 factors, VK Regulators P38159 RBMXRNA-bindingmotif 126-144 GGHMDDGGYSMNF 6 Transcription protein,Xchromosome NMSSSR factors, Regulators P38159 RBMXRNA-bindingmotif 23-30 ALEAVFGK 3136 Transcription protein,Xchromosome factors, Regulators P38159 RBMXRNA-bindingmotif 245-252 DYGHSSSR 3 Transcription protein,Xchromosome factors, Regulators P38159 RBMXRNA-bindingmotif 283-292 DSYESYGNSR 6 Transcription protein,Xchromosome factors, Regulators P38159 RBMXRNA-bindingmotif 299-309 GPPPSYGGSSR 6 Transcription protein,Xchromosome factors, Regulators P38159 RBMXRNA-bindingmotif 332-339 SDLYSSGR 6 Transcription protein,Xchromosome factors, Regulators P38159 RBMXRNA-bindingmotif 50-63 GFAFVTFESPADAK 6 Transcription protein,Xchromosome factors, Regulators Q96E39 RBMXL1RNAbindingmotif 299-309 GPPPSYGGSSR 6 Transcription protein,X-linked-like-1 factors, Regulators Q96E39 RBMXL1RNAbindingmotif 50-63 GFAFVTFESPADAK 6 Transcription protein,X-linked-like-1 factors, Regulators Q96E39 RBMXL1RNAbindingmotif 245-252 DYGHSSSR 3 Transcription protein,X-linked-like-1 factors, Regulators Q96E39 RBMXL1RNAbindingmotif 283-292 DSYESYGNSR 6 Transcription protein,X-linked-like-1 factors, Regulators Q96E39 RBMXL1RNAbindingmotif 126-144 GGHMDDGGYSMNF 6 Transcription protein,X-linked-like-1 NMSSSR factors, Regulators Q15293 RCN1Reticulocalbin-1 91-105 IDNDGDGFVTTEELK 13 Uncategorized Q14257 RCN2Reticulocalbin-2 283-305 LSEEEILENPDLFLTS 14315 Uncategorized EATDYGR 698 Q14257 RCN2Reticulocalbin-2 130-148 VIDFDENTALDDAEE 1396 Uncategorized ESFR Q14257 RCN2Reticulocalbin-2 217-232 WDPTANEDPEWILV 1446 Uncategorized EK Q14257 RCN2Reticulocalbin-2 96-103 HYAMQEAK 6 Uncategorized Q14257 RCN2Reticulocalbin-2 161-200 ANQDSGPGLSLEEFI 9 Uncategorized AFEHPEEVDYMTEF VIQEALEEHDK P35250 RFC2ReplicationfactorC 211-230 VPYTDDGLEAIIFTA 13 Transcription subunit2 QGDMR factors, Regulators P62888 RPL3060Sribosomalprotein 58-68 SEIEYYAMLAK 13 Uncategorized L30 P62917 RPL860Sribosomalprotein 129-144 ASGNYATVISHNPET 2 Transcription L8 K factors, Regulators P05387 RPLP260Sacidicribosomal 50-61 NIEDVIAQGIGK 14 Uncategorized proteinP2 P04843 RPN1Dolichyl- 152-169 QFVVFEGNHYFYSPY 6 Enzymes diphosphooligosaccharide-- PTK proteinglycosyltransferase subnit1 P04843 RPN1Dolichyl- 328-352 THYIVGYNLPSYEYL 6 Enzymes diphosphooligosaccharide-- YNLGDQYALK proteinglycosyltransferase subnit1 P04843 RPN1Dolichyl- 525-536 ALTSEIALLQSR 136 Enzymes diphosphooligosaccharide-- proteinglycosyltransferase subnit1 P04844 RPN2Dolichyl- 155-178 EETVLATVQALQTAS 6 Enzymes diphosphooligosaccharide-- HLSQQADLR proteinglycosyltransferase subunit2 P04844 RPN2Dolichyl- 179-190 SIVEEIEDLVAR 14313 Enzymes diphosphooligosaccharide-- 69 proteinglycosyltransferase subunit2 P04844 RPN2Dolichyl- 443-456 TGQEVVFVAEPDNK 9 Enzymes diphosphooligosaccharide-- proteinglycosyltransferase subunit2 P46783 RPS1040Sribosomalprotein 81-95 DYLHLPPEIVPATLR 313 Uncategorized S10 P23396 RPS340Sribosomalprotein 152-173 FVDGLMIHSGDPVN 6 Transcription S3 YYVDTAVR factors, Regulators P23396 RPS340Sribosomalprotein 28-40 ELAEDGYSGVEVR 136 Transcription S3 factors, Regulators P23396 RPS340Sribosomalprotein 46-54 TEIIILATR 6 Transcription S3 factors, Regulators P23396 RPS340Sribosomalprotein 77-90 FGFPEGSVELYAEK 26 Transcription S3 factors, Regulators P62241 RPS840Sribosomalprotein 158-170 ISSLLEEQFQQGK 13 Uncategorized S8 Q9NQC3 RTN4Reticulon-4 1075-1090 AYLESEVAISEELVQ 1314 Uncategorized K Q9Y265 RUVBL1RuvB-like1 318-333 ALESSIAPIVIFASNR 2 Enzymes Q9Y265 RUVBL1RuvB-like1 91-107 VPFCPMVGSEVYSTE 2 Enzymes IK Q9Y230 RUVBL2RuvB-like2 315-330 ALESDMAPVLIMAT 14 Transcription NR factors, Regulators Q9Y512 SAMM50Sortingand 128-148 LTGSYNTMVGNNEG 144 Uncategorized assemblymachinery SMVLGLK component50homolo Q8NBX0 SCCPDHSaccharopine 145-167 GVYIIGSSGFDSIPAD 14 Enzymes dehydrogenase-like LGVIYTR oxidoreductase Q9HB40 SCPEP1Retinoid-inducible 256-275 AEMIIEQNTDGVNFY 131415 Enzymes serinecarboxypeptidase NILTK 3246 98 Q01105 SETProteinSET 91-122 IPNFWVTTFVNHPQV 3 Chaperones SALLGEEDEEALHYL TR P23246 SFPQSplicingfactor, 377-399 NLSPYVSNELLEEAF 13143 Transcription proline-andglutamine- SQFGPIER 249 factors, rich Regulators P23246 SFPQSplicingfactor, 444-462 PVIVEPLEQLDDEDG 1442 Transcription proline-andglutamine- LPEK factors, rich Regulators Q9H9B4 SFXN1Sideroflexin-1 36-48 NILLTNEQLESAR 14 Channels, Transporters, Receptors Q9H9B4 SFXN1Sideroflexin-1 137-170 SGDAPLTVNELGTA 14 Channels, YVSATTGAVATALG Transporters, LNALTK Receptors Q9H9B4 SFXN1Sideroflexin-1 56-70 QGIVPPGLTENELWR 14 Channels, Transporters, Receptors Q9H9B4 SFXN1Sideroflexin-1 93-112 MSAQVPMNMTITGC 6 Channels, MMTFYR Transporters, Receptors Q9H9B4 SFXN1Sideroflexin-1 234-253 ILMAAPGMAIPPFIM 6 Channels, NTLEK Transporters, Receptors Q6P4A7 SFXN4Sideroflexin-4 43-66 FLQWTELLDPTNVFI 142 Channels, SVESIENSR Transporters, Receptors O95470 SGPL1Sphingosine-1- 42699 AFEPYLEILEVYSTK 14 Enzymes phosphatelyase1 Q9Y371 SH3GLB1Endophilin-B1 22-29 AVQFTEEK 48 Adapter, Scaffolding, Modulator Proteins P34897 SHMT2Serine 105-121 YYGGAEVVDEIELLC 131415 Enzymes hydroxymethyltransferase, QR 328 mitochondrial Q9UBX3 SLC25A10Mitochondrial 171-186 GALVTVGQLSCYDQ 14 Channels, dicarboxylatecarrier AK Transporters, Receptors O75746 SLC25A12Calcium-binding 260-283 YGQVTPLEIDILYQL 144 Channels, mitochondrialcarrier ADLYNASGR Transporters, proteinAral Receptors 075746 SLC25A12Calcium-binding 641-652 LATATFAGIENK 144 Channels, mitochondrialcarrier Transporters, proteinAral Receptors Q9UJS0 SLC25A13Calcium-binding 293-310 IAPLEEGTLPFNLAEA 46 Channels, mitochondrialcarrier QR Transporters, proteinAral Receptors Q9UJS0 SLC25A13Calcium-binding 261-282 FGQVTPMEVDILFQL 14153 Channels, mitochondrialcarrier ADLYEPR 426 Transporters, proteinAral Receptors Q9UJS0 SLC25A13Calcium-binding 642-653 LAVATFAGIENK 1443 Channels, mitochondrialcarrier 1568 Transporters, proteinAral Receptors Q6NUK1 SLC25A24Calcium-binding 454-469 VLPAVGISYVVYEN 2 Channels, mitochondrialcarrier MK Transporters, proteinSCaM Receptors Q00325 SLC25A3Phosphatecarrier 146-161 VLYSNMLGEENTYL 4 Channels, protein,mitochondrial WR Transporters, Receptors Q00325 SLC25A3Phosphatecarrier 162-187 TSLYLAASASAEFFA 4 Channels, protein,mitochondrial DIALAPMEAAK Transporters, Receptors Q9H2D1 SLC25A32Mitochondrial 118-145 LEATEYLVSAAEAG 14 Channels, folatetransporter/carrier AMTLCITNPLWVTK Transporters, Receptors P12235 SLC25A4ADP/ATP 189-199 AAYFGVYDTAK 1428 Channels, translocase1 4 Transporters, Receptors Q8TBP6 SLC25A40Solutecarrier 136-152 LGENETCIPIVAGIVA 14 Channels, family25member40 R Transporters, Receptors P05141 SLC25A5ADP/ATP 42697 DFLAGGVAAAISK 1424 Channels, translocase2 Transporters, Receptors P05141 SLC25A5ADP/ATP 189-199 AAYFGIYDTAK 14243 Channels, translocase2 98 Transporters, Receptors P12236 SLC25A6ADP/ATP 42697 DFLAGGIAAAISK 1442 Channels, translocase3 13 Transporters, Receptors P12236 SLC25A6ADP/ATP 189-199 AAYFGVYDTAK 1428 Channels, translocase3 4 Transporters, Receptors Q8IXU6 SLC35F2Solutecarrier 188-221 EDNSGSDVLIGDILV 9 Channels, family35memberF2 LLGASLYAISNVCEE Transporters, YIVK Receptors Q9H2G2 SLKSTE20-like 27-47 DLNPEDFWEIIGELG 6 Enzymes serine/threonine-protein DGAFGK kinase Q92922 SMARCC1SWI/SNF 894-905 SLVALLVETQMK 13 Transcription complexsubunitSMARCC1 factors, Regulators Q14683 SMC1AStructural 1070-1086 FNACFESVATNIDEIY 8 Adapter, maintenanceofchromosomes K Scaffolding, protein1A Modulator Proteins Q9H7B4 SMYD3SETandMYND 255-265 DQYCFECDCFR 9 Enzymes domain-containingprotein3 Q96DI7 SNRNP40U5smallnuclear 233-260 GHADSVTGLSLSSEG 13 Uncategorized ribonucleoprotein40kDa SYLLSNAMDNTVR protein P62314 SNRPD1Smallnuclear 67-86 YFILPDSLPLDTLLVD 13 Uncategorized ribonucleoproteinSmD1 VEPK Q13813 SPTAN1Spectrinalphachain, 2354-2382 SLGYDLPMVEEGEP 1314 Adapter, non-erythrocytic1 DPEFEAILDTVDPNR Scaffolding, Modulator Proteins Q01082 SPTBN1Spectrinbetachain, 1706-1717 EVDDLEQWIAER 13 Adapter, non-erythrocytic1 Scaffolding, Modulator Proteins Q9UHB9 SRP68Signalrecognition 312-333 IFLLGLADNEAAIVQ 1413 Transcription particle68kDaprotein AESEETK factors, Regulators Q04837 SSBP1Single-strandedDNA- 67-81 SGDSEVYQLGDVSQ 138 Transcription bindingprotein, K factors, mitochondrial Regulators Q8N3U4 STAG2CohesinsubunitSA-2 273-290 ELQENQDEIENMMN 13 Uncategorized AIFK P31948 STIP1Stress-induced- 416-429 DCEECIQLEPTFIK 14 Uncategorized phosphoprotein1 Q9UJZ1 STOML2Stomatin-like 58-72 ILEPGLNILIPVLDR 6 Adapter, protein2 Scaffolding, Modulator Proteins Q9UJZ1 STOML2Stomatin-like 35-51 NTVVLFVPQQEAWV 6 Adapter, protein2 VER Scaffolding, Modulator Proteins Q9UJZ1 STOML2Stomatin-like 115-135 ASYGVEDPEYAVTQ 138 Adapter, protein2 LAQTTMR Scaffolding, Modulator Proteins P46977 STT3ADolichyl- 330-340 FYSLLDPSYAK 14 Enzymes diphosphooligosaccharide-- proteinglycosy P46977 STT3ADolichyl- 59-67 FLAEEGFYK 6 Enzymes diphosphooligosaccharide-- proteinglycosy P46977 STT3ADolichyl- 672-690 DFELDVLEEAYTIEH 6 Enzymes diphosphooligosaccharide-- WLVR proteinglycosy P46977 STT3ADolichyl- 572-595 ELDVSYVLVIFGGLT 9 Enzymes diphosphooligosaccharide-- GYSSDDINK proteinglycosy Q8TCJ2 STT3BDolichyl- 692-703 ESDYFTPQGEFR 14 Enzymes diphosphooligosaccharide-- proteinglycosy Q8TCJ2 STT3BDolichyl- 651-674 TLDVDYVLVIFGGVI 9 Enzymes diphosphooligosaccharide-- GYSGDDINK proteinglycosy Q96I99 SUCLG2Succinyl-CoAligase 151-160 ETYLAILMDR 3 Enzymes O15260 SURF4Surfeitlocusprotein4 31-43 LCLISTFLEDGIR 1314 Uncategorized O60506 SYNCRIPHeterogeneous 344-356 NLANTVTEEILEK 96 Transcription nuclearribonucleoproteinQ factors, Regulators Q92804 TAF15TATA-binding 284-297 GEATVSFDDPPSAK 2 Transcription protein-associatedfactor2N factors, Regulators Q92804 TAF15TATA-binding 423-431 SGGGYGGDR 6 Transcription protein-associatedfactor2N factors, Regulators Q12788 TBL3Transducinbeta-like 755-766 AALEALLPYTER 138 Uncategorized protein3 P52888 THOP1Thimetoligopeptidase 67-79 ALADVEVTYTVQR 148 Enzymes P52888 THOP1Thimetoligopeptidase 105-115 LSEFDVEMSMR 14 Enzymes P52888 THOP1Thimetoligopeptidase 499-520 DFVEAPSQMLENWV 14 Enzymes WEQEPLLR P62072 TIMM10Mitochondrial 42545 AQQLAAELEVEMMA 13149 Chaperones importinnermembrane DMYNR 8 translocasesu Q99595 TIMM17AMitochondrial 13-35 IVDDCGGAFTMGTIG 14152 Channels, importinnermembrane GGIFQAIK 48 Transporters, translocasesu Receptors O60830 TIMM17BMitochondrial 13-35 IVDDCGGAFTMGVIG 14152 Channels, importinnermembrane GGVFQAIK 43136 Transporters, translocasesu 9 Receptors O43615 TIMM44Mitochondrial 428-439 DQDELNPYAAWR 13 Channels, importinnermembrane Transporters, translocasesu Receptors P49755 TMED10Transmembrane 154-169 LEDLSESIVNDFAYM 1439 Channels, emp24domain-containing K Transporters, protein10 Receptors Q9BVK6 TMED9Transmembrane 49-65 CFIEEIPDETMVIGNY 9 Channels, emp24domain-containing R Transporters, protein9 Receptors Q9H061 TMEM126ATransmembrane 85-105 CFVSFPLNTGDLDCE 14 Uncategorized protein126A TCTITR P42166 TMPOLamina-associated 621-637 TYDAASYICEAAFDE 4 Transcription polypeptide2,isoform VK factors, alpha Regulators Q92973 TNPO1Transportin-1 273-298 TQDQDENVALEACE 9 Channels, FWLTLAEQPICK Transporters, Receptors Q92973 TNPO1Transportin-1 45-64 LEQLNQYPDFNNYLI 13142 Channels, FVLTK Transporters, Receptors Q9NS69 TOMM22Mitochondrial 106-117 LQMEQQQQLQQR 14 Channels, importreceptorsubunit Transporters, TOM22homolog Receptors Q9NS69 TOMM22Mitochondrial 61-76 SAAGATFDLSLFVAQ 1442 Channels, importreceptorsubunit K 13 Transporters, TOM22homolog Receptors O96008 TOMM40Mitochondrial 278-293 ASDQLQVGVEFEAST 14 Channels, importreceptorsubunit R Transporters, TOM40homolog Receptors O94826 TOMM70AMitochondrial 475-494 CAEGYALYAQALTD 14 Uncategorized importreceptorsubunit QQQFGK TOM70 P67936 TPM4Tropomyosinalpha-4 170-177 SLEAASEK 133 Adapter, chain Scaffolding, Modulator Proteins O14773 TPP1Tripeptidyl-peptidase 521-558 GCHESCLDEEVEGQ 131415 Enzymes 1 GFCSGPGWDPVTGW 49 GTPNFPALLK Q9H4I3 TRABDTraBdomain- 235-253 DLLEQMMAEMIGEF 14 Uncategorized containingprotein PDLHR Q12931 TRAP1Heatshockprotein 603-619 LDTHPAMVTVLEMG 13 Chaperones 75kDa,mitochondrial AAR Q15631 TSNTranslin 205-215 VEEVVYDLSIR 2 Transcription factors, Regulators Q6DKK2 TTC19Tetratricopeptide 134-149 AITYTYDLMANLAFI 6 Adapter, repeatprotein19, R Scaffolding, mitochondrial Modulator Proteins Q14166 TTLL12Tubulin--tyrosine 254-287 CMLLPWAPTDMLDL 4 Enzymes ligase-likeprotein12 SSCTPEPPAEHYQAIL EENK Q71U36 TUBA1ATubulinalpha-1A 353-370 VGINYQPPTVVPGGD 4 Adapter, chain LAK Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 244-264 FDGALNVDLTEFQT 1332 Adapter, chain NLVPYPR 4 Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 281-304 AYHEQLSVAEITNAC 4313 Adapter, chain FEPANQMVK Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 374-390 AVCMLSNTTAIAEA 4 Adapter, chain WAR Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 65-79 AVFVDLEPTVIDEVR 13432 Adapter, chain Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 403-422 AFVHWYVGEGMEE 4 Adapter, chain GEFSEAR Scaffolding, Modulator Proteins Q71U36 TUBA1ATubulinalpha-1A 41-60 TIGGGDDSFNTFFSET 13 Adapter, chain GAGK Scaffolding, Modulator Proteins Q13748 TUBA3DTubulinalpha-3C/D 244-264 FDGALNVDLTEFQT 14139 Adapter, chain NLVPYPR 4 Scaffolding, Modulator Proteins Q13748 TUBA3DTubulinalpha-3C/D 281-304 AYHEQLSVAEITNAC 14134 Adapter, chain FEPANQMVK Scaffolding, Modulator Proteins Q13748 TUBA3DTubulinalpha-3C/D 41-60 TIGGGDDSFNTFFSET 139 Adapter, chain GAGK Scaffolding, Modulator Proteins P68366 TUBA4ATubulinalpha-4A 244-264 FDGALNVDLTEFQT 3213 Adapter, chain NLVPYPR 94 Scaffolding, Modulator Proteins P68366 TUBA4ATubulinalpha-4A 281-304 AYHEQLSVAEITNAC 3134 Adapter, chain FEPANQMVK Scaffolding, Modulator Proteins P68366 TUBA4ATubulinalpha-4A 340-352 SIQFVDWCPTGFK 13 Adapter, chain Scaffolding, Modulator Proteins Q9NY65 TUBA8Tubulinalpha-8chain 244-264 FDGALNVDLTEFQT 3213 Adapter, NLVPYPR 94 Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 104-121 GHYTEGAELVDSVL 1396 Adapter, DVVR Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 175-213 VSDTVVEPYNATLSV 6 Adapter, HQLVENTDETYCIDN Scaffolding, EALYDICFR Modulator Proteins P07437 TUBBTubulinbetachain 20-46 FWEVISDEHGIDPTG 6 Adapter, TYHGDSDLQLDR Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 217-241 LTTPTYGDLNHLVSA 3136 Adapter, TMSGVTTCLR Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 283-297 ALTVPELTQQVFDA 6 Adapter, K Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 310-318 YLTVAAVFR 6 Adapter, Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 337-350 NSSYFVEWIPNNVK 1339 Adapter, 86 Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 381-390 ISEQFTAMFR 6 Adapter, Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 47-58 ISVYYNEATGGK 136 Adapter, Scaffolding, Modulator Proteins P07437 TUBBTubulinbetachain 63-77 AILVDLEPGTMDSVR 6 Adapter, Scaffolding, Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 381-390 ISEQFTAMFR 6 Adapter, chain Scaffolding, Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 63-77 AILVDLEPGTMDSVR 6 Adapter, chain Scaffolding, Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 175-213 VSDTVVEPYNATLSV 6 Adapter, chain HQLVENTDETYCIDN Scaffolding, EALYDICFR Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 337-350 NSSYFVEWIPNNVK 3139 Adapter, chain 86 Scaffolding, Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 104-121 GHYTEGAELVDSVL 96 Adapter, chain DVVR Scaffolding, Modulator Proteins Q9BVA1 TUBB2BTubulinbeta-2B 217-241 LTTPTYGDLNHLVSA 313 Adapter, chain TMSGVTTCLR Scaffolding, Modulator Proteins Q13509 TUBB3Tubulinbeta-3chain 104-121 GHYTEGAELVDSVL 946 Adapter, DVVR Scaffolding, Modulator Proteins Q13509 TUBB3Tubulinbeta-3chain 337-350 NSSYFVEWIPNNVK 46 Adapter, Scaffolding, Modulator Proteins Q13509 TUBB3Tubulinbeta-3chain 63-77 AILVDLEPGTMDSVR 4 Adapter, Scaffolding, Modulator Proteins P68371 TUBB4BTubulinbeta-4B 104-121 GHYTEGAELVDSVL 96 Adapter, chain DVVR Scaffolding, Modulator Proteins P68371 TUBB4BTubulinbeta-4B 175-213 VSDTVVEPYNATLSV 6 Adapter, chain HQLVENTDETYCIDN Scaffolding, EALYDICFR Modulator Proteins P68371 TUBB4BTubulinbeta-4B 217-241 LTTPTYGDLNHLVSA 3136 Adapter, chain TMSGVTTCLR Scaffolding, Modulator Proteins P68371 TUBB4BTubulinbeta-4B 310-318 YLTVAAVFR 6 Adapter, chain Scaffolding, Modulator Proteins P68371 TUBB4BTubulinbeta-4B 337-350 NSSYFVEWIPNNVK 3139 Adapter, chain 86 Scaffolding, Modulator Proteins P68371 TUBB4BTubulinbeta-4B 381-390 ISEQFTAMFR 6 Adapter, chain Scaffolding, Modulator Proteins Q9BUF5 TUBB6Tubulinbeta-6chain 217-241 LTTPTYGDLNHLVSA 4 Adapter, TMSGVTTSLR Scaffolding, Modulator Proteins Q9BUF5 TUBB6Tubulinbeta-6chain 175-213 VSDTVVEPYNATLSV 6 Adapter, HQLVENTDETYCIDN Scaffolding, EALYDICFR Modulator Proteins Q9BUF5 TUBB6Tubulinbeta-6chain 337-350 NSSYFVEWIPNNVK 4213 Adapter, 6 Scaffolding, Modulator Proteins P49411 TUFMElongationfactorTu, 183-200 ADAVQDSEMVELVE 13432 Transcription mitochondrial LEIR 86 factors, Regulators P49411 TUFMElongationfactorTu, 239-252 LLDAVDTYIPVPAR 6 Transcription mitochondrial factors, Regulators P49411 TUFMElongationfactorTu, 272-281 GTVVTGTLER 34156 Transcription mitochondrial 8 factors, Regulators Q9BRA2 TXNDC17Thioredoxin 42477 YEEVSVSGFEEFHR 14 Uncategorized domain-containingprotein17 Q14157 UBAP2LUbiquitin-associated 239-257 TATEEWGTEDWNED 8 Uncategorized protein2-like LSETK P31930 UQCRC1Cytochromeb-c1 397-415 NALVSHLDGTTPVCE 13432 Channels, complexsubunit1, DIGR 8 Transporters, mitochondrial Receptors P21796 VDAC1Voltage-dependent 140-161 GALVLGYEGWLAGY 14213 Channels, anion-selectivechannel QMNFETAK 46 Transporters, protein Receptors P21796 VDAC1Voltage-dependent 121-139 EHINLGCDMDFDIAG 13142 Channels, anion-selectivechannel PSIR 48 Transporters, protein Receptors P21796 VDAC1Voltage-dependent 75-93 WNTDNTLGTEITVED 131415 Channels, anion-selectivechannel QLAR 3246 Transporters, protein 98 Receptors P21796 VDAC1Voltage-dependent 164-174 VTQSNFAVGYK 14486 Channels, anion-selectivechannel Transporters, protein Receptors P21796 VDAC1Voltage-dependent 64-74 WTEYGLTFTEK 131415 Channels, anion-selectivechannel 3246 Transporters, protein 98 Receptors P21796 VDAC1Voltage-dependent 35-53 SENGLEFTSSGSANT 489 Channels, anion-selectivechannel ETTK Transporters, protein Receptors P21796 VDAC1Voltage-dependent 175-197 TDEFQLHTNVNDGT 1448 Channels, anion-selectivechannel EFGGSIYQK Transporters, protein Receptors P21796 VDAC1Voltage-dependent 225-236 YQIDPDACFSAK 48 Channels, anion-selectivechannel Transporters, protein Receptors P45880 VDAC2Voltage-dependent 86-107 WNTDNTLGTEIAIED 131415 Channels, anion-selectivechannel QICQGLK 3246 Transporters, protein 98 Receptors P45880 VDAC2Voltage-dependent 178-185 NNFAVGYR 14213 Channels, anion-selectivechannel 846 Transporters, protein Receptors P45880 VDAC2Voltage-dependent 186-208 TGDFQLHTNVNDGT 1442 Channels, anion-selectivechannel EFGGSIYQK Transporters, protein Receptors P45880 VDAC2Voltage-dependent 209-229 VCEDLDTSVNLAWT 131415 Channels, anion-selectivechannel SGTNCTR 2984 Transporters, protein Receptors P45880 VDAC2Voltage-dependent 236-247 YQLDPTASISAK 13144 Channels, anion-selectivechannel Transporters, protein Receptors P45880 VDAC2Voltage-dependent 75-85 WCEYGLTFTEK 131415 Channels, anion-selectivechannel 3246 Transporters, protein 9 Receptors Q9Y277 VDAC3Voltage-dependent 164-174 LSQNNFALGYK 14 Channels, anion-selectivechannel Transporters, protein Receptors P08670 VIMVimentin 283-292 NLQEAEEWYK 13143 Uncategorized 2415 6 98 P08670 VIMVimentin 322-334 QVQSLTCEVDALK 496 Uncategorized P08670 VIMVimentin 176-184 DNLAEDIMR 6 Uncategorized P08670 VIMVimentin 197-207 EEAENTLQSFR 13143 Uncategorized 2159 6 P08670 VIMVimentin 130-139 ILLAELEQLK 14324 Uncategorized 69 P08670 VIMVimentin 29-36 SYVTTSTR 146 Uncategorized P08670 VIMVimentin 146-155 LGDLYEEEMR 6 Uncategorized P08670 VIMVimentin 42502 SVSSSSYR 6 Uncategorized P08670 VIMVimentin 189-196 LQEEMLQR 36 Uncategorized P08670 VIMVimentin 105-113 VELQELNDR 46 Uncategorized P08670 VIMVimentin 79-97 LLQDSVDFSLADAIN 131415 Uncategorized TEFK 4326 98 P08670 VIMVimentin 295-304 FADLSEAANR 6 Uncategorized P08670 VIMVimentin 346-364 EMEENFAVEAANYQ 131415 Uncategorized DTIGR 3246 98 P08670 VIMVimentin 335-342 GTNESLER 6 Uncategorized P08670 VIMVimentin 114-120 FANYIDK 4386 Uncategorized P08670 VIMVimentin 365-373 LQDEIQNMK 4326 Uncategorized P08670 VIMVimentin 382-390 EYQDLLNVK 3 Uncategorized P08670 VIMVimentin 51-64 SLYASSPGGVYATR 14243 Uncategorized 1386 P08670 VIMVimentin 224-235 VESLQEEIAFLK 1446 Uncategorized Q96GC9 VMP1Vacuolemembrane 214-243 LSGAEPDDEEYQEFE 14 Uncategorized protein1 EMLEHAESAQDFAS R Q96AX1 VPS33AVacuolarprotein 233-262 NVDLLTPLATQLTYE 14 Channels, sorting-associated GLIDEIYGIQNSYVK Transporters, protein33A Receptors Q9UID3 VPS51Vacuolarprotein 742-763 FVADEELVHLLLDEV 14 Channels, sorting-associated VASAALR Transporters, protein51hom Receptors O43592 XPOTExportin-T 825-843 VLVTVIQGAVEYPDP 132 Channels, IAQK Transporters, Receptors P12956 XRCC6X-rayrepaircross- 475-488 SDSFENPVLQQHFR 34213 Transcription complementingprotein6 8 factors, Regulators P12956 XRCC6X-rayrepaircross- 489-510 NLEALALDLMEPEQ 1332 Transcription complementingprotein6 AVDLTLPK 48 factors, Regulators P67809 YBX1Nuclease-sensitive 102-118 SVGDGETVEFDVVE 6 Transcription element-bindingprotein GEK factors, 1 Regulators P62258 YWHAE14-3-3protein 197-215 AAFDDAIAELDTLSE 13 Uncategorized epsilon ESYK P62258 YWHAE14-3-3protein 143-153 EAAENSLVAYK 13 Uncategorized epsilon P27348 YWHAQ14-3-3protein 194-212 TAFDEAIAELDTLNE 14 Uncategorized theta DSYK P63104 YWHAZ14-3-3protein 194-212 TAFDEAIAELDTLSE 1413 Uncategorized zeta/delta ESYK

    TABLE-US-00008 TABLE2 Predicted Overlapping pocket pockets Labeled residue (fpocket ProteinName Peptide PeptideSequence Probes PDB overlap designation) ACP1Low 42-59 VDSAATSGYEIGNPPD 13 3N8I 47.A,50.A 1 molecularweight YR phosphotyrosine proteinphosp ADCK3Chaperone 277-295 LGQMLSIQDDAFINPH 14 4PED 278.A,283.A 1 activityofbc1 LAK complex-like, mitochondr ADKAdenosine 209-224 IFTLNLSAPFISQFYK 2 4O1L 200.A,205.A, 1,5,10,12, kinase 207.A,200.B, 20,21 201.B, 206.B,207.B ADSS 431-441 FIEDELQIPVK 14 2V40 435.A 8 Adenylosuccinate synthetaseisozyme 2 AHCYL2Putative 331-342 GIVEESVTGVHR 6 3GVP 335.A,336.A, 5,6,16,17, adenosylhomocysteinase 337.A,338.A, 18,22,27, 3 341.A,342.A, 38,51 335.B, 336.B,337.B, 338.B,332.C, 334.C,335.C, 337.C,339.C, 342.C,332.D, 334.D, 335.D,336.D, 337.D,339.D, 342.D AIFM1Apoptosis- 475-510 PYWHQSMFWSDLGPD 2346 4LII 480.A,482.A, 1 inducingfactor1, VGYEAIGLVDSSLPTV 492.A mitochondrial GVFAK ALDH7A1Alpha- 139-162 ILVEGVGEVQEYVDIC 813 4ZUL 117.A,118.A, 3,6,26,37, aminoadipic DYAVGLSR 120.A,123.A, 47,48,52, semialdehyde 127.A,128.A, 69,71,84, dehydrogenase 130.A,131.A, 86,93,95, 132.A,133.A, 102,115 134.A,111.B, 112.B,113.B, 114.B,117.B 120.B,123.B, 127.B,128.B, 130.B,132.B, 133.B,134.B, 120.C, 123.C,127.C, 128.C,120.D, 123.D,127.D, 128.D,130.D, 132.D, 133.D,134.D, 116.E,120.E, 124.E,128.E, 120.F,127.F, 128.F,130.F, 131.F,132.F, 133.F,134.F, 128.G,130.G, 132.G, 133.G,134.G, 120.H,124.H, 128.H,130.H, 133.H, 134.H ANP32AAcidic 117-132 SLDLFNCEVTNLNDYR 13 4X0S NoOverlap leucine-richnuclear phosphoprotein32 fami API5Apoptosis 182-196 VLEDVTGEEFVLFMK 4 3U0R 187.A,193.A 3 inhibitor5 API5Apoptosis 131-148 GTLGGLFSQILQGEDI 4 3U0R 145.A 3 inhibitor5 VR API5Apoptosis 211-237 QQLVELVAEQADLEQ 4 3UOR NoOverlap inhibitor5 TFNPSDPDCVDR ARF1ADP- 39-59 LGEIVTTIPTIGFNVET 23813 3O47 175.A,176.A, 1,2,9,11,15 ribosylationfactor1 VEYK 177.A,178.A, 179.A,181.A, 183.A,184.A, 185.A,172.B 189.B ARF4ADP- 39-59 LGEIVTTIPTIGFNVET 23813 1Z6X 48.A,49.A, 1,5,6 ribosylationfactor4 VEYK 50.A,51.A, 52.A,54.A, 49.B,52.B, 54.B ARF5ADP- 39-59 LGEIVTTIPTIGFNVET 2348 2B6H 44.A,52.A, 1,2 ribosylationfactor5 VEYK 13 53.A,54.A, 57.A,59.A ARL1ADP- 163-178 GTGLDEAMEWLVETL 1314 4DCN NoOverlap ribosylationfactor- K likeprotein1 ARL1ADP- 37-59 LQVGEVVTTIPTIGFN 13 4DCN 38.A,44.A, 1,2,3,4 ribosylationfactor- VETVTYK 46.A,47.A, likeprotein1 51.A,52.A, 53.A,54.A, 38.B,43.B, 44.B,46.B, 47.B,48.B, 52.B,54.B ATICBifunctional 178-194 AFTHTAQYDEAISDYF 13 1PKX 183.A,184.A, 5,12,17,18 purinebiosynthesis R 187.A,191.A, 49,51,54 proteinPURH 194.A,183.B, 187.B, 188.B,190.B, 191.B,194.B, 180.C,181.C, 183.C,184.C, 185.C,187.C, 188.C, 191.C,194.C, 181.D,183.D, 184.D,185.D, 187.D,188.D, 190.D, 194.D BAXApoptosis 66-78 IGDELDSNMELQR 13 4ZIG NoOverlap regulatorBAX BLMHBleomycin 203-218 GEISATQDVMMEEIFR 13 1CB5 210.A,213.A, 29,30,31,78 hydrolase 217.A,218.A, 210.B,213.B, 217.B, 210.C,213.C, 217.C BLMHBleomycin 111-124 CYFFLSAFVDTAQR 14 1CB5 112.A,122.A, 4,29,30,31, hydrolase 123.A,112B 67,76,77 113B,122.B, 123.B, 112.C,122.C, 123.C C1QBP 247-276 GVDNTFADELVELSTA 3913 3RPX 264.A,265.A, 1,2,6,8 Complement LEHQEYITFLEDLK 14 268.A,274.A, component1Q 260.C, subcomponent- 261.C,264.C, bindingprot 265.C,268.C C1QBP 105-119 MSGGWELELNGTEAK 9 3RPX 108.A,110.A, 7 Complement 111.A component1Q subcomponent- bindingprot CALM3Calmodulin 39-75 SLGQNPIEAELQDMIN 14 4UPU NoOverlap EVDADGNGTIDFPEFL TMMAR CALRCalreticulin 323-351 SGTIFDNFLITNDEAYA 6913 3POW 329.A,345.A, 4 EEFGNETWGVTK 346.A,349.A CALRCalreticulin 99-111 HEQNIDCGGGYVK 6 3POW NoOverlap CAPN1Calpain-1 175-193 LVFVHSAEGNEFWSA 14 2ARY 175.A,179.A, 1,14 catalyticsubunit LLEK 180.A,181.A, 182.A,183.A, 175.B,176.B, 179.B,180.B, 181.B,186.B CKBCreatine 224-236 TFLVWVNEEDHLR 3 3B6R 228.A,232.A, 1,2,4 kinaseB-type 233.A,228.B, 232.B CKBCreatine 342-358 LGFSEVELVQMVVDG 313 3B6R 342.A 21 kinaseB-type VK CKBCreatine 367-381 LEQGQAIDDLMPAQK 13 3B6R NoOverlap kinaseB-type CKBCreatine 14-32 FPAEDEFPDLSAHNNH 3 3B6R 29.B 5 kinaseB-type MAK CKBCreatine 157-172 LAVEALSSLDGDLAG 13 3B6R 159.B,160.B, 3,10,15 kinaseB-type R 163.B,164.B, 168.B,169.B, 170.B,171.B, 172.B CKBCreatine 253-265 FCTGLTQIETLFK 13 3B6R 261.A,265.A, 7,17 kinaseB-type 261.B,265.B CKMT1BCreatine 257-269 SFLIWVNEEDHTR 3 1QK1 223.B,227.B, 4,6,38,78, kinaseU-type, 223.C,221.D, 80,82 mitochondrial 223.D,226.D, 221.H,223.H, 226.H CLPPPutativeATP- 215-226 QSLQVIESAMER 6 1TG6 166.A,167.A, 20,41,49, dependentClp 168.A,169.A, 53,56,58, proteaseproteolytic 170.A,169.B, 60,62,65 su 170.B, 159.C,167.C, 168.C,169.C, 170.C,159.E, 159.G,161.G, 163.G,165.G, 167.G, 168.G,169.G, 170.G COPS4COP9 154-170 LYLEDDDPVQAEAYIN 1315 4D18 157.D,158.D 178 signalosome R complexsubunit4 CSNK1A1Casein 84-106 DYNVLVMDLLGPSLE 14 5FQD 95.C,100.C, 14,15,69,88, kinaseIisoform DLFNFCSR 88.F,90.F, alpha 91.F,93.F, 94.F,95.F, 99.F CSNK2BCasein 112-134 VYCENQPMLPIGLSDI 14 4NH1 126.C,126.D 1,4 kinaseIIsubunit PGEAMVK beta CTNNB1Catenin 648-661 NEGVATYAAAVLFR 1314 3TX7 660.A,661.A 28 beta-1 CTSB 315-331 GQDHCGIESEVVAGIP 24913 3K9M 237.A,238.A, 4,10,13,19 CathepsinB R 240.A,241.A, 251.A,252.A, 251.B, 252.B CTSDCathepsinD 236-253 DPDAQPGGELMLGGT 9 4OD9 173.B 10 DSK CTSDCathepsinD 288-309 EGCEAIVDTGTSLMVG 4689 4OD9 231.B,233.B, 1,2,7 PVDEVR 1314 234.B,238.B, 15 241.B,242.B, 245.B,231.D, 233.D,234.D, 235.D, 236.D,238.D CTSDCathepsinD 314-331 AIGAVPLIQGEYMIPCE 2346 4OD9 258.B,260.B, 1,2 K 8913 258.D,260.D 1415 CYB5R3NADH- 235-241 LWYTLDR 3 1UMK 237.A,238.A, 1 cytochromeb5 239.A reductase3 DECR12,4-dienoyl- 299-315 FDGGEEVLISGEFNDL 6 1W6U 306.A,307.A, 1,2,9,10, CoAreductase, R 308.A,309.A, 14,23,25, mitochondrial 311.A,312.A, 27,35,42,47 313.A, 314.A,315.A, 304.B,305.B, 308.B,310.B, 311.B,313.B, 314.B, 315.B,303.C, 304.C,305.C, 306.C,308.C, 310.C,311.C, 312.C,315.C, 305.D, 306.D,307.D, 308.D,309.D, 310.D,311.D, 312.D, 313.D,314.D, 315.D DHX9ATP- 448-456 ISAVSVAER 3 3LLM 449.B,453.B, 6 dependentRNA 456.B helicaseA DIABLODiablo 124-140 MNSEEEDEVWQVIIGA 13 4TX5 78.A,82.A, 5,11,12 homolog, R 85.A,71.B, mitochondrial 74.B,75.B, 78.B,84.B DLDDihydrolipoyl 450-482 VLGAHILGPGAGEMV 41314 3RNM 416.A,417.A, 2,3,8,9,10, dehydrogenase, NEAALALEYGASCEDI 418.A,423.A, 11,12,17, mitochondrial AR 424.A,443.A, 37,44,50, 444.A, 54,67 445.A,446.A, 447.A,415.B, 416.B,423.B, 424.B, 428.B,433.B, 436.B,437.B, 446.B,421.C, 423.C,424.C, 427.C,436.C, 437.C, 443.C,447.C, 421.D,423.D, 424.D,446.D ECH1Delta(3,5)- 197-211 EVDVGLAADVGTLQR 3468 2VRE 171.A,174.A, 1,3,4,24 Delta(2,4)-dienoyl- 1314 171.B,176.B, CoAisomerase, 15 179.B,180.B, mitoc 171.C,174.D ECH1Delta(3,5)- 149-158 YQETFNVIER 6 2VRE 123.A,124.A, 1,2,3,4,5, Delta(2,4)-dienoyl- 128.A,131.A, 8,9,12 CoAisomerase, 123.B,125.B, mitoc 126.B, 128.B,131.B, 123.C,124.C, 125.C,128.C, 131.0 ECH1Delta(3,5)- 113-131 MFTAGIDLMDMASDI 6 2VRE 98.A,100.A, 1,3,4,12, Delta(2,4)-dienoyl- LQPK 101.A,102.A, 23,24 CoAisomerase, 92.B,97.B, mitoc 98.B,100.B, 90.C,92.C, 93.C,94.C, 95.C,97.C, 98.C,100.C, 101.C,104.C EIF4A1Eukaryotic 69-82 GYDVIAQAQSGTGK 91314 2ZU6 75.A,76.A, 1,5,10,53, initiation 78.A,82.A, 84 factor4A-I 75.C,78.C, 79.C,80.C, 82.C EIF4A1Eukaryotic 178-190 MFVLDEADEMLSR 13 2ZU6 178.C,190.C, 2,4,5 initiationfactor4A-I 185.D,186.D, 188.D,189.D, 190.D EIF4A2Eukaryotic 70-83 GYDVIAQAQSGTGK 13 3BOR 76.A,82.A, 1 initiationfactor4A- 83.A II ELAVL1ELAV- 20-37 TNLIVNYLPQNMTQD 2413 4FXV 33.A,26.B, 1,2,4,5,6 likeprotein1 ELR 28.B,30.B, 32.B,34.B, 35.B,37.B, 20.C,21.C, 32.D,34.D, 35.D,37.D ERHEnhancerof 18-34 TYADYESVNECNIEGV 13 2NML 18.A 2 rudimentary CK homolog ETFBElectron 36-51 HSMNPFCEIAVEEAVR 3 2A1T 36.S,37.S, 1,4 transferflavoprotein 39.S,40.S, subunitbeta 41.S,43.S, 44.S EXO1Exonuclease1 139-160 SQGVDCLVAPYEADA 2689 3QEB 143.Z,144.Z, 1,9,11 QLAYLNK 13 145.Z,149.Z, 150.Z FARSB 72-82 YDLLCLEGLVR 9 3L4G 72.B,72.D, 1,5,8,9,43 Phenylalanine-- 76.D,72.F, 44,45,53, tRNAligasebeta 76.F,72.H, 57,99,113, subunit 72.J,74.J, 124,273,279 76.J,75.L, 76.N,78.N, 72.P,75.P, 76.P FARSB 518-530 IMQLLDVPPGEDK 2 3L4G 519.B,520.B, 2,7,35,54, Phenylalanine-- 524.B,526.B, 97,106,107, tRNAligasebeta 528.B,530.B, 134,136, subunit 520.D,521.D, 181,215, 523.D,524.D, 218,224, 525.D, 267,288, 530.D,519.F, 295,308 520.F,523.F, 524.F,525.F, 520.H,521.H, 523.H,524.H, 526.H,530.H, 519.J,520.J, 523.J,524.J, 525.J,526.J, 529.J,530.J, 523.N,520.P, 523.P FDFT1Squalene 78-92 ALDTLEDDMTISVEK 15 3VJ9 80.A,83.A 1 synthase FECH 254-272 SEVVILFSAHSLPMSV 4 3HCN 255.A,263.A, 1,2,3,8,12, Ferrochelatase, VNR 270.A,271.A, 17,21,27 mitochondrial 754.B,755.B, 763.B, 764.B,766.B, 768.B,770.B, 771.B FKBP4Peptidyl- 190-206 FEIGEGENLDLPYGLE 13 4LAY NoOverlap - prolylcis-trans isomeraseFKBP4 GLAAlpha- 241-252 SILDWTSFNQER 9 3S5Z 244.A,247.A, 11,20 galactosidaseA 250.B,251.B, 252.B GLAAlpha- 68-82 LFMEMAELMVSEGW 4 3S5Z 70.A,68.B, 13,16 galactosidaseA K 71.B GLAAlpha- 50-67 FMCNLDCQEEPDSCIS 9 3S5Z 50.A,51.A, 1,3,13,16 galactosidaseA EK 52.A,53.A, 59.A,60.A, 61.A,62.A, 66.A,50.B, 51.B,52.B, 53.B,55.B, 59.B,60.B, 61.B,62.B, 63.B,65.B,67.B GLB1Beta- 286-299 TEAVASSLYDILAR 9 3THC NoOverlap - galactosidase GLO1 160-179 GLAFIQDPDGYWIEIL 314 3W0T 159.A,164.A, 1,2,4,8,12, Lactoylglutathione NPNK 165.A,166.A, 19 lyase 175.A,178.A, 160.B,162.B, 170.B, 172.B,160.C, 162.C,170.C, 172.C,162.D, 164.D,166.D, 167.D, 168.D,170.D, 172.D GLUD1Glutamate 481-496 HGGTIPIVPTAEFQDR 6 1L1F 443.A,440.B, 35,39,66 dehydrogenase1, 443.B,439.F, mitochondrial 443.F GLUD1Glutamate 152-162 YSTDVSVDEVK 6 1L1F 99.A,100.A, 4,17,44,55, dehydrogenase1, 101.A,102.A, 57,60,61,65 mitochondrial 99.B,100.B, 101.B,107.B, 99.C,101.C, 102.C,99.D, 100.D,101.D, 102.D,109.D, 99.E,100.E, 101.E, 102.E,99.F, 100.F,101.F, 102.F,109.F GOLPH3Golgi 75-90 EGYTSFWNDCISSGLR 14 3KN1 76.A,79.A, 1,5,9 phosphoprotein3 80.A81.A, 83.A,84.A, 85.A,87.A, 90.A GSTP1Glutathione 56-71 FQDGDLTLYQSNTILR 2 2A2R 61.B,63.B, 1,14 S-transferaseP 64.B H2AFZHistone 47-75 VGATAAVYSAAILEYL 3 5FUG 48.A,49.A, 1,2,3,4,5, H2A.Z TAEVLELAGNASK 52.A,53.A, 7,8,10,11 71.A,72.A, 18,27 73.A,74.A, 49.D,67.D, 70.D,71.D, 46.G,54.G, 57.G,59.G, 60.G,63.G, 71.G,72.G, 73.G,74.G, 48.J,49.J, 52.J HADH 250-271 LGAGYPMGPFELLDY 213 3HAD 238.A,239.A, 1,2,3 Hydroxyacyl- VGLDTTK 240.A,242.A, coenzymeA 243.A,252.A, dehydrogenase, 256.A, mitochondria 257.A,239.B, 240.B,242.B, 243.B,245.B, 252.B,253.B, 256.B,257.B HARSHistidine-- 170-193 EFYQCDFDIAGNFDPM 41415 4PHC 171.A,173.A, 1,2,4,5,32, tRNAligase, IPDAECLK 171.B,172.B, 43 cytoplasmic 173.B,171.C, 172.C,173.C, 177.C, 180.C,181.C, 182.C,184.C, 185.C,188.C, 170.D,171.D, 172.D HBA2Hemoglobin 18-32 VGAHAGEYGAEALER 4 4X0L 27.A,31.A 6 subunitalpha HBA2Hemoglobin 94-100 VDPVNFK 4 4X0L 96.A 2 subunitalpha HEXABeta- 489-499 LTSDLTFAYER 9 2GJX 497.E,497.H, 47,70 hexosaminidase 498.H subunitalpha HLA-AHLAclassI 46-59 FIAVGYVDDTQFVR 14 5EU3 23.A,30.A, 1,5 histocompatibility 31.A,32.A antigen,A-2alpha HMOX2Heme 48-55 AENTQFVK 2346 4WMH 52.A,54.A 1 oxygenase2 81415 HMOX2Heme 69-87 LATTALYFTYSALEEE 14 4WMH 73.A,74.A, 1,5 oxygenase2 MER 76.A,77.A, 79.A,80.A HNRNPA1 56-75 GFGFVTYATVEEVDA 3 2UP1 NoOverlap Heterogeneous AMNAR nuclear ribonucleoprotein A1 HNRNPA1 16-31 LFIGGLSFETTDESLR 2314 2UP1 27.A 2 Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 131-140 IEVIEIMTDR 389 2UP1 NoOverlap Heterogeneous nuclear ribonucleoprotein A1 HNRNPK 423-433 IDEPLEGSEDR 4 1ZZK NoOverlap Heterogeneous nuclear ribonucleoproteinK HNRNPK Heterogeneous 397-405 DLAGSIIGK 34 1ZZK NoOverlap nuclear ribonucleoproteinK HNRNPK 415-422 HESGASIK 3413 1ZZK 42.A 2 Heterogeneous nuclear ribonucleoproteinK HNRNPK 434-456 IITITGTQDQIQNAQYL 2348 1ZZK 75.A,76.A, 1,2 Heterogeneous LQNSVK 91314 78.A,79.A, nuclear 80.A ribonucleoproteinK HNRNPL 399-411 VFNVFCLYGNVEK 2 3TO8 405.A, 2 Heterogeneous 406.A nuclear ribonucleoproteinL HSD17B103- 10-29 GLVAVITGGASGLGLA 23 2O23 20.A,29.A, 1,2,16 hydroxyacyl-CoA TAER 20.B,29.B dehydrogenasetype- 2 HSD17B4 169-183 LGLLGLANSLAIEGR 3 1ZBQ 175.A,176.A, 10,12,15, Peroxisomal 179.A,180.A, 22,44 multifunctional 183.A,169.B, enzymetype2 175.B, 176.B,169.C, 172.C,176.C, 179.C,180.C, 169.D,172.D, 179.D,180.D, 183.D, 179.F,180.F HSP90AB1Heat 360-378 VFIMDSCDELIPEYLNF 1314 3PRY 361.A,362.A, 1,2,3,4,5, shockproteinHSP IR 363.A,364.A, 7,12,30 90-beta 365.A,366.A, 367.A, 368.A,370.A, 371.A, 375.A,365.B 366.B,367.B, 362.C,365.0, 366.C,367.C, 370.C,371.C, 372.C, 373.C,375.C HSP90AB1Heat 507-526 GFEVVYM1EPIDEYCV 1314 3PRY 508.A,512.A, 1,3,4,5,6, shockproteinHSP QQLK 513.A,514.A, 7,11,13,18, 90-beta 515.A,516.A, 20,21,25, 517.A, 28,33 518.A,519.A, 520.A,523.A, 525.A, 514.B,516B, 518.B,525.B, 508.C,512.C, 513.C,514.C, 515.C,516.C, 517.C,518.C, 519.C, 520.C,524.C HSP90B1 117-135 LISLTDENALSGNEELT 9 4NH9 NoOverlap Endoplasmin VK HSP90B1 271-285 YSQFINFPIYVWSSK 6 4NH9 NoOverlap Endoplasmin HSPA1BHeat 424-447 QTQIFTTYSDNQPGVLI 313 4WV5 429.A,431.A, 1,3,7,10,11 shock70kDa QVYEGER 432.A,433.A, protein1A/1B 434.A,435.A, 436.A, 439.A,444.A, 436.B,439.B, 445.B,446.B, 447.B HSPA578kDa 602-617 IEWLESHQDADIEDFK 6 5E85 602.A,605.A, 6 glucose-regulated 606.A,609.A protein HSPA578kDa 475-492 DNHLLGTFDLTGIPPA 6 5E85 490.A, 6,7 glucose-regulated PR 491.A,492.A protein HSPA8Heatshock 113-126 SFYPEEVSSMVLTK 1314 3LDQ 115.A,116.A, 15 cognate71kDa 117.A protein HSPA9Stress-70 266-284 STNGDTFLGGEDFDQ 813 4KBO 268.A,269.A, 1,3 protein, ALLR 270.A,271.A, mitochondrial 279.A,283.A HSPD160kDaheat 206-218 TLNDELEIIEGMK 313 4PJ1 183.A,184.A, 1,2,3,4,7, shockprotein, 188.A,190.A, 14,17,21, mitochondrial 194.A,183.B, 27,29,34, 193.B, 36,37,44, 183.C,186.C, 46,47,48, 188.C,190.C, 49,53,54, 194.C,183.D, 55,57,58, 184.D,188.D, 60,63,64, 190.D,191.D, 67,72,73, 193.D, 82,84,95, 183.E,184.E, 100,103, 190.E,192.E, 117,118, 193.E,183.F, 119,129, 184.F,188.F, 131,135, 190.F,191.F, 154,160, 192.F,193.F, 204,244, 183.G,184.G, 269,277, 189.G, 281,310, 191.G,193.G, 369,371, 183.H,184.H, 381,382, 190.H,194.H, 385,472 183.I, 191.I,193.I, 183.I,192.I, 193.I,183.K, 184.K,192.K, 193.K,182.L, 183.L,184.L, 185.L,186.L, 187.L,188.L, 190.L,193.L, 194.L,183.M, 184.M, 190.M,193.M, 183.N,184.N, 188.N,189.N, 190.N, 191.N,192.N, 193.N,194.N HSPD160kDaheat 222-233 GYISPYFINTSK 13 4PJ1 199.A,200.A, 18,19,22, shockprotein, 201.A,202.A, 25,28,30, mitochondrial 203.A,205.A, 38,39,43, 208.A, 61,98,102, 200.B,201.B, 123,124, 202.B,203.B, 152,179, 204.B,205.B, 184,188, 206.B,207.B, 201,202, 208.B,209.B, 209,222, 200.D, 229,282, 201.D,202.D, 283,314, 203.D,208.D, 332,340, 199.E,202.E, 388,409, 203.E, 429,460, 205.E,206.E, 468,471,482 208.E,209.E, 199.F,200.F, 201.F,202.F, 203.F,206.F, 198.G,199.G, 200.G,201.G, 202.G,205.G, 206.G, 200.H,201.H, 202.H,203.H, 206.H,207.H, 199.1,201.I, 202.1,203.I, 205.I,199.J, 200.J,201.J, 202.J,203.J, 200.K,201.K, 202.K,203.K, 206.K,207.K, 198.L, 199.L,200.L, 202.L,203.L, 205.L,199.M, 200.M,201.M, 202.M, 203.M,205.M, 208.M HSPD160kDaheat 251-268 ISSIQSIVPALEIANAHR 313 4PJ1 230.B,231.B, 18,66,83, shockprotein, 234.B,235.B, 96,147,176, mitochondrial 238.B,243.B, 179,183, 229.C,230.C, 216,217, 231.C,234.C, 305,362, 235.C, 374,377, 238.C,243.C, 380,391, 244.C,237.E, 439,473,482 240.E,241.E, 244.E,231.F, 234.F,235.F, 238.F,244.F, 228.G, 238.G,240.G, 241.G,242.G, 244.G, 237.H,240.H, 241.H,244.H, 237.K,238.K, 241.K,231.M, 240.M,241.M, 244.M,238.N, 239.N,242.N, 244.N HSPD160kDaheat 371-387 IQEIIEQLDVTTSEYEK 13 4PJ1 349.A,350.A, 1,2,3,4,7, shockprotein, 353.A,361.A, 14,17,24, mitochondrial 363.A,352.B, 25,30,37, 353.B, 43,46,49, 355.B,356.B, 52,53,54, 357.B,358.B, 55,57,63, 359.B,361 73,85,95, 362.B,363.B, 98,100,102, 348.C, 111,118, 350.C,351.C, 128,134, 352.C,353.C, 150,154, 354.C,355.C, 173,181, 361.C,363.C, 184,197, 348.D,349.D, 198,201, 350.D,352.D, 202,206, 353.D, 222,229, 358.D,361.D, 237,240, 362.D,363.D, 242,278, 350.E,352.E, 280,282, 353.E, 283,297, 354.E,355.E, 330,332, 356.E,357.E, 353,371, 358.E,359.E, 389,449 361.E,362.E, 363.E,348.F, 351.F,354.F, 355.F,358.F, 361.F,363.F, 348.G, 361.G,362.G, 348.H,349.H, 350.H,353.H, 355.H, 361.H,363.H, 348.I,349.I, 352.I,353.I, 361.I,349.I, 350.I,351.J, 353.I,354.J, 355.I,361.J, 362.I,363.J, 348.K,349.K, 353.K,354.K, 355.K, 361.K,348.L, 349.L,351.L, 355.L,356.L, 358.L,361.L, 362.L,348.M, 349.M, 350.M,353.M, 354.M,355.M, 361.M, 362.M,363.M HSPD160kDaheat 494-516 IMQSSSEVGYDAMAG 479.A,480.A, 5,6,8,9,10, shockprotein, DFVNMVEK 482.A, 11,12,15, mitochondrial 483.A,479.B, 16,33,106, 481.B,482.B, 252,279, 484.B,479.C, 334,390, 484.C,486.C, 469,477 479.E,480.E, 481.E,482.E, 491.E,492.E, 479.F,479.G, 483.G, 479.H,482.H, 483.H,484.H, 491.H,492.1, 484.I,471.K, 472.K, 475.K,484.K, 479.L,481.L, 482.L,483.L, 489.L,471.M, 479.M, 479.N,481.N HSPD160kDaheat 97-121 LVQDVANNTNEEAGD 813 4PJ1 80.A,84.A, 6,8,9,10, shockprotein, GTTTATVLAR 94.A,79.B, 11,12,14, mitochondrial 84.B,91.B, 15,16,17, 97.B,80.C, 20,21,31, 84.C,87.C, 37,41,46, 90.C,94.C, 48,49,53, 97.C,80.D, 55,56,57, 82.D,84.D, 60,63,67, 88.D,91.D, 71,73,84, 75.E,76.E, 121,142, 80.E,83.E, 145,178, 94.E,80.F, 181,214, 84.F,87.F, 237,240, 88.F,90.F, 250,253, 80.G,82.G, 255,275, 84.G,87.G, 280,319,371 90.G,94.G, 97.G,80.H, 82.H,83.H, 85.H,86.H, 89.H,80.I, 83.I,91.I, 80.I,83.I, 84.I,86.I, 94.I,79.K, 83.K,84.K, 85.K,86.K, 94.K,97.K, 80.L,84.L, 85.L,86.L, 87.L,94.L, 97.L,80.M, 82.M,83.M, 88.M,90.M, 94.M,97.M, 80.N,82.N, 84.N,87.N, 90.N IDEInsulin- 312-324 NLYVTFPIPDLQK 4 4RAL 316.A,319.A, 3,4,7,39, degradingenzyme 320.A,321.A, 41,67,93 322.A,323.A, 324.A, 316.B,319.B, 320.B IGF2BP1Insulin- 509-525 TVNELQNLTAAEVVV 313 3KRM 525.A,515.B, 1,2,12,13, likegrowthfactor2 PR 518.B,524.B, 17 mRNA-binding 525.B,524.C, protein 525.C IMPDH2Inosine-5- 110-124 YEQGFITDPVVLSPK 13 1NF7 110.A,111.A, 3,9,16,21, monophosphate 112.A,113.A, 30,33 dehydrogenase2 114.A,116.A, 120.A, 122.A,110.B, 111.B,112.B, 119.B,121.B KPNA2Importin 203-227 YGAVDPLLALLAVPD 1314 4WV6 NoOverlap subunitalpha-2 MSSLACGYLR KPNA2Importin 301-315 LLGASELPIVTPALR 13 4WV6 NoOverlap subunitalpha-2 KPNB1Importin 317-332 GALQYLVPILTQTLTK 1314 3W5K 318.A,330.A 1,23 subunitbeta-1 KPNB1Importin 28-42 AAVENLPTFLVELSR 1314 3W5K 29.A,30.A, 28,33,39 subunitbeta-1 34.A,35.A, 36.A,38.A, 39.A,40.A, 42.A KPNB1Importin 526-537 SSAYESLMEIVK 1314 3W5K 537.A 3 subunitbeta-1 LDHAL-lactate 43-57 DLADELALVDVIEDK 9 4JNK 42.A,43.A, 1,2,3,4,6, dehydrogenaseA 44.A,45.A, 7,10,12,14, chain 46.A,51.A, 16,27,29 42.B,45.B, 46.B,51.B, 53.B,56.B, 42.C,45.C, 50.C,51.C, 42.D,43.D, 44.D,45.D, 46.D,51.D, 52.D LDHBL-lactate 234-244 MVVESAYEVIK 4 1I0Z 233.A,238.A, 1,2,4,5 dehydrogenaseB 242.A,238.B, chain 239.B LGMNLegumain 102-118 DYTGEDVTPQNFLAVLR 9 4N6O NoOverlap LMNAPrelamin- 352-366 MQQQLDEYQELLDIK 613 3V5B NoOverlap A/C LTA4HLeukotriene 366-386 LVVDLTDIDPDVAYSS 4813 3U9W 1367.A,1369.A, 1 A-4hydrolase VPYEK 1377.A, 1380.A,1383.A NAGLUAlpha-N- 566-580 QAVQELVSLYYEEAR 9 4XWH NoOverlap acetylglucosaminidase NAGLUAlpha-N- 594-615 AGGVLAYELLPALDE 1315 4XWH NoOverlap acetylglucosaminidase VLASDSR NAMPT 175-189 YLLETSGNLDGLEYK 36813 4LW 185.A,187.A, 2,5,6 Nicotinamide 1415 188.A,189.A, phosphoribosyl- 184.B,185.B, transferase 189.B NCBP1Nuclear 42-65 SACSLESNLEGLAGVL 2313 3FEY NoOverlap cap-bindingprotein EADLPNYK 14 subunit1 NHP2L1NHP2-like 114-125 QQIQSIQQSIER 236 3SIV 118.A,119.A, 4,36,61 protein1 118.J,119.J, 120.J,121.J, 125.J NONONon-POU 127-135 VELDNMPLR 3 3SDE 127.B,131.B 1 domain-containing octamer-binding protein NONONon-POU 257-270 FAQPGSFEYEYAMR 6 3SDE 257.B,258.B, 6,13 domain-containing 259.B,260.B, octamer-binding 265.B,267.B protein NONONon-POU 296-304 LEMEMEAAR 6 3SDE NoOverlap domain-containing octamer-binding protein NONONon-POU 154-176 NLPQYVSNELLEEAFS 2369 3SDE 154.B,173.B, 2,5 domain-containing VFGQVER 1314 174.B,175.B octamer-binding protein NONONon-POU 177-184 AVVIVDDR 6 3SDE 181.B,183.B, 3 domain-containing 184.B octamer-binding protein NPM1 55-73 DELHIVEAEAMNYEG 13 2P1B 55.A,56.A, 1,4,5,7,12, Nucleophosmin SPIK 57.A,55.B, 13,19,23, 56.B,66.B, 25,27,32,38 67.B,68.B, 72.B,55.C, 56.C,57.C, 64.C,65.C, 67.C,68.C, 55.D,56.D, 57.D,61.D, 73.D,55.E, 56.E,57.E, 61.E,72.E, 73.E,55.F, 56.F,57.F, 64.F,65.F, 67.F,68.F, 55.G,56.G, 57.G,61.G, 63.G,64.G, 65.G,73.G, 55.H,56.H, 57.H,63.H, 64.H,65.H, 55.I,56.I, 57.I,55.I, 56.I,57.J NPM1 81-101 MSVQPTVSLGGFEITP 13 2P1B 81.A,82.A, 1,9,12,13, Nucleophosmin PVVLR 83.A,84.A, 14,15,16, 86.A,87.A, 17,25,29, 88.A,89.A, 30,31,32, 90.A,95.A, 33,36,37,38 81.B,82.B, 83.B,84.B, 86.B,87.B, 88.B,89.B, 90.B,81.C, 82.C,83.C, 84.C,86.C, 87.C,88.C, 89.C,90.C, 92.C,93.C, 94.C,95.C, 96.C,81.D, 82.D,83.D, 84.D,88.D, 89.D,90.D, 81.E,82.E, 83.E,84.E, 88.E,89.E, 90.E,93.E, 81.F,82.F, 83.F,84.F, 86.F,87.F, 88.F,89.F, 90.F,94.F, 95.F,97.F, 99.F,81.G, 82.G,83.G, 84.G,85.G, 86.G,88.G, 89.G,90.G, 94.G,95.G, 96.G,97.G, 99.G,101.G, 81.H,82.H, 83.H,84.H, 86.H,87.H, 88.H,89.H, 90.H,94.H, 95.H,96.H, 98.H,81.I, 82.I,83.I, 84.I,86.I, 87.I,88.I, 89.I,90.I, 95.I,96.I, 81.I,82.J, 83.J,84.J, 86.J,87.J, 88.J,89.J, 90.J,95.J, 96.J NTMT1N-terminal 167-185 DNMAQEGVILDDVDS 13 5E2B 168.A,180.A, 1,4,7,18 Xaa-Pro-LysN- SVCR 182.A, methyltransferase1 183.A,184.A, 185.A,167.B, 168.B,169.B, 170.B,171.B, 178.B,179.B, 182.B,183.B, 184.B,185.B OATOrnithine 332-351 VAIAALEVLEEENLAE 1314 20AT 340.A,341.A, 6,21,24,43 aminotransferase, NADK 344.A,346.A, mitochondrial 334.B, 338.B,344.B, 347.B,350.B, 340.C,341.C, 344.C,350.C P4HBProtein 171-195 QFLQAAEAIDDIPFGIT 9 4JU5 178.A,179.A, 4,13 disulfide-isomerase SNSDVFSK 181.A,181.B P4HBProtein 231-247 HNQLPLVIEF1EQTAP 21314 4JU5 231.A,232.A, 2,3,4,5,7, disulfide-isomerase K 233.A,234.A, 11,13,15 235.A,236.A, 242.A, 244.A,245.A, 246.A,231.B, 233.B,234.B, 235.B, 238.B,239.B, 240.B,241.B, 244.B,245.B, 247.B PABPC1 114-129 ALYDTFSAFGNILSCK 14 1CVJ 116.A,127.A, 1,2,9,12, Polyadenylate- 128.A,116.B, 13,16,27 bindingprotein1 126.B,127.B, 128.B, 129.B,116.C, 125.C,126.C, 127.C,128.C, 116.D,116.E, 117.E,125.E, 127.E, 128.E,116.G, 126.G,128.G PABPC1 51-67 SLGYAYVNFQQPADA 314 1CVJ 51.A,52.A, 2,3,4,5,7, Polyadenylate- ER 58.A,60.A, 11,14,22, bindingprotein1 58.B,61.C, 30,32,33, 64.C,67.C, 43,51,52,53 51.E,52.E, 56.E,64.E, 66.E,67.E, 52.F,60.F, 60.G,67.G, 51.H,56.H, 60.H PARP1Poly 762-779 VEMLDNLLDIEVAYSL 36 4ZZZ 762.A,763.A, 1,2,29 LR 766.A,767.A, 769.A,773.A, 763.B, 766.B,769.B PARP1Poly 954-1000 TTPDPSANISLDGVDV 3 4ZZZ 962.A,964.A, 3,4,6,8,9, PLGTGISSGVNDTSLL 965.A,967.A, 13,16,22, YNEYIVYDIAQVNLK 980.A,981.A, 24,25,26 983A, 985.A,988.A, 992.A,993.A, 996.A,1000.A, 955.B, 961.B,968.B, 970.B,981.B, 982.B,983.B, 985.B,986.B, 988.B, 989.B,992.B, 993.B,996.B PCMT1Protein-L- 179-197 LILPVGPAGGNQMLEQ 2314 1I1N 183.A,185.A 5 isoaspartate(D-aspartate) YDK O-methyltransf PCNAProliferating 118-138 LMDLDVEQLGIPEQEY 14 5E0V 121.A,122.A, 1,2,11 cellnuclearantigen SCVVK 123.A,122.B, 123.B,124.B, 125.B, 126.B PDCD4 246-256 DLPELALDTPR 13 3EIJ 256.A 1 Programmedcell deathprotein4 PDHBPyruvate 53-68 VFLLGEEVAQYDGAY 2313 3EXE 31.B,32.B, 1,2,3,12, dehydrogenaseE1 K 14 37.B,23.D, 13,14,18, componentsubunit 28.D,33.D, 19,21,29 beta, 36.D,37.D, 28.F,31.F, 32.F,33.F, 36.F,37.F, 24.H,28.H, 31.H,32.H, 36.H,37.H PGK1 333-350 QIVWNGPVGVFEWEA 3 2WZB NoOverlap Phosphoglycerate FAR kinase1 PGRMC1 106-119 FYGPEGPYGVFAGR 23413 4X8Y 108.A, 12 Membrane-associated 14 109.A,110.A progesterone receptorcomponen PKMPyruvate 174-186 IYVDDGLISLQVK 29 4FXF 177.D,180.D, 1,2,4,16, kinaseisozymes 175.C,177.C, 47,62 M1/M2 178.C,179.C, 180.C,182.C, 175.B, 177.B,180.B, 182.B PKMPyruvate 401-422 LAPITSDPTEATAVGA 29 4FXF 401.A,403.A, 3,9,37,39, kinaseisozymes VEASFK 418.A,420.A, 41,53,68, M1/M2 421.A,422.A, 75,78 401.D, 408.D,409.D, 420.D,421.D, 404.C,407.C, 408.C, 409.C,410.C, 402.B,403.B, 404.B,414.B PORNADPH-- 369-382 TALTYYLDITNPPR 1314 3QFS 375.A,376.A 2,5 cytochromeP450 reductase PPP1CA 133-141 IYGFYDECK 2 4XPN 134.C,139.0 3,4 Serine/threonine- proteinphosphatase PP1-alphacat PPP1CC 44-60 EIFLSQPILLELEAPLK 14 4UT2 55.A,56.A, 13,14 Serine/threonine- 47.B,48.B, proteinphosphatase 49.B,50.B, PP1-gammacat 51.B PPP1CC 133-141 IYGFYDECK 2 4UT2 NoOverlap Serine/threonine- proteinphosphatase PP1-gammacat PPT1Palmitoyl- 75-101 TLMEDVENSFFLNVNS 2489 3GRO 75.A,76.A, 1,2,5,10 proteinthioesterase QVTTVCQALAK 1314 78.A,75.B, 1 15 76.B,80.B, 81.B,85.B, 86.B,87.B, 90.B PRDX2 120-127 TDEGIAYR 13 1QMV 121.A,122.A, 3,5,6,7,8, Peroxiredoxin-2 121.B,122.B, 14,15,18, 124.B,121.C, 20,26,27, 122.C,124.C, 29,30,32, 127.C, 36,42,43, 120.D,121.D, 54,72,111 122.D,124.D, 126.D,127.D, 121.E, 122.E,124.E, 127.E,121.F, 122.F,124.F, 127.F,121.G, 122.G,124.G, 120.H,121.H, 122.H, 124.H,126.H, 127.H,120.I, 121.I,122.I, 124.I,126.I, 127.I,120.J, 121.I,122.J, 124.J,126.J, 127.J PSMA2Proteasome 144-159 PYLFQSDPSGAYFAW 2 4R3O 144.B,152.B, 1,28,63,69, subunitalphatype-2 K 154.B,155.B, 93 156B,147.P, 149.P,154.P, 155.P,157.P PSMA2Proteasome 19-39 LVQIEYALAAVAGGA 3 4R3O 25.P,28.P 28 subunitalphatype-2 PSVGIK PSMA4Proteasome 68-91 LNEDMACSVAGITSD 36813 4R3O 71.C,80.C, 1,69,93, subunitalphatype-4 ANVLTNELR 14 81.C,84.C, 145,147 85.C,88.C, 70.Q,81.Q, 85.Q,87.Q, 88.Q,89.Q, 91.Q PSMB1Proteasome 129-146 FFPYYVYNIIGGLDEE 21314 4R3O 107.M,108.M, 4,11,57 subunitbetatype-1 GK 15 109.M,118.M, 107.I,109.I PSMB2Proteasome 96-126 TPYHVNLLLAGYDEH 26 4R3O 96.K,97.K, 97,145,180, subunitbetatype-2 EGPALYYMDYLAALA 98.K,99.K, 181,191 K 101.K,108.K, 110.K,111.K, 119.K,101.Y, 116.Y,119.Y, 124.Y,125.Y, 126.Y PSMB2Proteasome 42-62 ILLLCVGEAGDTVQFA 6 4R3O 49.K,52.K, 97,149,163 subunitbetatype-2 EYIQK 48.Y,54.Y, 58.Y,61.Y PSMB3Proteasome 100-115 FGPYYTEPVIAGLDPK 3613 4R3O 100.J,106.X, 1,3,198 subunitbetatype-3 1415 113.X,114.X PSMB4Proteasome 61-80 FEGGVVIAADMLGSY 6 4R3O 30.2,35.2 67 GSLAR PSMB5Proteasome 141-150 LLANMVYQYK 346 4R3O 88.L,91.L 97 subunitbetatype-5 PSMB5Proteasome 226-239 DAYSGGAVNLYHVR 6 4R3O NoOverlap subunitbetatype-5 PSMB6Proteasome 80-118 SGSAADTQAVADAVT 3614 4R30 48.H,50.H, 10,23,50, subunitbetatype-6 YQLGFHSIELNEPPLV 51.H,60.H, 67,152,155 HTAASLFK 61.H,64.H, 160,169, 65.H,67.H, 187,200, 68.H,69.H, 204,206,212 70.H,71.H, 75.H,77.H, 78.H,84.H, 46.V,48.V, 50.V,51.V, 53.V,62.V, 65.V,70.V, 72.V,75.V, 77.V,78.V, 82.V,84.V PSPC1Paraspeckle 229-247 PVIVEPMEQFDDEDGL 614 3SDE 229.A,231.A, 1,2,3,4,6 component1 PEK 232.A,233.A, 235.A,237.A, 239.A, 240.A,241.A PTGR2 93-106 GDFVTSFYWPWQTK 14 2ZB4 97.A 2 Prostaglandin reductase2 PTGR2 262-278 DVPYPPPLSPAIEAIQK 2314 2ZB4 263.A,265.A, 1,4 Prostaglandin 267.A,277.A, reductase2 278.A RAB7ARas-related 104-113 DEFLIQASPR 14 1YHN NoOverlap proteinRab-7a RARSArginine-- 528-540 GNTAAYLLYAFTR 14 4ZAJ 464.A,467.A, 1 tRNAligase, 468.A cytoplasmic RPL3060S 58-68 SEIEYYAMLAK 13 3VI6 NoOverlap ribosomalprotein L30 RUVBL1RuvB-like1 318-333 ALESSIAPIVIFASNR 2 2XSZ 229.A,231.A, 2,3,4,5,12, 232.A,233.A, 20,37,39, 234.A,235.A, 45,47,48, 236.A, 52,53,55, 237.A,243.A, 58,69 229.B,231.B, 232.B,233.B, 236.B,229.C, 230.C, 231.C,232.C, 233.C,234.C, 235.C,236.C, 237.C,238.C, 243.C,244.C RUVBL1RuvB-like1 91-107 VPFCPMVGSEVYSTEI 2 2XSZ 105.A,106.A, 1,2,3,7,8, K 107.A,108.A, 13,33 115.A,116.A, 117.A, 118.A,119.A, 120.A,121.A, 105.B,106.B, 107.B, 108.B,120.B, 105.C,106.C, 107.C,113.C, 120.C RUVBL2RuvB-like 315-330 ALESDMAPVLIMATN 14 3UK6 316.A,317.A, 1,3,4,5,6, 2 R 318.A,319.A, 7,8,9,10, 320.A, 11,12,13, 322.A,323.A, 15,18,19, 329.A,315.B, 20,22,23, 317.B,318.B, 24,25,30, 319.B,320.B, 31,33,37, 321.B,322.B, 48,54,64, 323.B,329.B, 65,72,75, 315.C, 80,83,98, 316.C,318.C, 100,117, 322.C,315.D, 121,147, 316.D,317.D, 154,155 318.D,319.D, 321.D, 322.D,323.D, 329.D,318.E, 319.E,322.E, 323.E, 329.E,315.F, 316.F,317.F, 318.F,319.F, 320.F,322.F, 323.F,329.F, 315.G,320.G, 329.G,330.G, 315.H,318.H, 320.H, 322.H,323.H, 324.H,327.H, 329.H,315.I, 317.I,318.I, 319.I,320.I, 322.I,329.I, 315.I,318.J, 320.I,322.I, 323.I,327.J, 329.I,318.K, 319.K,322.K, 323.K,325.K, 328.K,318.L, 319.L, 320.L,322.L, 323.L,325.L, 329.L SFPQSplicing 377-399 NLSPYVSNELLEEAFS 2349 4WIK 377.A,380.A, 1,3,6,12 factor,proline-and QFGPIER 1314 381.A, glutamine-rich 399.A,377.B SFPQSplicing 444-462 PVIVEPLEQLDDEDGL 2414 4WIK 450.A,452.A, 5,8,12 factor,proline-and PEK 455.A,446.B, glutamine-rich 447.B,448.B, 449.B, 455.B SLC25Al2 260-283 YGQVTPLEIDILYQLA 414 4P5X NoOverlap Calcium-binding DLYNASGR mitochondrial carrierproteinAral SLC25A13 261-282 FGQVTPMEVDILFQLA 2346 4P5W 262.A,263.A, 1,4,10,11 Calcium-binding DLYEPR 1415 264.A,265.A, mitochondrial 267.A,273.A, carrierproteinAral 274.A, 276.A,277.A, 280.A,282.A, 261.B,262.B, 263.B, 264.B,265.B, 267.B,268.B, 270.B,273.B, 274.B,276.B, 280.B SLC25A13 642-653 LAVATFAGIENK 3468 4P5W 647.A,649.A, 1,2,3,4,8 Calcium-binding 1415 650.A,651.A, mitochondrial 653.A,647.B, carrierproteinAral 648.B, 649.B,650.B, 651.B SMYD3SETand 255-265 DQYCFECDCFR 9 5HQ8 255.A,256.A, 1,2,5,6,8, MYNDdomain- 258.A,259.A, containingprotein3 260.A,264.A, 255.B, 256.B,258.B, 259.B SPTBN1Spectrin 1706-1717 EVDDLEQWIAER 13 3EDV NoOverlap betachain,non- erythrocytic1 STAG2Cohesin 273-290 ELQENQDEIENMMNAI 13 4PK7 NoOverlap subunitSA-2 FK TIMM10 6-24 AQQLAAELEVEMMA 8913 2BSK 15.D,19.D, 3,11 Mitochondrial 14 20.D,22.D, importinner 23.D,24.D DMYNR membrane translocasesu TIMM44 428-439 DQDELNPYAAWR 13 2CW9 434.A,435.A, 1 Mitochondrial 438.A importinner membrane translocasesu TNPO1Transportin- 273-298 TQDQDENVALEACEF 9 4OO6 265.A, 3 1 WLTLAEQPICK 266.A,267.A TNPO1Transportin- 45-64 LEQLNQYPDFNNYLIF 21314 4OO6 37.A,38.A, 11,16,18 1 VLTK 40.A,43.A, 45.A,46.A TPP1Tripeptidyl- 521-558 GCHESCLDEEVEGQGF 4913 3EDY 522.A,524.A, 4,8,13 peptidase1 CSGPGWDPVTGWGTP 1415 531.A,532.A, NFPALLK 534.A,535.A, 537.A, 540.A,541.A, 543.A,548.A TSNTranslin 205-215 VEEVVYDLSIR 2 3PJA 206.A,207.A, 1,2,3,4,6, 209.A,210.A, 11,15,49, 211.A,215.A, 54,65,68, 207.B, 94,101,116 211.B,213.B, 215.B,207.C, 209.C,213.C, 214.C,215.C, 206.D,207.D, 209.D,210.D, 211.D, 213.D,214.D, 215.D,207.E, 211.E, 214.E,215.E, 207.F,208.F, 211.F,215.F, 207.G,210.G, 211.G,214.G, 215.G,207.H, 211.H,215.H, 207.I, 209.I,211.I, 213.I,214.I, 215.I TXNDC17 4-17 YEEVSVSGFEEFHR 14 1WOU NoOverlap Thioredoxin domain-containing protein17 VDAC1Voltage- 140-161 GALVLGYEGWLAGY 24613 2JK4 144.A,146.A, 1,2,6 dependentanion- QMNFETAK 14 149.A,152.A, selectivechannel 153.A,155.A, protein 157.A VDAC1Voltage- 121-139 EHINLGCDMDFDIAGP 24813 2JK4 126.A,127.A, 1,6 dependentanion- SIR 14 131.A,142.A selectivechannel protein VDAC1Voltage- 75-93 WNTDNTLG1EITVED 2346 2JK4 84.A,85.A, 5 dependentanion- QLAR 8913 86.A,87.A selectivechannel 1415 protein VDAC1Voltage- 164-174 VTQSNFAVGYK 46814 2JK4 173.A,174.A, 1,2 dependentanion- 175.A,176.A, selectivechannel 177.A protein VDAC1Voltage- 64-74 WTEYGLTF 2346 2JK4 NoOverlap dependentanion- ILK 8913 selectivechannel 1415 protein VDAC1Voltage- 35-53 SENGLEFTSSGSAN1E 489 2JK4 45.A,47.A 7 dependentanion- TTK selectivechannel protein VDAC1Voltage- 175-197 TDEFQLHTNVNDGTEF 4814 2JK4 180.A,181.A, 1,2,4 dependentanion- GGSIYQK 184.A,185.A, selectivechannel 186.A, protein 196.A,197.A, 198.A VDAC1Voltage- 225-236 YQIDPDACFSAK 48 2JK4 229.A 4 dependentanion- selectivechannel protein VIMVimentin 176-184 DNLAEDIMR 6 4YPC NoOverlap VIMVimentin 197-207 EEAENTLQSFR 2369 4YPC NoOverlap 131415 VIMVimentin 189-196 LQEEMLQR 36 4YPC NoOverlap VIMVimentin 224-235 VESLQEEIAFLK 4614 4YPC NoOverlap VPS33AVacuolar 233-262 NVDLLTPLATQLTYEG 14 4BX9 NoOverlap proteinsorting- LIDEIYGIQNSYVK associatedprotein 33A XRCC6X-rayrepair 475-488 SDSFENPVLQQHFR 2348 1JEY 476.A, 1,25 cross- 13 486.A,488.A complementing protein6 XRCC6X-rayrepair 489-510 NLEALALDLMEPEQA 2348 1JEY 491.A,497.A, 14,25 cross- VDLTLPK 13 508.A,509.A complementing protein6 YWHAE14-3-3 197-215 AAFDDAIAELDTLSEE 13 3UBW 212.A 1 proteinepsilon SYK YWHAE14-3-3 143-153 EAAENSLVAYK 13 3UBW NoOverlap proteinepsilon YWHAQ14-3-3 194-212 TAFDEAIAELDTLNED 14 5IQP 196.A,197.A, 2,6,10 proteintheta SYK 196.B,197.B, 209.B,210.B YWHAZ14-3-3 194-212 TAFDEAIAELDTLSEES 1314 5D2D 196.A,197.A, 1,6,13,19 proteinzeta/delta YK 200.A,203.A, 211.A,194.B, 198.B, 211.B,212.B

    TABLE-US-00009 TABLE3 Annotated Estimated SEQ Accension Labeled Functional Distance ID # ProteinName Peptide PeptideSequence Probes PDB Site fromSite NO: P24666 ACP1Low 42-59 VDSAATSGYEIG 13 3N81 ACT_SITE 2.995 1 molecular NPPDYR 1313, weight ACT_SITE phosphotyrosine 1919, proteinphosp ACT_SITE 130130 Q8NI60 ADCK3 277-295 LGQMLSIQDDAFI 14 4PED NP_BIND 2.639 2 Chaperone NPHLAK 336344, activityof ACT_SITE bc1 488488, complex-like, BINDING mitochondr 358358 P55263 ADK 209-224 IFTLNLSAPFISQF 2 4O1L ACT_SITE 5.239 3 Adenosine YK 317317, kinase METAL49 49,METAL 147147, METAL148 148 P30520 ADSS 431-441 FIEDELQIPVK 14 2V40 NP_BIND39 6.392 4 Adenylosuccin 45, atesynthetase NP_BIND67 isozyme2 69, NP_BIND 362364, NP_BIND 444447, ACT_SITE 4040, ACT_SITE 6868, METAL40 40,METAL 6767, BINDING40 40, BINDING 162162, BINDING 176176, BINDING 255255, BINDING 270270, BINDING 334334, BINDING 336336 O95831 AIFM1 475-510 PYWHQSMFWSD 32 4LII NP_BIND 0 5 Apoptosis- LGPDVGYEAIGL 46 138142, inducing VDSSLPTVGVFA NP_BIND factor1, K 164165, mitochondrial NP_BIND 454455, BINDING 172172, BINDING 177177, BINDING 233233, BINDING 285285, BINDING 438438, BINDING 483483 P49419 ALDH7A1 139-162 ILVEGVGEVQEY 138 4ZUL NP_BIND 4.14 6 Alpha- VDICDYAVGLSR 274279, aminoadipic ACT_SITE semialdehyde 296296, dehydrogenase ACT_SITE 330330, SITE195 195 P18085 ARF4ADP- 39-59 LGEIVTTIPTIGFN 133 1Z6X NP_BIND24 2.742 7 ribosylation 31, factor4 NP_BIND67 VETVEYK 28 71, NP_BIND 126129 P84085 ARF5ADP- 39-59 LGEIVTTIPTIGFN 133 2B6H NP_BIND24 2.639 8 ribosylation VETVEYK 428 31, factor5 NP_BIND67 71, NP_BIND 126129 P40616 ARL1ADP- 163-178 GTGLDEAMEWL 1413 4DCN NP_BIND24 3.491 9 ribosylation VETLK 31, factor-like NP_BIND45 protein1 48, NP_BIND67 71, NP_BIND 126129, NP_BIND 160161, METAL31 31,METAL 4848, BINDING70 70 P40616 ARL1ADP- 37-59 LQVGEVVTTIPTI 13 4DCN NP_BIND24 0 10 ribosylation GFNVETVTYK 31, factor-like NP_BIND45 48, NP_BIND67 71, NP_BIND 126129, NP_BIND protein1 160161, METAL31 31,METAL 4848, BINDING70 70 P31939 ATIC 178-194 AFTHTAQYDEAI 13 1PKX NP_BIND12 2.81 11 Bifunctional SDYFR 14, purine NP_BIND34 biosynthesis NP_BIND64 proteinPURH 67, NP_BIND 101104, NP_BIND 125127, ACT_SITE 137137, ACT_SITE 267267, BINDING 316316, BINDING 339339, BINDING 431431, BINDING 451451, BINDING 541541, BINDING 588588, SITE266266 Q13867 BLMH 111-124 CYFFLSAFVDTA 14 1CB5 ACT_SITE 15.919 12 Bleomycin QR 7373, hydrolase ACT_SITE 372372, ACT_SITE 396396 Q13867 BLMH 203-218 GEISATQDVMME 13 1CB5 ACT_SITE 19.295 13 Bleomycin EIFR 7373, hydrolase ACT_SITE 372372, ACT_SITE 396396 P27797 CALR 323-351 SGTIFDNFLITND 139 3POW METAL26 0 14 Calreticulin EAYAEEFGNETW 6 26,METAL GVTK 6262, METAL64 64,METAL 328328, BINDING 109109, BINDING 111111, BINDING 128128, BINDING 135135, BINDING 317317 P27797 CALR 99-111 HEQNEDCGGGYV 6 3POW METAL26 0 15 Calreticulin K 26,METAL 6262, METAL64 64,METAL 328328, BINDING 109109, BINDING 111111, BINDING 128128, BINDING 135135, BINDING 317317 P07384 CAPN1 175-193 LVFVHSAEGNEF 14 2ARY ACT_SITE 7.409 16 Calpain-1 WSALLEK 115115, catalytic ACT_SITE subunit 272272, ACT_SITE 296296, SITE1516, SITE2728 P12277 CKBCreatine 14-32 FPAEDEFPDLSAH 3 3B6R NP_BIND 2.797 17 kinaseB-type NNHMAK 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12277 CKBCreatine 157-172 LAVEALSSLDGD 13 3B6R NP_BIND 7.719 18 kmaseB-type LAGR 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12277 CKBCreatine 224-236 TFLVWVNEEDHL 3 3B6R NP_BIND 0 19 kinaseB-type R 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12277 CKBCreatine 253-265 FCTGLTQIETLFK 13 3B6R NP_BIND 3.569 20 kmaseB-type 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12277 CKBCreatine 342-358 LGFSEVELVQMV 313 3B6R NP_BIND 4.632 21 kinaseB-type VDGVK 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12277 CKBCreatine 367-381 LEQGQAIDDLMP 13 3B6R NP_BIND 15.156 22 kinaseB-type AQK 128132, NP_BIND 320325, BINDING72 72, BINDING 130130, BINDING 132132, BINDING 191191, BINDING 232232, BINDING 236236, BINDING 285285, BINDING 292292, BINDING 320320, BINDING 335335 P12532 CKMT1B 257-269 SFLIWVNEEDHT 3 1QK1 NP_BIND 0 2 Creatinekinase R 161165, U-type, NP_BIND mitochondrial 353358, BINDING 224224, BINDING 269269, BINDING 325325, BINDING 368368 Q16740 CLPPPutative 215-226 QSLQVIESAMER 6 1TG6 ACT_SITE 3.045 24 ATP- 153153, dependentClp ACT_SITE protease 178178 proteolyticsu P48729 CSNK1A1 84-106 DYNVLVMDLLG 14 5FQD NP_BIND23 2.833 25 CaseinkinaseI PSLEDLFNFCSR 31, isoformalpha ACT_SITE 136136, BINDING46 46 P67870 CSNK2B 112-134 VYCENQPMLPIG 14 4NH1 METAL109 0 26 Caseinkinase LSDIPGEAMVK 109,METAL IIsubunitbeta 114114, METAL137 137,METAL 140140 P07858 CTSB 315-331 GQDHCGIESEVV 134 3K9M ACT_SITE 6.662 27 CathepsinB AGIPR 29 108108, ACT_SITE 278278, ACT_SITE 298298 P07339 CTSD 236-253 DPDAQPGGELML 9 4OD9 ACT_SITE 11.321 28 CathepsinD GGTDSK 9797, ACT_SITE 295295 P07339 CTSD 288-309 EGCEAIVDTGTSL 1314 4OD9 ACT_SITE 0 29 CathepsinD MVGPVDEVR 154 9797, 698 ACTSITE 295295 P07339 CTSD 314-331 AIGAVPLIQGEY 1415 4OD9 ACT_SITE 13.281 30 CathepsinD MIPCEK 324 9797, 136 ACT_SITE 98 295295 P00387 CYB5R3 235-241 LWYTLDR 3 1UMK NP_BIND 2.96 31 NADH- 132147, cytochromeb5 NP_BIND reductase3 171206 Q16698 DECR12,4- 299-315 FDGGEEVLISGEF 6 1W6U NP_BIND66 2.779 32 dienoyl-CoA NDLR 71, reductase, NP_BIND mitochondrial 240243, ACT_SITE 199199, BINDING91 91, BINDING91 91, BINDING 117117, BINDING 119119, BINDING 149149, BINDING 157157, BINDING 214214, BINDING 251251 Q08211 DHX9ATP- 448-456 ISAVSVAER 3 3LLM NP_BIND 3.525 33 dependent 411419 RNAhelicase A P09622 DLD 450-482 VLGAHILGPGAG 144 3RNM NP_BIND71 6.842 34 Dihydrolipoyl EMVNEAALALEY 13 80, dehydrogenase, GASCEDIAR NP_BIND mitochondrial 183185, NP_BIND 220227, NP_BIND 361364, ACT_SITE 487487, BINDING89 89, BINDING 154154, BINDING 243243, BINDING 278278, BINDING 314314, BINDING 355355 Q13011 ECH1 113-131 MFTAGIDLMDM 6 2VRE BINDING 3.9 35 Delta(3,5)- ASDILQPK 174174, Delta(2,4)- SITE197 dienoyl-CoA 197,SITE isomerase, 205205 mitoc Q13011 ECH1 149-158 YQETFNVIER 6 2VRE BINDING 2.823 36 Delta(3,5)- 174174, Delta(2,4)- SITE197 dienoyl-CoA 197,SITE isomerase, 205205 mitoc Q13011 ECH1 197-211 EVDVGLAADVG 1314 2VRE BINDING 0 37 Delta(3,5)- TLQR 153 174174, Delta(2,4)- 468 SITE197 dienoyl-CoA 197,SITE isomerase, 205205 mitoc P60842 EIF4A1 178-190 MFVLDEADEMLS 13 2ZU6 NP_BIND76 2.797 38 Eukaryotic R 83 initiationfactor 4A-I P60842 EIF4A1 69-82 GYDVIAQAQSGT 1413 2ZU NP_BIND76 0 39 Eukaryotic GK 96 83 initiationfactor 4A-I Q14240 EIF4A2 Eukaryotic 70-83 GYDVIAQAQSGT 13 3B0R NP_BIND77 0 40 initiationfactor GK 84 4A-II P38117 ETFBElectron 36-51 HSMNPFCEIAVEE 3 2A1T BINDING16 5.189 41 transfer AVR 16 flavoprotein subunitbeta P22830 FECH 254-272 SEVVILFSAHSLP 4 3HCN ACT_SITE 3.373 42 Fen-ochelatase, MSVVNR 230230, mitochondrial ACT_SITE 383383, METAL196 196,METAL 403403, METAL406 406,METAL 411411 P06280 GLAAlpha- 241-252 SILDWTSFNQER 9 355Z ACT_SITE 5.4 43 galactosidase 170170, A AC_SITE 231231 P06280 GLAAlpha- 50-67 FMCNLDCQEEPD 9 3S5Z ACT_SITE 8.622 44 galactosidase SCISEK 170170, A ACT_SITE 231231 P06280 GLAAlpha- 68-82 LFMEMAELMVSE 4 355Z ACT_SITE 14.579 45 galactosidase GWK 170170, A ACT_SITE 231231 P16278 GLB1Beta- 286-299 TEAVASSLYDILA 9 3THC ACT_SITE 7.48 46 galactosidase R 188188, ACT_SITE 268268 Q04760 GLO1 160-179 GLAFIQDPDGYW 143 3W0T ACT_SITE 0 47 Lactoyl- IEILNPNK 173173, glutathione- METAL34 lyase 34,METAL 100100, METAL127 127,METAL 173173, BINDING34 34, BINDING38 38, BINDING 104104, BINDING 123123, BINDING 127127 P00367 GLUD1 152-162 YSTDVSVDEVK 6 1L1F NP_BIND 3.908 48 Glutamate 141143, dehydrogenase ACT_SITE 1, 183183, mitochondrial BINDING 147147, BINDING 171171, BINDING 176176, BINDING 252252, BINDING 266266, BINDING 270270, BINDING 319319, BINDING 322322, BINDING 438438, BINDING 444444, BINDING 450450, BINDING 516516 P00367 GLUD1 481-496 HGGTIPIVPTAEF 6 1L1F NP_BIND 10.438 49 Glutamate QDR 141143, dehydrogenase ACT_SITE 1, 183183, mitochondrial BINDING 147147, BINDING 171171, BINDING 176176, BINDING 252252, BINDING 266266, BINDING 270270, BINDING 319319, BINDING 322322, BINDING 438438, BINDING 444444, BINDING 450450, BINDING 516516 Q9H4A6 GOLPH3 75-90 EGYTSFWNDCISS 14 3KN1 BINDING81 0 50 Golgi GLR 81, phosphoprotein BINDING90 3 90, BINDING 171171, BINDING 174174 P09211 GSTP1 56-71 FQDGDLTLYQSN 2 2A2R BINDING8 3.198 51 GlutathioneS- TILR 8,BINDING transferaseP 1414, BINDING39 39, BINDING45 45 P69905 HBA2 18-32 VGAHAGEYGAE 4 4X0L METAL59 3.717 52 Hemoglobin ALER 59,METAL subunitalpha 8888,SITE 1212,SITE 5757,SITE 6161,SITE 9191,SITE 100100 P69905 HBA2 94-100 VDPVNFK 4 4X0L METAL59 0 53 Hemoglobin 59,METAL subunitalpha 8888,SITE 1212,SITE 5757,SITE 6161,SITE 9191,SITE 100100 P06865 HEXABeta- 489-499 LTSDLTFAYER 9 2GJX ACT_SITE 28.463 54 hexosaminidase 323323 subunitalpha P30519 HMOX2Heme 48-55 AENTQFVK 1514 4WMB METAL45 3.21 55 oxygenase2 342 45 68 P30519 HMOX2Heme 69-87 LATTALYFTYSA 14 4WMH METAL45 11.935 56 oxygenase2 LEEEMER 45 P51659 HSD17B4 169-183 LGLLGLANSLAIE 3 1ZBQ NP_BIND13 1.327 57 multifunctional GR 37, enzymetype2 NP_BIND75 76, NP_BIND 164168, NP_BIND 196199, ACT_SITE 164164, BINDING21 21, BINDING40 40, BINDING99 99, BINDING 151151, BINDING 435435, BINDING 533533, BINDING 563563, BINDING 706706, BINDING 724724 P08238 HSP90AB1 360-378 VFIMDSCDELIPE 1413 3PRY BINDING46 12.676 58 Heatshock YLNFIR 46, proteinHSP BINDING88 90-beta 88, BINDING 107107, BINDING 133133, BINDING 392392 P08238 HSP90AB1 507-526 GFEVVYMTEPID 1314 3PRY BINDING46 35.151 59 Heatshock EYCVQQLK 46, proteinHSP BINDING88 90-beta 88, BINDING 107107, BINDING 133133, BINDING 392392 P14625 HSP90B1 117-135 LISLTDENALSGN 9 4NH9 BINDING 3.486 60 Endoplasmin EELTVK 107107, BINDING 149149, BINDING 162162, BINDING 168168, BINDING 199199, BINDING 448448 P14625 HSP90B1 271-285 YSQFINFPIYVWS 6 4NH9 BINDING 7.026 61 Endoplasmin SK 107107, BINDING 149149, BINDING 162162, BINDING 168168, BINDING 199199, BINDING 448448 P11142 HSPA8Heat 113-126 SFYPEEVSSMVLT 1314 3LDQ NP_BIND12 4.637 62 shockcognate K 15, 71kDaprotein NP_BIND 202204, NP_BIND 268275, NP_BIND 339342, BINDING71 71 P12268 IMPDH2 110-124 YEQGFITDPVVLS 13 1NF7 NP_BIND 21.6 63 Inosine-5- PK 274276, monophosphate NP_BIND dehydrogenase 324326, 2 ACT_SITE 331331, ACT_SITE 429429, METAL326 326,METAL 328328, METAL331 331,METAL 500500, METAL501 501,METAL 502502, BINDING 329329, BINDING 441441 P00338 LDHAL- 43-57 DLADELALVDVI 9 4JNK NP_BIND29 0 64 lactate EDK 57, dehydrogenase ACT_SITE Achain 193193, BINDING99 99, BINDING 106106, BINDING 138138, BINDING 169169, BINDING 248248 P07195 LDHBL- 234-244 MVVESAYEVEK 4 1I0Z NP_BIND31 3.118 65 lactate 53, dehydrogenase ACT_SITE Bchain 194194, BINDING 100100, BINDING 107107, BINDING 139139, BINDING 170170, BINDING 249249 Q99538 LGMN 102-118 DYTGEDVTPQNF 9 4N6O ACT_SITE 10.316 66 Legumain LAVLR 148148, ACT_SITE 189189, SITE323324 P09960 LTA4H 366-386 LVVDLTDIDPDV 134 3U9W ACT_SITE 0 67 LeukotrieneA- AYSSVPYEK 8 297297, 4hydrolase ACT_SITE 384384, METAL296 296,METAL 300300, METAL319 319,SITE 376376, SITE379379 P43490 NAMPT 175-189 YLLETSGNLDGL 1314 4LVF BINDING 9.786 68 Nicotinamide EYK 153 196196, phosphoribosyl 68 BINDING transferase 219219, BINDING 247247, BINDING 311311, BINDING 384384, BINDING 392392 P06748 NPM1 55-73 DELHIVEAEAMN 13 2P1B SITE5555, 0 69 Nucleophosmin YEGSPIK SITE8080, SITE175176 P06748 NPM1 81-101 MSVQPTVSLGGF 13 2P1B SITE5555, 1.327 70 Nucleophosmin EITPPVVLR SITE8080, SITE175176 P22061 PCMT1 179-197 LILPVGPAGGNQ 143 1I1N ACT_SITE 8.729 71 Protein-L- MLEQYDK 2 6060 isoaspartate(D- aspartate)O- methyhransf P11177 PDHB 53-68 VFLLGEEVAQYD 1314 3EXE BINDING89 2.492 72 Pyruvate GAYK 32 89 dehydrogenase E1component subunitbeta, P00558 PGK1 333-350 QIVWNGPVGVFE 3 2WZB NP_BIND 0 73 Phosphoglycerate WEAFAR 373376, kinase1 BINDING39 39, BINDING 123123, BINDING 171171, BINDING 220220, BINDING 313313, BINDING 344344 P14618 PKMPyruyate 174-186 IYVDDGLISLQVK 29 4FXF NP_BIND75 3.318 74 kinase 78,METAL isozymes 7575, M1/M2 METAL77 77,METAL 113113, METAL114 114,METAL 272272, METAL296 296, BINDING70 70, BINDING73 73, BINDING 106106, BINDING 120120, BINDING 207207, BINDING 270270, BINDING 295295, BINDING 296296, BINDING 328328, BINDING 464464, BINDING 482482, BINDING 489489, SITE270 270,SITE 433433 P14618 PKMPyruvate 401-422 LAPITSDPTEATA 29 4FXF NP_BIND75 9.657 75 kinase VGAVEASFK 78,METAL isozymes 7575, M1/M2 METAL77 77,METAL 113113, METAL114 114,METAL 272272, METAL296 296, BINDING70 70, BINDING73 73, BINDING 106106, BINDING 120120, BINDING 207207, BINDING 270270, BINDING 295295, BINDING 296296, BINDING 328328, BINDING 464464, BINDING 482482, BINDING 489489, SITE270 270,SITE 433433 P16435 PORNADPH-- 369-382 TALTYYLDITNPP 1314 3QFS NP_BIND86 3.068 76 cytochrome R 91, P450reductase NP_BIND 138141, NP_BIND 173182, NP_BIND 454457, NP_BIND 472474, NP_BIND 488491, NP_BIND 596597, NP_BIND 602606, BINDING 208208, BINDING 298298, BINDING 424424, BINDING 478478, BINDING 535535, BINDING 638638, BINDING 676676 P62136 PPP1CA 133-141 IYGFYDECK 2 4XPN ACT_SITE 4.098 77 Serine/ 125125, threonine- METAL64 protein 64,METAL phosphatase 6666, PP1-alphacat METAL92 92,METAL 9292, METAL92 92,METAL 124124, METAL124 124,METAL 173173, METAL173 173,METAL 248248, METAL248 248 P36873 PPP1CC 133-141 IYGFYDECK 2 4UT2 ACT_SITE 4.153 78 Serine/ 125125, threonine- METAL64 protein 64,METAL phosphatase 6666, PP1-gamma METAL92 cat 92,METAL 9292, METAL124 124,METAL 173173, METAL248 248,SITE 273273 P36873 PPP1CC 44-60 EIFLSQPILLELEA 14 4UT2 ACT_SITE 10.048 79 Serine/ PLK 125125, threonine- METAL64 protein 64,METAL phosphatase 6666, PP1-gamma METAL92 cat 92,METAL 9292, METAL124 124,METAL 173173, METAL248 248,SITE 273273 P50897 PPT1 75-101 TLMEDVENSFFL 1314 3GRO ACT_SITE 9.259 80 Palmitoyl- NVNSQVTTVCQA 154 115115, protein LAK 298 ACT_SITE thioesterase1 233233, ACT_SITE 289289 P32119 PRDX2 120-127 TDEGIAYR 13 1QMV ACT_SITE 2.624 81 Peroxiredoxin- 5151 2 P28070 PSMB4 61-80 FEGGVVIAADML 6 4R3O ACT_SITE 11.396 82 Proteasome GSYGSLAR 4646 subunitbeta type-4 P28074 PSMB5 141-150 LLANMVYQYK 43 4R3O ACT_SITE 10.794 83 Proteasome 6 6060, subunitbeta BINDING type-5 108108 P28074 PSMB5 226-239 DAYSGGAVNLY 6 4R3O ACT_SITE 2.795 84 Proteasome HVR 6060, subunitbeta BINDING type-5 108108 P28072 PSMB6 80-118 SGSAADTQAVAD 143 4R3O ACT_SITE 3.784 85 Proteasome AVTYQLGFHSIEL 6 3535 subunitbeta NEPPLVHTAASLF type-6 K P51149 RAB7ARas- 104-113 DEFLIQASPR 14 1YHN NP_BIND15 8.675 86 relatedprotein 22, Rab-7a NP_BIND34 40, NP_BIND63 67, NP_BIND 125128, NP_BIND 156157 Q9Y230 RUVBL2 315-330 ALESDMAPVLIM 14 3UK6 NP_BIND77 3.038 87 RuyB-like2 ATNR 84 Q9H7B4 SMYD3SET 255-265 DQYCLECDCFR 9 5HQ8 BINDING 0 88 andMYND 124124, domain- BINDING containing 132132, protein3 BINDING 181181, BINDING 239239, BINDING 259259 O14773 TPP1 521-558 GCHESCLDEEVE 1314 3EDY ACT_SITE 0 89 Tripeptidyl- GQGFCSGPGWDP 154 272272, peptidase1 VTGWGTPNFPAL 9 ACT_SITE LK 276276, ACT_SITE 475475, METAL517 517,METAL 518518, METAL539 539,METAL 541541, METAL543 543 Q9BRA2 TXNDC17 42477 YEEVSVSGFEEFH 14 IWOU ACT_SITE 12.278 90 Thioredoxin R 4343, domain- ACT_SITE containing 4646,SITE protein17 4444,SITE 4545 P62258 YWHAE14-3- 143-153 EAAENSLVAYK 13 3UBW SITE5757, 2.851 91 3protein SITE130130 epsilon P62258 YWHAE14-3- 197-215 AAFDDAIAELDT 13 3UBW SITE5757, 14.177 92 3protein LSEESYK SITE130130 epsilon P27348 YWHAQ14-3- 194-212 TAFDEAIAELDTL 14 5IQP SITE5656, 14.319 93 3proteintheta NEDSYK SITE127127 P63104 YWHAZ14-3- 194-212 TAFDEAIAELDTL 1413 5D2D SITE5656, 14.87 94 3protein SEESYK SITE127127 zeta/delta Q9UQ84 EX01 139-160 SQGVDCLVAPYE 132 3QEB METAL30 0 95 Exonuclease1 ADAQLAYLNK 698 30,METAL 7878, METAL150 150,METAL 152152, METAL171 171,METAL 173173, METAL225 225 P02545 LMNA 352-366 MQQQLDEYQELL 136 3V5B SITE266 28.999 96 Prelamin-A/C DIK SITE330 266,SITE 325325, 330,SITE 646647

    [0302] Table 4 illustrates exemplary list of proteins identified by a method described herein.

    TABLE-US-00010 Accession # Protein Name P01023 A2M Alpha-2-macroglobulin Q9NRG9 AAAS Aladin Q13685 AAMP Angio-associated migratory cell protein P49588 AARS Alanine--tRNA ligase, cytoplasmic Q5JTZ9 AARS2 Alanine--tRNA ligase, mitochondrial Q9NRN7 AASDHPPT L-aminoadipate- semialdehyde dehydrogenase-phosphop P08183 ABCB1 Multidrug resistance protein 1 Q9NRK6 ABCB10 ATP-binding cassette sub-family B member 10, mitoc O75027 ABCB7 ATP-binding cassette sub-family B member 7, mitoch Q9NUT2 ABCB8 ATP-binding cassette sub-family B member 8, mitoch P28288 ABCD3 ATP-binding cassette sub-family D member 3 P61221 ABCE1 ATP-binding cassette sub-family E member 1 Q8NE71 ABCF1 ATP-binding cassette sub-family F member 1 Q9UG63 ABCF2 ATP-binding cassette sub-family F member 2 Q9NUJ1 ABHD10 Abhydrolase domain-containing protein 10, mitochon Q8N2K0 ABHD12 Monoacylglycerol lipase ABHD12 O95870 ABHD16A Abhydrolase domain- containing protein 16A P09110 ACAA1 3-ketoacyl-CoA thiolase, peroxisomal Q9H845 ACAD9 Acyl-CoA dehydrogenase family member 9, mitochondr P11310 ACADM Medium-chain specific acyl-CoA dehydrogenase, mito P45954 ACADSB Short/branched chain specific acyl-CoA dehydrogena P49748 ACADVL Very long-chain specific acyl- CoA dehydrogenase, m P24752 ACAT1 Acetyl-CoA acetyltransferase, mitochondrial Q9BWD1 ACAT2 Acetyl-CoA acetyltransferase, cytosolic Q9H3P7 ACBD3 Golgi resident protein GCP60 Q9UKV3 ACIN1 Apoptotic chromatin condensation inducer in the nu P53396 ACLY ATP-citrate synthase Q99798 ACO2 Aconitate hydratase, mitochondrial P49753 ACOT2 Acyl-coenzyme A thioesterase 2, mitochondrial O00154 ACOT7 Cytosolic acyl coenzyme A thioester hydrolase Q9Y305 ACOT9 Acyl-coenzyme A thioesterase 9, mitochondrial Q15067 ACOX1 Peroxisomal acyl-coenzyme A oxidase 1 P24666 ACP1 Low molecular weight phosphotyrosine protein phosp P11117 ACP2 Lysosomal acid phosphatase Q9NPH0 ACP6 Lysophosphatidic acid phosphatase type 6 P33121 ACSL1 Long-chain-fatty-acid--CoA ligase 1 O95573 ACSL3 Long-chain-fatty-acid--CoA ligase 3 O60488 ACSL4 Long-chain-fatty-acid--CoA ligase 4 Q53FZ2 ACSM3 Acyl-coenzyme A synthetase ACSM3, mitochondrial P68133 ACTA1 Actin, alpha skeletal muscle P62736 ACTA2 Actin, aortic smooth muscle P60709 ACTB Actin, cytoplasmic 1 Q562R1 ACTBL2 Beta-actin-like protein 2 P68032 ACTC1 Actin, alpha cardiac muscle 1 P63261 ACTG1 Actin, cytoplasmic 2 O96019 ACTL6A Actin-like protein 6A P12814 ACTN1 Alpha-actinin-1 Q08043 ACTN3 Alpha-actinin-3 O43707 ACTN4 Alpha-actinin-4 P61163 ACTR1A Alpha-centractin P61160 ACTR2 Actin-related protein 2 P61158 ACTR3 Actin-related protein 3 P55265 ADAR Double-stranded RNA-specific adenosine deaminase Q8NI60 ADCK3 Chaperone activity of bc1 complex-like, mitochondr Q96D53 ADCK4 Uncharacterized aarF domain- containing protein kin P35611 ADD1 Alpha-adducin P55263 ADK Adenosine kinase Q9BRR6 ADPGK ADP-dependent glucokinase P30520 ADSS Adenylosuccinate synthetase isozyme 2 Q9Y4W6 AFG3L2 AFG3-like protein 2 Q53H12 AGK Acylglycerol kinase, mitochondrial P35573 AGL Glycogen debranching enzyme Q99943 AGPAT1 1-acyl-sn-glycerol-3-phosphate acyltransferase alp Q9NUQ2 AGPAT5 1-acyl-sn-glycerol-3-phosphate acyltransferase eps Q86UL3 AGPAT6 Glycerol-3-phosphate acyltransferase 4 O00116 AGPS Alkyldihydroxyacetonephosphate synthase, peroxisom P23526 AHCY Adenosylhomocysteinase O43865 AHCYL1 Putative adenosylhomocysteinase 2 Q96HN2 AHCYL2 Putative adenosylhomocysteinase 3 O95433 AHSA1 Activator of 90 kDa heat shock protein ATPase homo O95831 AIFM1 Apoptosis-inducing factor 1, mitochondrial Q12904 AIMP1 Aminoacyl tRNA synthase complex-interacting multif Q13155 AIMP2 Aminoacyl tRNA synthase complex-interacting multif O00170 AIP AH receptor-interacting protein P54819 AK2 Adenylate kinase 2, mitochondrial Q92667 AKAP1 A-kinase anchor protein 1, mitochondrial Q02952 AKAP12 A-kinase anchor protein 12 O43823 AKAP8 A-kinase anchor protein 8 Q9ULX6 AKAP8L A-kinase anchor protein 8-like Q04828 AKR1C1 Aldo-keto reductase family 1 member C1 P31751 AKT2 RAC-beta serine/threonine-protein kinase P54886 ALDH18A1 Delta-1-pyrroline-5- carboxylate synthase P00352 ALDH1A1 Retinal dehydrogenase 1 P30837 ALDH1B1 Aldehyde dehydrogenase X, mitochondrial Q3SY69 ALDH1L2 Mitochondrial 10- formyltetrahydrofolate dehydrogen P05091 ALDH2 Aldehyde dehydrogenase, mitochondrial P51648 ALDH3A2 Fatty aldehyde dehydrogenase Q02252 ALDH6A1 Methylmalonate-semialdehyde dehydrogenase [acylati P49419 ALDH7A1 Alpha-aminoadipic semialdehyde dehydrogenase P49189 ALDH9A1 4-trimethylaminobutyraldehyde dehydrogenase Q9BT22 ALG1 Chitobiosyldiphosphodolichol beta- mannosyltransfer Q9BV10 ALG12 Dol-P-Man:Man(7)GlcNAc(2)-PP- Dol alpha-1,6-mannosy Q9Y673 ALG5 Dolichyl-phosphate beta- glucosyltransferase Q9Y672 ALG6 Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-gluco Q86V81 ALYREF THO complex subunit 4 Q9UJX4 ANAPC5 Anaphase-promoting complex subunit 5 Q9UJX3 ANAPC7 Anaphase-promoting complex subunit 7 Q86XL3 ANKLE2 Ankyrin repeat and LEM domain-containing protein 2 Q8IZ07 ANKRD13A Ankyin repeat domain- containing protein 13A Q9NW15 ANO10 Anoctamin-10 P39687 ANP32A Acidic leucine-rich nuclear phosphoprotein 32 fami Q92688 ANP32B Acidic leucine-rich nuclear phosphoprotein 32 fami Q9BTT0 ANP32E Acidic leucine-rich nuclear phosphoprotein 32 fami P04083 ANXA1 Annexin A1 P50995 ANXA11 Annexin A11 P07355 ANXA2 Annexin A2 P08758 ANXA5 Annexin A5 P08133 ANXA6 Annexin A6 P20073 ANXA7 Annexin A7 Q10567 AP1B1 AP-1 complex subunit beta-1 P63010 AP2B1 AP-2 complex subunit beta Q96CW1 AP2M1 AP-2 complex subunit mu O00203 AP3B1 AP-3 complex subunit beta-1 O14617 AP3D1 AP-3 complex subunit delta-1 Q9Y2T2 AP3M1 AP-3 complex subunit mu-1 P13798 APEH Acylamino-acid-releasing enzyme Q9BZZ5 API5 Apoptosis inhibitor 5 Q06481 APLP2 Amyloid-like protein 2 Q9HDC9 APMAP Adipocyte plasma membrane- associated protein Q8NCW5 APOA1BP NAD(P)H-hydrate epimerase Q9UH17 APOBEC3B Probable DNA dC-dU- editing enzyme APOBEC-3B P02649 APOE Apolipoprotein E Q9BQE5 APOL2 Apolipoprotein L2 Q9BUR5 APOO Apolipoprotein O Q6UXV4 APOOL Apolipoprotein O-like P05067 APP Amyloid beta A4 protein P07741 APRT Adenine phosphoribosyltransferase P10398 ARAF Serine/threonine-protein kinase A- Raf P48444 ARCN1 Coatomer subunit delta P84077 ARF1 ADP-ribosylation factor 1 P61204 ARF3 ADP-ribosylation factor 3 P18085 ARF4 ADP-ribosylation factor 4 P84085 ARF5 ADP-ribosylation factor 5 E7EV62 ARFGAP1 ADP-ribosylation factor GTPase-activating protein Q8N6H7 ARFGAP2 ADP-ribosylation factor GTPase-activating protein P53367 ARFIP1 Arfaptin-1 Q92888 ARHGEF1 Rho guanine nucleotide exchange factor 1 Q92974 ARHGEF2 Rho guanine nucleotide exchange factor 2 O14497 ARID1A AT-rich interactive domain- containing protein 1A P40616 ARL1 ADP-ribosylation factor-like protein 1 Q8N6S5 ARL6IP6 ADP-ribosylation factor-like protein 6-interacting Q9NVJ2 ARL8B ADP-ribosylation factor-like protein 8B Q9NVT9 ARMC1 Armadillo repeat-containing protein 1 Q8N2F6 ARMC10 Armadillo repeat-containing protein 10 Q9UH62 ARMCX3 Armadillo repeat-containing X- linked protein 3 Q13510 ASAH1 Acid ceramidase Q9UBL3 ASH2L Set1/Ash2 histone methyltransferase complex subuni O43681 ASNA1 ATPase ASNA1 P08243 ASNS Asparagine synthetase [glutamine- hydrolyzing] Q12797 ASPH Aspartyl/asparaginyl beta- hydroxylase Q8NBU5 ATAD1 ATPase family AAA domain- containing protein 1 Q9NVI7 ATAD3A ATPase family AAA domain- containing protein 3A Q5T9A4 ATAD3B ATPase family AAA domain- containing protein 3B Q5T2N8 ATAD3C ATPase family AAA domain- containing protein 3C Q7Z3C6 ATG9A Autophagy-related protein 9A P31939 ATIC Bifunctional purine biosynthesis protein PURH Q8NHH9 ATL2 Atlastin-2 Q6DD88 ATL3 Atlastin-3 Q9HD20 ATP13A1 Probable cation-transporting ATPase 13A1 P05023 ATP1A1 Sodium/potassium-transporting ATPase subunit alpha P13637 ATP1A3 Sodium/potassium-transporting ATPase subunit alpha P54709 ATP1B3 Sodium/potassium-transporting ATPase subunit beta- P16615 ATP2A2 Sarcoplasmic/endoplasmic reticulum calcium ATPase Q93084 ATP2A3 Sarcoplasmic/endoplasmic reticulum calcium ATPase P20020 ATP2B1 Plasma membrane calcium- transporting ATPase 1 P23634 ATP2B4 Plasma membrane calcium- transporting ATPase 4 P25705 ATP5A1 ATP synthase subunit alpha, mitochondrial P06576 ATP5B ATP synthase subunit beta, mitochondrial P36542 ATP5C1 ATP synthase subunit gamma, mitochondrial P24539 ATP5F1 ATP synthase subunit b, mitochondrial O75947 ATP5H ATP synthase subunit d, mitochondrial O75964 ATP5L ATP synthase subunit g, mitochondrial P48047 ATP5O ATP synthase subunit O, mitochondrial Q93050 ATP6V0A1 V-type proton ATPase 116 kDa subunit a isoform 1 Q9Y487 ATP6V0A2 V-type proton ATPase 116 kDa subunit a isoform 2 P61421 ATP6V0D1 V-type proton ATPase subunit d 1 P38606 ATP6V1A V-type proton ATPase catalytic subunit A P21281 ATP6V1B2 V-type proton ATPase subunit B, brain isoform P36543 ATP6V1E1 V-type proton ATPase subunit E 1 Q9UBB4 ATXN10 Ataxin-10 Q99700 ATXN2 Ataxin-2 Q8WWM7 ATXN2L Ataxin-2-like protein Q9Y679 AUP1 Ancient ubiquitous protein 1 O14965 AURKA Aurora kinase A O43505 B3GNT1 N-acetyllactosaminide beta-1,3- N-acetylglucosaminy O95817 BAG3 BAG family molecular chaperone regulator 3 O95429 BAG4 BAG family molecular chaperone regulator 4 Q9UL15 BAG5 BAG family molecular chaperone regulator 5 P46379 BAG6 Large proline-rich protein BAG6 Q9UQB8 BAIAP2 Brain-specific angiogenesis inhibitor 1-associated B0UX83 BAT3 HLA-B associated transcript 3 B0UXB6 BAT5 Abhydrolase domain-containing protein 16A Q07812 BAX Apoptosis regulator BAX Q9NRL2 BAZ1A Bromodomain adjacent to zinc finger domain protein Q9UIG0 BAZ1B Tyrosine-protein kinase BAZ1B P51572 BCAP31 B-cell receptor-associated protein 31 O75934 BCAS2 Pre-mRNA-splicing factor SPF27 Q9P287 BCCIP BRCA2 and CDKN1A-interacting protein P12694 BCKDHA 2-oxoisovalerate dehydrogenase subunit alpha, mito Q9BXK5 BCL2L13 Bcl-2-like protein 13 Q9NYF8 BCLAF1 Bcl-2-associated transcription factor 1 Q9Y276 BCS1L Mitochondrial chaperone BCS1 P55957 BID BH3-interacting domain death agonist Q13867 BLMH Bleomycin hydrolase P53004 BLVRA Biliverdin reductase A P30043 BLVRB Flavin reductase (NADPH) Q9NSY1 BMP2K BMP-2-inducible protein kinase Q14137 BOP1 Ribosome biogenesis protein BOP1 Q6PJG6 BRAT1 BRCA1-associated ATM activator 1 P25440 BRD2 Bromodomain-containing protein 2 Q8WY22 BRI3BP BRI3-binding protein Q8TDN6 BRIX1 Ribosome biogenesis protein BRX1 homolog Q5VW32 BROX BRO1 domain-containing protein BROX Q9NW68 BSDC1 BSD domain-containing protein 1 P35613 BSG Basigin Q06187 BTK Tyrosine-protein kinase BTK O60566 BUB1B Mitotic checkpoint serine/threonine-protein kinase O43684 BUB3 Mitotic checkpoint protein BUB3 Q13895 BYSL Bystin Q7L1Q6 BZW1 Basic leucine zipper and W2 domain-containing prot Q69YU5 C12orf73 Uncharacterized protein C12orf73 Q9Y224 C14orf166 UPF0568 protein C14orf166 Q96GQ5 C16orf58 UPF0420 protein C16orf58 Q9BSF4 C19orf52 Uncharacterized protein C19orf52 Q4ZIN3 C19orf6 Membralin E9PFR7 C1orf27 Protein C1orf27 Q07021 C1QBP Complement component 1 Q subcomponent-binding prot Q9BQP7 C20orf72 Uncharacterized protein C20orf72 P30042 C21orf33 ES1 protein homolog, mitochondrial Q9H6V9 C2orf43 UPF0554 protein C2orf43 Q8WWC4 C2orf47 Uncharacterized protein C2orf47, mitochondrial Q96FZ2 C3orf37 UPF0361 protein C3orf37 Q9H993 C6orf211 UPF0364 protein C6orf211 Q9H7E9 C8orf33 UPF0488 protein C8orf33 Q5T6V5 C9orf64 UPF0553 protein C9orf64 Q9Y376 CAB39 Calcium-binding protein 39 Q9HB71 CACYBP Calcyclin-binding protein P27708 CAD CAD protein Q9BY67 CADM1 Cell adhesion molecule 1 P05937 CALB1 Calbindin P62158 CALM1 Calmodulin P27797 CALR Calreticulin O43852 CALU Calumenin Q14012 CAMK1 Calcium/calmodulin-dependent protein kinase type 1 Q13557 CAMK2D Calcium/calmodulin-dependent protein kinase type I Q13555 CAMK2G Calcium/calmodulin-dependent protein kinase type I P27824 CANX Calnexin P07384 CAPN1 Calpain-1 catalytic subunit P17655 CAPN2 Calpain-2 catalytic subunit P04632 CAPNS1 Calpain small subunit 1 Q14444 CAPRIN1 Caprin-1 P47756 CAPZB F-actin-capping protein subunit beta Q86X55 CARM1 Histone-arginine methyltransferase CARM1 P49589 CARS Cysteine--tRNA ligase, cytoplasmic P20810 CAST Calpastatin P04040 CAT Catalase P35520 CBS Cystathionine beta-synthase Q13185 CBX3 Chromobox protein homolog 3 P45973 CBX5 Chromobox protein homolog 5 Q96G28 CCDC104 Coiled-coil domain-containing protein 104 O60826 CCDC22 Coiled-coil domain-containing protein 22 Q96A33 CCDC47 Coiled-coil domain-containing protein 47 Q96ER9 CCDC51 Coiled-coil domain-containing protein 51 Q16204 CCDC6 Coiled-coil domain-containing protein 6 P78371 CCT2 T-complex protein 1 subunit beta P49368 CCT3 T-complex protein 1 subunit gamma P50991 CCT4 T-complex protein 1 subunit delta P48643 CCT5 T-complex protein 1 subunit epsilon P40227 CCT6A T-complex protein 1 subunit zeta Q99832 CCT7 T-complex protein 1 subunit eta P50990 CCT8 T-complex protein 1 subunit theta O95400 CD2BP2 CD2 antigen cytoplasmic tail- binding protein 2 P60033 CD81 CD81 antigen Q9UJX2 CDC23 Cell division cycle protein 23 homolog P30260 CDC27 Cell division cycle protein 27 homolog Q16543 CDC37 Hsp90 co-chaperone Cdc37 P60953 CDC42 Cell division control protein 42 homolog Q99459 CDC5L Cell division cycle 5-like protein P19022 CDH2 Cadherin-2 O14735 CDIPT CDP-diacylglycerol--inositol 3- phosphatidyltransfe P06493 CDK1 Cyclin-dependent kinase 1 P24941 CDK2 Cyclin-dependent kinase 2 P11802 CDK4 Cyclin-dependent kinase 4 Q96JB5 CDK5RAP3 CDK5 regulatory subunit- associated protein 3 Q00534 CDK6 Cyclin-dependent kinase 6 P50750 CDK9 Cyclin-dependent kinase 9 Q5VV42 CDKAL1 Threonylcarbamoyladenosine tRNA methylthiotransfer O95674 CDS2 Phosphatidate cytidylyltransferase 2 Q03701 CEBPZ CCAAT/enhancer-binding protein zeta Q9BXW7 CECR5 Cat eye syndrome critical region protein 5 Q92879 CELF1 CUGBP Elav-like family member 1 Q5SW79 CEP170 Centrosomal protein of 170 kDa Q9C0F1 CEP44 Centrosomal protein of 44 kDa Q9Y6K0 CEPT1 Choline/ethanolaminephosphotransferase 1 P27544 CERS1 Ceramide synthase 1 Q96G23 CERS2 Ceramide synthase 2 Q6ZMG9 CERS6 Ceramide synthase 6 Q9NX63 CHCHD3 Coiled-coil-helix-coiled-coil- helix domain-contain O14646 CHD1 Chromodomain-helicase-DNA- binding protein 1 Q14839 CHD4 Chromodomain-helicase-DNA- binding protein 4 O14757 CHEK1 Serine/threonine-protein kinase Chk1 Q8IWX8 CHERP Calcium homeostasis endoplasmic reticulum protein Q9NZZ3 CHMP5 Charged multiyesicular body protein 5 Q14011 CIRBP Cold-inducible RNA-binding protein Q9NZ45 CISD1 CDGSH iron-sulfur domain- containing protein 1 Q8N5K1 CISD2 CDGSH iron-sulfur domain- containing protein 2 Q8WWK9 CKAP2 Cytoskeleton-associated protein 2 Q07065 CKAP4 Cytoskeleton-associated protein 4 P12277 CKB Creatine kinase B-type P12532 CKMT1B Creatine kinase U-type, mitochondrial F5H604 CLASP2 CLIP-associating protein 2 Q96S66 CLCC1 Chloride channel CLIC-like protein 1 O14967 CLGN Calmegin O15247 CLIC2 Chloride intracellular channel protein 2 Q9Y696 CLIC4 Chloride intracellular channel protein 4 O75503 CLN5 Ceroid-lipofuscinosis neuronal protein 5 P54105 CLNS1A Methylosome subunit pICIn Q9H078 CLPB Caseinolytic peptidase B protein homolog Q16740 CLPP Putative ATP-dependent Clp protease proteolytic su O96005 CLPTM1 Cleft lip and palate transmembrane protein 1 Q96KA5 CLPTM1L Cleft lip and palate transmembrane protein 1-like P30085 CMPK1 UMP-CMP kinase Q99439 CNN2 Calponin-2 Q15417 CNN3 Calponin-3 A5YKK6 CNOT1 CCR4-NOT transcription complex subunit 1 Q9NZN8 CNOT2 CCR4-NOT transcription complex subunit 2 P09543 CNP 2,3-cyclic-nucleotide 3- phosphodiesterase Q9BT09 CNPY3 Protein canopy homolog 3 Q9Y2R0 COA3 Cytochrome C oxidase assembly factor 3 homolog, mi Q13057 COASY Bifunctional coenzyme A synthase P21964 COMT Catechol O-methyltransferase P53618 COPB1 Coatomer subunit beta P35606 COPB2 Coatomer subunit beta 014579 COPE Coatomer subunit epsilon Q9Y678 COPG1 Coatomer subunit gamma-1 Q9UBF2 COPG2 Coatomer subunit gamma-2 P61201 COPS2 COP9 signalosome complex subunit 2 Q9UNS2 COPS3 COP9 signalosome complex subunit 3 Q9BT78 COPS4 COP9 signalosome complex subunit 4 Q92905 COPS5 COP9 signalosome complex subunit 5 Q7L5N1 COPS6 COP9 signalosome complex subunit 6 Q5HYK3 COQ5 2-methoxy-6-polyprenyl-1,4- benzoquinol methylase, Q9ULV4 CORO1C Coronin-1C I3L416 CORO7 Coronin Q9Y6N1 COX11 Cytochrome c oxidase assembly protein COX11, mitoc Q7KZN9 COX15 Cytochrome c oxidase assembly protein COX15 homolo P13073 COX4I1 Cytochrome c oxidase subunit 4 isoform 1, mitochon P20674 COX5A Cytochrome c oxidase subunit 5A, mitochondrial O75976 CPD Carboxypeptidase D Q99829 CPNE1 Copine-1 O75131 CPNE3 Copine-3 P36551 CPOX Coproporphyrinogen-III oxidase, mitochondrial Q9BRF8 CPPED1 Calcineurin-like phosphoesterase domain-containing Q9UKF6 CPSF3 Cleavage and polyadenylation specificity factor su Q16630 CPSF6 Cleavage and polyadenylation specificity factor su Q8N684 CPSF7 Cleavage and polyadenylation specificity factor su P50416 CPT1A Carnitine O-palmitoyltransferase 1, liver isoform P23786 CPT2 Carnitine O-palmitoyltransferase 2, mitochondrial Q9H3G5 CPVL Probable serine carboxypeptidase CPVL P46108 CRK Adapter molecule crk P46109 CRKL Crk-like protein O75390 CS Citrate synthase, mitochondrial P16989 CSDA DNA-binding protein A O75534 CSDE1 Cold shock domain-containing protein E1 P55060 CSE1L Exportin-2 P41240 CSK Tyrosine-protein kinase CSK P48729 CSNK1A1 Casein kinase I isoform alpha P49674 CSNK1E Casein kinase I isoform epsilon P68400 CSNK2A1 Casein kinase II subunit alpha P19784 CSNK2A2 Casein kinase II subunit alpha P67870 CSNK2B Casein kinase II subunit beta P04080 CSTB Cystatin-B Q05048 CSTF1 Cleavage stimulation factor subunit 1 P33240 CSTF2 Cleavage stimulation factor subunit 2 Q12996 CSTF3 Cleavage stimulation factor subunit 3 O15320 CTAGE5 Cutaneous T-cell lymphoma- associated antigen 5 Q13363 CTBP1 C-terminal-binding protein 1 P32929 CTH Cystathionine gamma-lyase P35221 CTNNA1 Catenin alpha-1 P35222 CTNNB1 Catenin beta-1 O60716 CTNND1 Catenin delta-1 P17812 CTPS1 CTP synthase 1 P10619 CTSA Lysosomal protective protein P07858 CTSB Cathepsin B P53634 CTSC Dipeptidyl peptidase 1 P07339 CTSD Cathepsin D Q14247 CTTN Src substrate cortactin Q13620 CUL4B Cullin-4B O60888 CUTA Protein CutA Q69YN2 CWF19L1 CWF19-like protein 1 Q9BVG4 CXorf26 UPF0368 protein Cxorf26 P00167 CYB5A Cytochrome b5 O43169 CYB5B Cytochrome b5 type B Q8WUJ1 CYB5D2 Neuferricin Q9UHQ9 CYB5R1 NADH-cytochrome b5 reductase 1 P00387 CYB5R3 NADH-cytochrome b5 reductase 3 P08574 CYC1 Cytochrome c1, heme protein, mitochondrial Q7L576 CYFIP1 Cytoplasmic FMR1-interacting protein 1 Q6UW02 CYP20A1 Cytochrome P450 20A1 Q16850 CYP51A1 Lanosterol 14-alpha demethylase P51398 DAP3 28S ribosomal protein S29, mitochondrial P14868 DARS Aspartate--tRNA ligase, cytoplasmic Q6PI48 DARS2 Aspartate--tRNA ligase, mitochondrial Q96EP5 DAZAP1 DAZ-associated protein 1 Q16643 DBN1 Drebrin Q9UJU6 DBNL Drebrin-like protein P61962 DCAF7 DDB1- and CUL4-associated factor 7 Q8WVC6 DCAKD Dephospho-CoA kinase domain- containing protein P81605 DCD Dermcidin Q14203 DCTN1 Dynactin subunit 1 Q13561 DCTN2 Dynactin subunit 2 Q9UJW0 DCTN4 Dynactin subunit 4 Q9H773 DCTPP1 dCTP pyrophosphatase 1 Q92564 DCUN1D4 DCN1-like protein 4 Q7Z4W1 DCXR L-xylulose reductase Q16531 DDB1 DNA damage-binding protein 1 P39656 DDOST Dolichyl- diphosphooligosaccharide--protein glycosy Q96HY6 DDRGK1 DDRGK domain-containing protein 1 Q13206 DDX10 Probable ATP-dependent RNA helicase DDX10 Q92841 DDX17 Probable ATP-dependent RNA helicase DDX17 Q9NVP1 DDX18 ATP-dependent RNA helicase DDX18 Q9UHI6 DDX20 Probable ATP-dependent RNA helicase DDX20 Q9NR30 DDX21 Nucleolar RNA helicase 2 Q9BUQ8 DDX23 Probable ATP-dependent RNA helicase DDX23 Q9GZR7 DDX24 ATP-dependent RNA helicase DDX24 O00148 DDX39A ATP-dependent RNA helicase DDX39A Q13838 DDX39B Spliceosome RNA helicase DDX39B O00571 DDX3X ATP-dependent RNA helicase DDX3X Q86XP3 DDX42 ATP-dependent RNA helicase DDX42 Q7L014 DDX46 Probable ATP-dependent RNA helicase DDX46 P17844 DDX5 Probable ATP-dependent RNA helicase DDX5 Q9BQ39 DDX50 ATP-dependent RNA helicase DDX50 Q8TDD1 DDX54 ATP-dependent RNA helicase DDX54 P26196 DDX6 Probable ATP-dependent RNA helicase DDX6 Q16698 DECR1 2,4-dienoyl-CoA reductase, mitochondrial O15121 DEGS1 Sphingolipid delta(4)-desaturase DES1 Q9BUN8 DERL1 Derlin-1 Q9BSY9 DESI2 Desumoylating isopeptidase 2 O00273 DFFA DNA fragmentation factor subunit alpha Q96DF8 DGCR14 Protein DGCR14 Q15392 DHCR24 Delta(24)-sterol reductase P00374 DHFR Dihydrofolate reductase P49366 DHPS Deoxyhypusine synthase Q9Y394 DHRS7 Dehydrogenase/reductase SDR family member 7 Q6IAN0 DHRS7B Dehydrogenase/reductase SDR family member 7B O43143 DHX15 Putative pre-mRNA-splicing factor ATP-dependent RN Q7Z478 DHX29 ATP-dependent RNA helicase DHX29 Q7L2E3 DHX30 Putative ATP-dependent RNA helicase DHX30 Q9H2U1 DHX36 Probable ATP-dependent RNA helicase DHX36 Q14562 DHX8 ATP-dependent RNA helicase DHX8 Q08211 DHX9 ATP-dependent RNA helicase A Q9NR28 DIABLO Diablo homolog, mitochondrial O60610 DIAPH1 Protein diaphanous homolog 1 Q9Y2L1 DIS3 Exosome complex exonuclease RRP44 P10515 DLAT Dihydrolipoyllysine-residue acetyltransferase comp P09622 DLD Dihydrolipoyl dehydrogenase, mitochondrial Q15398 DLGAP5 Disks large-associated protein 5 P31689 DNAJA1 DnaJ homolog subfamily A member 1 O60884 DNAJA2 DnaJ homolog subfamily A member 2 Q96EY1 DNAJA3 DnaJ homolog subfamily A member 3, mitochondrial P25685 DNAJB1 DnaJ homolog subfamily B member 1 Q9NXW2 DNAJB12 DnaJ homolog subfamily B member 12 Q96KC8 DNAJC1 DnaJ homolog subfamily C member 1 Q8IXB1 DNAJC10 DnaJ homolog subfamily C member 10 Q9NVH1 DNAJC11 DnaJ homolog subfamily C member 11 Q99543 DNAJC2 DnaJ homolog subfamily C member 2 Q9H3Z4 DNAJC5 DnaJ homolog subfamily C member 5 Q99615 DNAJC7 DnaJ homolog subfamily C member 7 O75937 DNAJC8 DnaJ homolog subfamily C member 8 Q8WXX5 DNAJC9 DnaJ homolog subfamily C member 9 O00115 DNASE2 Deoxyribonuclease-2-alpha Q05193 DNM1 Dynamin-1 O00429 DNM1L Dynamin-1-like protein P50570 DNM2 Dynamin-2 Q9UQ16 DNM3 Dynamin-3 Q9BU89 DOHH Deoxyhypusine hydroxylase Q9UPQ8 DOLK Dolichol kinase Q86YN1 DOLPP1 Dolichyldiphosphatase 1 O60762 DPM1 Dolichol-phosphate mannosyltransferase Q9NY33 DPP3 Dipeptidyl peptidase 3 Q9UHL4 DPP7 Dipeptidyl peptidase 2 Q9Y295 DRG1 Developmentally-regulated GTP- binding protein 1 Q08554 DSC1 Desmocollin-1 Q02413 DSG1 Desmoglein-1 P15924 DSP Desmoplakin P60981 DSTN Destrin Q14204 DYNC1H1 Cytoplasmic dynein 1 heavy chain 1 Q13409 DYNC1I2 Cytoplasmic dynein 1 intermediate chain 2 Q9Y6G9 DYNC1LI1 Cytoplasmic dynein 1 light intermediate chain 1 P63167 DYNLL1 Dynein light chain 1, cytoplasmic Q96FJ2 DYNLL2 Dynein light chain 2, cytoplasmic Q99848 EBNA1BP2 Probable rRNA-processing protein EBP2 O95905 ECD Protein SGT1 P42892 ECE1 Endothelin-converting enzyme 1 Q13011 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitoc Q9NTX5 ECHDC1 Ethylmalonyl-CoA decarboxylase P30084 ECHS1 Enoyl-CoA hydratase, mitochondrial P42126 ECI1 Enoyl-CoA delta isomerase 1, mitochondrial O75521 ECI2 Enoyl-CoA delta isomerase 2, mitochondrial Q5VYK3 ECM29 Proteasome-associated protein ECM29 homolog Q6P2E9 EDC4 Enhancer of mRNA-decapping protein 4 P68104 EEF1A1 Elongation factor 1-alpha 1 Q5VTE0 EEF1A1P5 Putative elongation factor 1- alpha-like 3 P24534 EEF1B2 Elongation factor 1-beta E9PRY8 EEF1D Elongation factor 1-delta P26641 EEF1G Elongation factor 1-gamma P13639 EEF2 Elongation factor 2 Q8IYU8 EFHA1 EF-hand domain-containing family member A1 Q15029 EFTUD2 116 kDa U5 small nuclear ribonucleoprotein compone Q9H4M9 EHD1 EH domain-containing protein 1 Q9H223 EHD4 EH domain-containing protein 4 O14681 EI24 Etoposide-induced protein 2.4 homolog Q9BY44 EIF2A Eukaryotic translation initiation factor 2A P19525 EIF2AK2 Interferon-induced, double- stranded RNA-activated Q9NR50 EIF2B3 Translation initiation factor eIF- 2B subunit gamma P05198 EIF2S1 Eukaryotic translation initiation factor 2 subunit P20042 EIF2S2 Eukaryotic translation initiation factor 2 subunit P41091 EIF2S3 Eukaryotic translation initiation factor 2 subunit Q14152 EIF3A Eukaryotic translation initiation factor 3 subunit P55884 EIF3B Eukaryotic translation initiation factor 3 subunit B5ME19 EIF3CL Eukaryotic translation initiation factor 3 subunit O15371 EIF3D Eukaryotic translation initiation factor 3 subunit P60228 EIF3E Eukaryotic translation initiation factor 3 subunit B0QY89 EIF3EIP Eukaryotic translation initiation factor 3 subunit O00303 EIF3F Eukaryotic translation initiation factor 3 subunit O75821 EIF3G Eukaryotic translation initiation factor 3 subunit O15372 EIF3H Eukaryotic translation initiation factor 3 subunit Q13347 EIF3I Eukaryotic translation initiation factor 3 subunit O75822 EIF3J Eukaryotic translation initiation factor 3 subunit Q9Y262 EIF3L Eukaryotic translation initiation factor 3 subunit Q7L2H7 EIF3M Eukaryotic translation initiation factor 3 subunit P60842 EIF4A1 Eukaryotic initiation factor 4A-I Q14240 EIF4A2 Eukaryotic initiation factor 4A-II P38919 EIF4A3 Eukaryotic initiation factor 4A-III P23588 EIF4B Eukaryotic translation initiation factor 4B P06730 EIF4E Eukaryotic translation initiation factor 4E Q04637 EIF4G1 Eukaryotic translation initiation factor 4 gamma 1 P78344 EIF4G2 Eukaryotic translation initiation factor 4 gamma 2 Q15056 EIF4H Eukaryotic translation initiation factor 4H P55010 EIF5 Eukaryotic translation initiation factor 5 P63241 EIF5A Eukaryotic translation initiation factor 5A-1 Q9GZV4 EIF5A2 Eukaryotic translation initiation factor 5A-2 O60841 EIF5B Eukaryotic translation initiation factor 5B P56537 EIF6 Eukaryotic translation initiation factor 6 Q9BQ52 ELAC2 Zinc phosphodiesterase ELAC protein 2 Q15717 ELAVL1 ELAV-like protein 1 Q8IZ81 ELMOD2 ELMO domain-containing protein 2 Q9NXB9 ELOVL2 Elongation of very long chain fatty acids protein Q8N766 EMC1 ER membrane protein complex subunit 1 Q9NPA0 EMC7 ER membrane protein complex subunit 7 P50402 EMD Emerin O94919 ENDOD1 Endonuclease domain- containing 1 protein Q9UHY7 ENOPH1 Enolase-phosphatase E1 P11171 EPB41 Protein 4.1 O43491 EPB41L2 Band 4.1-like protein 2 Q9UM22 EPDR1 Mammalian ependymin-related protein 1 P07099 EPHX1 Epoxide hydrolase 1 P34913 EPHX2 Bifunctional epoxide hydrolase 2 P07814 EPRS Bifunctional glutamate/proline-- tRNA ligase P42566 EPS15 Epidermal growth factor receptor substrate 15 Q9UBC2 EPS15L1 Epidermal growth factor receptor substrate 15-like Q9NZ08 ERAP1 Endoplasmic reticulum aminopeptidase 1 Q9Y282 ERGIC3 Endoplasmic reticulum-Golgi intermediate compartme P84090 ERH Enhancer of rudimentary homolog O75477 ERLIN1 Erlin-1 O94905 ERLIN2 Erlin-2 Q96HE7 ERO1L ERO1-like protein alpha P30040 ERP29 Endoplasmic reticulum resident protein 29 Q9B526 ERP44 Endoplasmic reticulum resident protein 44 Q9BSJ8 ESYT1 Extended synaptotagmin-1 A0FGR8 ESYT2 Extended synaptotagmin-2 P62495 ETF1 Eukaryotic peptide chain release factor subunit 1 P13804 ETFA Electron transfer flavoprotein subunit alpha, mito P38117 ETFB Electron transfer flavoprotein subunit beta Q16134 ETFDH Electron transfer flavoprotein- ubiquinone oxidored Q01844 EWSR1 RNA-binding protein EWS Q9UQ84 EXO1 Exonuclease 1 Q96KP1 EXOC2 Exocyst complex component 2 Q96A65 EXOC4 Exocyst complex component 4 O00471 EXOC5 Exocyst complex component 5 Q01780 EXOSC10 Exosome component 10 Q9NQT5 EXOSC3 Exosome complex component RRP40 P15311 EZR Ezrin Q9Y624 F11R Junctional adhesion molecule A O60427 FADS1 Fatty acid desaturase 1 O95864 FADS2 Fatty acid desaturase 2 Q9UNN5 FAF1 FAS-associated factor 1 Q96CS3 FAF2 FAS-associated factor 2 P16930 FAH Fumarylacetoacetase Q9NRY5 FAM114A2 Protein FAM114A2 Q96TA1 FAM129B Niban-like protein 1 Q96A26 FAM162A Protein FAM162A Q9BTY7 FAM203A Protein FAM203A P0CB43 FAM203B Protein FAM203B Q9UK61 FAM208A Protein FAM208A Q9BRX8 FAM213A Redox-regulatory protein FAM213A Q92520 FAM3C Protein FAM3C Q9NUQ9 FAM49B Protein FAM49B Q9H019 FAM54B Protein FAM54B Q96TC7 FAM82A2 Regulator of microtubule dynamics protein 3 Q96DB5 FAM82B Regulator of microtubule dynamics protein 1 Q9UBU6 FAM8A1 Protein FAM8A1 Q8NCA5 FAM98A Protein FAM98A Q52LJ0 FAM98B Protein FAM98B Q9NVI1 FANCI Fanconi anemia group I protein Q8WVX9 FAR1 Fatty acyl-CoA reductase 1 Q9Y285 FARSA Phenylalanine--tRNA ligase alpha subunit Q9NSD9 FARSB Phenylalanine--tRNA ligase beta subunit P49327 FASN Fatty acid synthase P22087 FBL rRNA 2-O-methyltransferase fibrillarin P37268 FDFT1 Squalene synthase P22830 FECH Ferrochelatase, mitochondrial P39748 FEN1 Flap endonuclease 1 Q86UX7 FERMT3 Fermitin family homolog 3 O95684 FGFR1OP FGFR1 oncogene partner P07954 FH Fumarate hydratase, mitochondrial Q9Y613 FHOD1 FH1/FH2 domain-containing protein 1 Q6UN15 FIP1L1 Pre-mRNA 3-end-processing factor FIP1 Q96AY3 FKBP10 Peptidyl-prolyl cis-trans isomerase FKBP10 Q9NWM8 FKBP14 Peptidyl-prolyl cis-trans isomerase FKBP14 P62942 FKBP1A Peptidyl-prolyl cis-trans isomerase FKBP1A Q00688 FKBP3 Peptidyl-prolyl cis-trans isomerase FKBP3 Q02790 FKBP4 Peptidyl-prolyl cis-trans isomerase FKBP4 Q13451 FKBP5 Peptidyl-prolyl cis-trans isomerase FKBP5 Q9Y680 FKBP7 Peptidyl-prolyl cis-trans isomerase FKBP7 Q14318 FKBP8 Peptidyl-prolyl cis-trans isomerase FKBP8 Q8NFF5 FLAD1 FAD synthase Q13045 FLII Protein flightless-1 homolog Q14315 FLNC Filamin-C O75955 FLOT1 Flotillin-1 Q14254 FLOT2 Flotillin-2 Q06787 FMR1 Fragile X mental retardation protein 1 Q9H479 FN3K Fructosamine-3-kinase P49354 FNTA Protein farnesyltransferase/geranylgeranyltransfer Q96CU9 FOXRED1 FAD-dependent oxidoreductase domain-containing pro Q16658 FSCN1 Fascin Q8IY81 FTSJ3 pre-rRNA processing protein FTSJ3 Q96AE4 FUBP1 Far upstream element-binding protein 1 Q96I24 FUBP3 Far upstream element-binding protein 3 P04066 FUCA1 Tissue alpha-L-fucosidase Q9BTY2 FUCA2 Plasma alpha-L-fucosidase P35637 FUS RNA-binding protein FUS P51114 FXR1 Fragile X mental retardation syndrome-related prot P51116 FXR2 Fragile X mental retardation syndrome-related prot Q13283 G3BP1 Ras GTPase-activating protein- binding protein 1 Q9UN86 G3BP2 Ras GTPase-activating protein- binding protein 2 P11413 G6PD Glucose-6-phosphate 1- dehydrogenase P10253 GAA Lysosomal alpha-glucosidase O14976 GAK Cyclin-G-associated kinase Q10472 GALNT1 Polypeptide N- acetylgalactosaminyltransferase 1 Q10471 GALNT2 Polypeptide N- acetylgalactosaminyltransferase 2 Q8N4A0 GALNT4 Polypeptide N- acetylgalactosaminyltransferase 4 Q14697 GANAB Neutral alpha-glucosidase AB Q14C86 GAPVD1 GTPase-activating protein and VPS9 domain-containi P41250 GARS Glycine--tRNA ligase P22102 GART Trifunctional purine biosynthetic protein adenosin P04062 GBA Glucosylceramidase O75323 GBAS Protein NipSnap homolog 2 Q92538 GBF1 Golgi-specific brefeldin A- resistance guanine nucl O75600 GCAT 2-amino-3-ketobutyrate coenzyme A ligase, mitochon Q92616 GCN1L1 Translational activator GCN1 P31150 GDI1 Rab GDP dissociation inhibitor alpha P50395 GDI2 Rab GDP dissociation inhibitor beta Q8N9F7 GDPD1 Glycerophosphodiester phosphodiesterase domain-con Q7L5D6 GET4 Golgi to ER traffic protein 4 homolog Q96RP9 GFM1 Elongation factor G, mitochondrial Q06210 GFPT1 Glucosamine--fructose-6- phosphate aminotransferase P38435 GGCX Vitamin K-dependent gamma- carboxylase Q92820 GGH Gamma-glutamyl hydrolase Q9UJ14 GGT7 Gamma-glutamyltransferase 7 Q9H3K2 GHITM Growth hormone-inducible transmembrane protein Q6Y7W6 GIGYF2 PERQ amino acid-rich with GYF domain-containing pr P32189 GK Glycerol kinase P06280 GLA Alpha-galactosidase A P16278 GLB1 Beta-galactosidase Q92896 GLG1 Golgi apparatus protein 1 Q04760 GLO1 Lactoylglutathione lyase Q9HC38 GLOD4 Glyoxalase domain-containing protein 4 O76003 GLRX3 Glutaredoxin-3 O94925 GLS Glutaminase kidney isoform, mitochondrial Q68CQ7 GLT8D1 Glycosyltransferase 8 domain- containing protein 1 P00367 GLUD1 Glutamate dehydrogenase 1, mitochondrial P49448 GLUD2 Glutamate dehydrogenase 2, mitochondrial P17900 GM2A Ganglioside GM2 activator P49915 GMPS GMP synthase [glutamine- hydrolyzing] P04899 GNAI2 Guanine nucleotide-binding protein G(i) subunit al P08754 GNAI3 Guanine nucleotide-binding protein G(k) subunit al P62873 GNB1 Guanine nucleotide-binding protein G(I)/G(S)/G(T) P62879 GNB2 Guanine nucleotide-binding protein G(I)/G(S)/G(T) P63244 GNB2L1 Guanine nucleotide-binding protein subunit beta-2- Q13823 GNL2 Nucleolar GTP-binding protein 2 Q9BVP2 GNL3 Guanine nucleotide-binding protein- like 3 O15228 GNPAT Dihydroxyacetone phosphate acyltransferase P15586 GNS N-acetylglucosamine-6-sulfatase Q08378 GOLGA3 Golgin subfamily A member 3 Q8TBA6 GOLGA5 Golgin subfamily A member 5 O00461 GOLIM4 Golgi integral membrane protein 4 Q8NBJ4 GOLM1 Golgi membrane protein 1 Q9H4A6 GOLPH3 Golgi phosphoprotein 3 Q9H4A5 GOLPH3L Golgi phosphoprotein 3-like Q9HD26 GOPC Golgi-associated PDZ and coiled- coil motif-contain O95249 GOSR1 Golgi SNAP receptor complex member 1 P00505 GOT2 Aspartate aminotransferase, mitochondrial O43292 GPAA1 Glycosylphosphatidylinositol anchor attachment 1 p Q9HCL2 GPAM Glycerol-3-phosphate acyltransferase 1, mitochondr P43304 GPD2 Glycerol-3-phosphate dehydrogenase, mitochondrial Q5VW38 GPR107 Protein GPR107 P0CG08 GPR89B Golgi pH regulator B P36969 GPX4 Phospholipid hydroperoxide glutathione peroxidase, Q8TED1 GPX8 Probable glutathione peroxidase 8 P62993 GRB2 Growth factor receptor-bound protein 2 Q9UBQ7 GRHPR Glyoxylate reductase/hydroxypyruvate reductase Q9HAV7 GRPEL1 GrpE protein homolog 1, mitochondrial Q12849 GRSF1 G-rich sequence factor 1 Q9BQ67 GRWD1 Glutamate-rich WD repeat- containing protein 1 P15170 GSPT1 Eukaryotic peptide chain release factor GTP-bindin Q8IYD1 GSPT2 Eukaryotic peptide chain release factor GTP-bindin P00390 GSR Glutathione reductase, mitochondrial P48637 GSS Glutathione synthetase Q9Y2Q3 GSTK1 Glutathione S-transferase kappa 1 P21266 GSTM3 Glutathione S-transferase Mu 3 P78417 GSTO1 Glutathione S-transferase omega-1 P09211 GSTP1 Glutathione S-transferase P P78347 GTF21 General transcription factor II-I Q9Y5Q9 GTF3C3 General transcription factor 3C polypeptide 3 O00178 GTPBP1 GTP-binding protein 1 Q9BZE4 GTPBP4 Nucleolar GTP-binding protein 1 P08236 GUSB Beta-glucuronidase P13807 GYS1 Glycogen P16104 H2AFX Histone H2A.x O75367 H2AFY Core histone macro-H2A.1 P0C0S5 H2AFZ Histone H2A.Z Q16836 HADH Hydroxyacyl-coenzyme A dehydrogenase, mitochondria P40939 HADHA Trifunctional enzyme subunit alpha, mitochondrial P55084 HADHB Trifunctional enzyme subunit beta, mitochondrial P12081 HARS Histidine--tRNA ligase, cytoplasmic O14929 HAT1 Histone acetyltransferase type B catalytic subunit Q96CS2 HAUS1 HAUS augmin-like complex subunit 1 Q9NVX0 HAUS2 HAUS augmin-like complex subunit 2 Q68CZ6 HAUS3 HAUS augmin-like complex subunit 3 Q9H6D7 HAUS4 HAUS augmin-like complex subunit 4 O94927 HAUS5 HAUS augmin-like complex subunit 5 O00165 HAX1 HCLS1-associated protein X-1 P69905 HBA2 Hemoglobin subunit alpha P68871 HBB Hemoglobin subunit beta P02100 HBE1 Hemoglobin subunit epsilon P69891 HBG1 Hemoglobin subunit gamma-1 P69892 HBG2 Hemoglobin subunit gamma-2 Q9Y450 HBS1L HBS1-like protein P02008 HBZ Hemoglobin subunit zeta P53701 HCCS Cytochrome c-type heme lyase Q13547 HDAC1 Histone deacetylase 1 Q92769 HDAC2 Histone deacetylase 2 P51858 HDGF Hepatoma-derived growth factor Q9BSH5 HDHD3 Haloacid dehalogenase-like hydrolase domain-contai Q00341 HDLBP Vigilin Q9H583 HEATR1 HEAT repeat-containing protein 1 Q86Y56 HEATR2 HEAT repeat-containing protein 2 Q7Z4Q2 HEATR3 HEAT repeat-containing protein 3 Q9NRZ9 HELLS Lymphoid-specific helicase Q9BXL5 HEMGN Hemogen P06865 HEXA Beta-hexosaminidase subunit alpha P07686 HEXB Beta-hexosaminidase subunit beta P31937 HIBADH 3-hydroxyisobutyrate dehydrogenase, mitochondrial Q6NVY1 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Q9Y241 HIGD1A HIG1 domain family member 1A P49773 HINT1 Histidine triad nucleotide-binding protein 1 Q9NQE9 HINT3 Histidine triad nucleotide-binding protein 3 P16403 HIST1H1C Histone H1.2 P16402 HIST1H1D Histone H1.3 Q16777 HIST2H2AC Histone H2A type 2-C P19367 HK1 Hexokinase-1 P52789 HK2 Hexokinase-2 P30443 HLA-A HLA class I histocompatibility antigen, A-1 alpha P01892 HLA-A HLA class I histocompatibility antigen, A-2 alpha P04439 HLA-A HLA class I histocompatibility antigen, A-3 alpha P01891 HLA-A HLA class I histocompatibility antigen, A-68 alpha P30462 HLA-B HLA class I histocompatibility antigen, B-14 alpha P18463 HLA-B HLA class I histocompatibility antigen, B-37 alpha Q29940 HLA-B HLA class I histocompatibility antigen, B-59 alpha Q31612 HLA-B HLA class I histocompatibility antigen, B-73 alpha P30460 HLA-B HLA class I histocompatibility antigen, B-8 alpha P30499 HLA-C HLA class I histocompatibility antigen, Cw-1 alpha F8VZB9 HLA-C HLA class I histocompatibility antigen, Cw-14 alph Q07000 HLA-C HLA class I histocompatibility antigen, Cw-15 alph Q29963 HLA-C HLA class I histocompatibility antigen, Cw-6 alpha P10321 HLA-C HLA class I histocompatibility antigen, Cw-7 alpha Q8TCT9 HM13 Minor histocompatibility antigen H13 P09429 HMGB1 High mobility group protein B1 P26583 HMGB2 High mobility group protein B2 O15347 HMGB3 High mobility group protein B3 Q01581 HMGCS1 Hydroxymethylglutaryl-CoA synthase, cytoplasmic P09601 HMOX1 Heme oxygenase 1 P30519 HMOX2 Heme oxygenase 2 Q13151 HNRNPA0 Heterogeneous nuclear ribonucleoprotein A0 P09651 HNRNPA1 Heterogeneous nuclear ribonucleoprotein A1 Q32P51 HNRNPA1L2 Heterogeneous nuclear ribonucleoprotein A1-like 2 P22626 HNRNPA2B1 Heterogeneous nuclear ribonucleoproteins A2/B1 P51991 HNRNPA3 Heterogeneous nuclear ribonucleoprotein A3 Q99729 HNRNPAB Heterogeneous nuclear ribonucleoprotein A/B P07910 HNRNPC Heterogeneous nuclear ribonucleoproteins C1/C2 O60812 HNRNPCL1 Heterogeneous nuclear ribonucleoprotein C-like 1 Q14103 HNRNPD Heterogeneous nuclear ribonucleoprotein D0 P52597 HNRNPF Heterogeneous nuclear ribonucleoprotein F P31943 HNRNPH1 Heterogeneous nuclear ribonucleoprotein H P55795 HNRNPH2 Heterogeneous nuclear ribonucleoprotein H2 P31942 HNRNPH3 Heterogeneous nuclear ribonucleoprotein H3 P61978 HNRNPK Heterogeneous nuclear ribonucleoprotein K P14866 HNRNPL Heterogeneous nuclear ribonucleoprotein L P52272 HNRNPM Heterogeneous nuclear ribonucleoprotein M O43390 HNRNPR Heterogeneous nuclear ribonucleoprotein R Q00839 HNRNPU Heterogeneous nuclear ribonucleoprotein U Q9BUJ2 HNRNPUL1 Heterogeneous nuclear ribonucleoprotein U-like pro Q1KMD3 HNRNPUL2 Heterogeneous nuclear ribonucleoprotein U-like pro O14979 HNRPDL Heterogeneous nuclear ribonucleoprotein D-like Q8WVV9 HNRPLL Heterogeneous nuclear ribonucleoprotein L-like Q5SSJ5 HP1BP3 Heterochromatin protein 1- binding protein 3 P37235 HPCAL1 Hippocalcin-like protein 1 P00492 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Q86YZ3 HRNR Hornerin Q7LGA3 HS2ST1 Heparan sulfate 2-O- sulfotransferase 1 Q99714 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Q8NBQ5 HSD17B11 Estradiol 17-beta- dehydrogenase 11 Q53GQ0 HSD17B12 Estradiol 17-beta- dehydrogenase 12 P51659 HSD17B4 Peroxisomal multifunctional enzyme type 2 Q3SXM5 HSDL1 Inactive hydroxysteroid dehydrogenase-like protein Q6YN16 HSDL2 Hydroxysteroid dehydrogenase- like protein 2 P07900 HSP90AA1 Heat shock protein HSP 90- alpha P08238 HSP90AB1 Heat shock protein HSP 90- beta P14625 HSP90B1 Endoplasmin Q0VDF9 HSPA14 Heat shock 70 kDa protein 14 P08107 HSPA1A Heat shock 70 kDa protein 1A/1B P34931 HSPA1L Heat shock 70 kDa protein 1-like P11021 HSPA5 78 kDa glucose-regulated protein P17066 HSPA6 Heat shock 70 kDa protein 6 P11142 HSPA8 Heat shock cognate 71 kDa protein P38646 HSPA9 Stress-70 protein, mitochondrial P04792 HSPB1 Heat shock protein beta-1 Q9NZL4 HSPBP1 Hsp70-binding protein 1 P10809 HSPD1 60 kDa heat shock protein, mitochondrial P61604 HSPE1 10 kDa heat shock protein, mitochondrial Q92598 HSPH1 Heat shock protein 105 kDa O43719 HTATSF1 HIV Tat-specific factor 1 Q7Z6Z7 HUWE1 E3 ubiquitin-protein ligase HUWE1 Q9Y4L1 HYOU1 Hypoxia up-regulated protein 1 P41252 IARS Isoleucine--tRNA ligase, cytoplasmic Q9NSE4 IARS2 Isoleucine--tRNA ligase, mitochondrial O60725 ICMT Protein-S-isoprenylcysteine O- methyltransferase P14735 IDE Insulin-degrading enzyme O75874 IDH1 Isocitrate dehydrogenase [NADP] cytoplasmic P48735 IDH2 Isocitrate dehydrogenase P50213 IDH3A Isocitrate dehydrogenase O43837 IDH3B Isocitrate dehydrogenase [NAD] subunit beta, mitoc P13284 IF130 Gamma-interferon-inducible lysosomal thiol reducta Q9NZI8 IGF2BP1 Insulin-like growth factor 2 mRNA-binding protein Q9Y6M1 IGF2BP2 Insulin-like growth factor 2 mRNA-binding protein O00425 IGF2BP3 Insulin-like growth factor 2 mRNA-binding protein Q13123 IK Protein Red Q12905 ILF2 Interleukin enhancer-binding factor 2 Q12906 ILF3 Interleukin enhancer-binding factor 3 A1L0T0 ILVBL Acetolactate synthase-like protein Q16891 IMMT Mitochondrial inner membrane protein Q9NX62 IMPAD1 Inositol monophosphatase 3 P12268 IMPDH2 Inosine-5-monophosphate dehydrogenase 2 Q16352 INA Alpha-internexin Q9UI26 IPO11 Importin-11 Q8IEX9 IPO4 Importin-4 O00410 IPO5 Importin-5 O95373 IPO7 Importin-7 O15397 IPO8 Importin-8 Q96P70 IPO9 Importin-9 P46940 IQGAP1 Ras GTPase-activating-like protein IQGAP1 O14654 IRS4 Insulin receptor substrate 4 Q96CN7 ISOC1 Isochorismatase domain-containing protein 1 Q96J02 ITCH E3 ubiquitin-protein ligase Itchy homolog Q9Y287 ITM2B Integral membrane protein 2B Q8N5M9 JAGN1 Protein jagunal homolog 1 P14923 JUP Junction plakoglobin Q15046 KARS Lysine-tRNA ligase Q96CX2 KCTD12 BTB/POZ domain-containing protein KCTD12 P24390 KDELR1 ER lumen protein retaining receptor 1 P33947 KDELR2 ER lumen protein retaining receptor 2 O43731 KDELR3 ER lumen protein retaining receptor 3 Q8NB78 KDM1B Lysine-specific histone demethylase 1B Q06136 KDSR 3-ketodihydrosphingosine reductase Q07666 KHDRBS1 KH domain-containing, RNA- binding, signal transduc Q92945 KHSRP Far upstream element-binding protein 2 Q15397 KIAA0020 Pumilio domain-containing protein KIAA0020 O75153 KIAA0664 Clustered mitochondria protein homolog Q2M389 KIAA1033 WASH complex subunit 7 Q96EK5 KIAA1279 KIF1-binding protein Q8N163 KIAA1967 DBIRD complex subunit KIAA1967 Q8IYS2 KIAA2013 Uncharacterized protein KIAA2013 P52732 KIF11 Kinesin-like protein KIF11 Q14807 KIF22 Kinesin-like protein KIF22 Q99661 KIF2C Kinesin-like protein KIF2C P33176 KIF5B Kinesin-1 heavy chain Q07866 KLC1 Kinesin light chain 1 Q9H0B6 KLC2 Kinesin light chain 2 P50748 KNTC1 Kinetochore-associated protein 1 P52294 KPNA1 Importin subunit alpha-1 P52292 KPNA2 Importin subunit alpha-2 O00505 KPNA3 Importin subunit alpha-3 O00629 KPNA4 Importin subunit alpha-4 O60684 KPNA6 Importin subunit alpha-7 Q14974 KPNB1 Importin subunit beta-1 Q5T749 KPRP Keratinocyte proline-rich protein Q86UP2 KTN1 Kinectin Q9H9P8 L2HGDH L-2-hydroxyglutarate dehydrogenase, mitochondrial P11279 LAMP1 Lysosome-associated membrane glycoprotein 1 P13473 LAMP2 Lysosome-associated membrane glycoprotein 2 Q6IAA8 LAMTOR1 Ragulator complex protein LAMTOR1 P28838 LAP3 Cytosol aminopeptidase Q6PKG0 LARP1 La-related protein 1 Q71RC2 LARP4 La-related protein 4 Q92615 LARP4B La-related protein 4B Q9P2J5 LARS Leucine--tRNA ligase, cytoplasmic Q15031 LARS2 Probable leucine--tRNA ligase, mitochondrial Q9Y4W2 LAS1L Ribosomal biogenesis protein LAS1L Q14739 LBR Lamin-B receptor P00338 LDHA L-lactate dehydrogenase A chain P07195 LDHB L-lactate dehydrogenase B chain Q9Y2U8 LEMD3 Inner nuclear membrane protein Man1 Q32P28 LEPRE1 Prolyl 3-hydroxylase 1 O95202 LETM1 LETM1 and EF-hand domain- containing protein 1, mit Q08380 LGALS3BP Galectin-3-binding protein Q99538 LGMN Legumain P18858 LIG1 DNA ligase 1 P38571 LIPA Lysosomal acid lipase/cholesteryl ester hydrolase P49257 LMAN1 Protein ERGIC-53 Q12907 LMAN2 Vesicular integral-membrane protein VIP36 Q8WVP7 LMBR1 Limb region 1 protein homolog Q68DH5 LMBRD2 LMBR1 domain-containing protein 2 Q9BU23 LMF2 Lipase maturation factor 2 P02545 LMNA Prelamin-A/C P20700 LMNB1 Lamin-B1 Q03252 LMNB2 Lamin-B2 Q9UIQ6 LNPEP Leucyl-cystinyl aminopeptidase P36776 LONP1 Lon protease homolog, mitochondrial Q8NF37 LPCAT1 Lysophosphatidylcholine acyltransferase 1 Q6P1A2 LPCAT3 Lysophospholipid acyltransferase 5 Q92604 LPGAT1 Acyl- CoA:lysophosphatidylglycerol acyltransferase P42704 LRPPRC Leucine-rich PPR motif- containing protein, mitocho Q8N1G4 LRRC47 Leucine-rich repeat-containing protein 47 Q96AG4 LRRC59 Leucine-rich repeat-containing protein 59 Q9UFC0 LRWD1 Leucine-rich repeat and WD repeat-containing prote Q8ND56 LSM14A Protein LSM14 homolog A Q9BX40 LSM14B Protein LSM14 homolog B P48449 LSS Lanosterol synthase P09960 LTA4H Leukotriene A-4 hydrolase Q96GA3 LTV1 Protein LTV1 homolog O95232 LUC7L3 Luc7-like protein 3 P07948 LYN Tyrosine-protein kinase Lyn Q9UPN3 MACF1 Microtubule-actin cross-linking factor 1, isoforms P43366 MAGEB1 Melanoma-associated antigen B1 O15479 MAGEB2 Melanoma-associated antigen B2 O60732 MAGEC1 Melanoma-associated antigen C1 Q9UBF1 MAGEC2 Melanoma-associated antigen C2 Q9Y5V3 MAGED1 Melanoma-associated antigen D1 Q9UNF1 MAGED2 Melanoma-associated antigen D2 Q96A72 MAGOHB Protein mago nashi homolog 2 Q9H0U3 MAGT1 Magnesium transporter protein 1 P33908 MAN1A1 Mannosyl-oligosaccharide 1,2- alpha-mannosidase IA O00754 MAN2B1 Lysosomal alpha-mannosidase Q9Y2E5 MAN2B2 Epididymis-specific alpha- mannosidase P46821 MAP1B Microtubule-associated protein 1B Q02750 MAP2K1 Dual specificity mitogen- activated protein kinase P36507 MAP2K2 Dual specificity mitogen- activated protein kinase P27816 MAP4 Microtubule-associated protein 4 P28482 MAPK1 Mitogen-activated protein kinase 1 P27361 MAPK3 Mitogen-activated protein kinase 3 Q15691 MAPRE1 Microtubule-associated protein RP/EB family member Q15555 MAPRE2 Microtubule-associated protein RP/EB family member Q9NX47 MARCH5 E3 ubiquitin-protein ligase MARCH5 P56192 MARS Methionine--tRNA ligase, cytoplasmic Q96GX5 MASTL Serine/threonine-protein kinase greatwall P43243 MATR3 Matrin-3 Q7Z434 MAVS Mitochondrial antiviral-signaling protein Q96N66 MBOAT7 Lysophospholipid acyltransferase 7 Q8IVS2 MCAT Malonyl-CoA-acyl carrier protein transacylase, mit Q9HCC0 MCCC2 Methylcrotonoyl-CoA carboxylase beta chain, mitoch Q8NI22 MCFD2 Multiple coagulation factor deficiency protein 2 P49736 MCM2 DNA replication licensing factor MCM2 P25205 MCM3 DNA replication licensing factor MCM3 P33991 MCM4 DNA replication licensing factor MCM4 P33992 MCM5 DNA replication licensing factor MCM5 Q14566 MCM6 DNA replication licensing factor MCM6 P33993 MCM7 DNA replication licensing factor MCM7 Q9BTE3 MCMBP Mini-chromosome maintenance complex-binding protei Q9ULC4 MCTS1 Malignant T-cell-amplified sequence 1 Q14676 MDC1 Mediator of DNA damage checkpoint protein 1 P40926 MDH2 Malate dehydrogenase, mitochondrial P23368 ME2 NAD-dependent malic enzyme, mitochondrial O00470 MEIS1 Homeobox protein Meisl O14770 MEIS2 Homeobox protein Meis2 Q7L2J0 MEPCE 7SK snRNA methylphosphate capping enzyme Q14696 MESDC2 LDLR chaperone MESD Q8N6R0 METTL13 Methyltransferase-like protein 13 Q9H8H3 METTL7A Methyltransferase-like protein 7A Q9GZY8 MFF Mitochondrial fission factor O95140 MFN2 Mitofusin-2 Q6N075 MFSD5 Major facilitator superfamily domain-containing pr Q8NHS3 MFSD8 Major facilitator superfamily domain-containing pr O60502 MGEA5 Bifunctional protein NCOAT O14880 MGST3 Microsomal glutathione S- transferase 3 Q5JRA6 MIA3 Melanoma inhibitory activity protein 3 Q9BPX6 MICU1 Calcium uptake protein 1, mitochondrial Q99797 MIPEP Mitochondrial intermediate peptidase P46013 MKI67 Antigen KI-67 Q9BYG3 MKI67IP MKI67 FHA domain-interacting nucleolar phosphoprot P55196 MLLT4 Afadin Q96EY8 MMAB Cob(I)yrinic acid a,c-diamide adenosyltransferase, Q8N4V1 MMGT1 Membrane magnesium transporter 1 Q96T76 MMS19 MMS19 nucleotide excision repair protein homolog Q13724 MOGS Mannosyl-oligosaccharide glucosidase Q9UBU8 MORF4L1 Mortality factor 4-like protein 1 Q15014 MORF4L2 Mortality factor 4-like protein 2 Q9HCE1 MOV10 Putative helicase MOV-10 O00566 MPHOSPH10 U3 small nucleolar ribonucleoprotein protein MPP10 Q00013 MPP1 55 kDa erythrocyte membrane protein Q14168 MPP2 MAGUK p55 subfamily member 2 Q9NZW5 MPP6 MAGUK p55 subfamily member 6 P25325 MPST 3-mercaptopyruvate sulfurtransferase P39210 MPV17 Protein Mpv17 Q567V2 MPV17L2 Mpv17-like protein 2 Q7Z7H8 MRPL10 39S ribosomal protein L10, mitochondrial Q13084 MRPL28 39S ribosomal protein L28, mitochondrial Q9BZE1 MRPL37 39S ribosomal protein L37, mitochondrial Q9NYK5 MRPL39 39S ribosomal protein L39, mitochondrial Q9NQ50 MRPL40 39S ribosomal protein L40, mitochondrial Q9H9J2 MRPL44 39S ribosomal protein L44, mitochondrial Q9BRJ2 MRPL45 39S ribosomal protein L45, mitochondrial Q9H2W6 MRPL46 39S ribosomal protein L46, mitochondrial Q7Z7F7 MRPL55 39S ribosomal protein L55, mitochondrial Q9Y676 MRPS18B 28S ribosomal protein S18b, mitochondrial P82650 MRPS22 28S ribosomal protein S22, mitochondrial Q92552 MRPS27 28S ribosomal protein S27, mitochondrial Q92665 MRPS31 28S ribosomal protein S31, mitochondrial P82673 MRPS35 28S ribosomal protein S35, mitochondrial P82933 MRPS9 28S ribosomal protein S9, mitochondrial P43246 MSH2 DNA mismatch repair protein Msh2 P52701 MSH6 DNA mismatch repair protein Msh6 O43347 MSI1 RNA-binding protein Musashi homolog 1 Q96DH6 MSI2 RNA-binding protein Musashi homolog 2 P26038 MSN Moesin Q9P289 MST4 Serine/threonine-protein kinase MST4 Q9BUK6 MSTO1 Protein misato homolog 1 P00395 MT-CO1 Cytochrome c oxidase subunit 1 P00403 MT-CO2 Cytochrome c oxidase subunit 2 P03886 MT-ND1 NADH-ubiquinone oxidoreductase chain 1 P03891 MT-ND2 NADH-ubiquinone oxidoreductase chain 2 P03905 MT-ND4 NADH-ubiquinone oxidoreductase chain 4 P03915 MT-ND5 NADH-ubiquinone oxidoreductase chain 5 O94776 MTA2 Metastasis-associated protein MTA2 Q13126 MTAP S-methyl-5-thioadenosine phosphorylase Q9NZJ7 MTCH1 Mitochondrial carrier homolog 1 Q9Y6C9 MTCH2 Mitochondrial carrier homolog 2 Q86UE4 MTDH Protein LYRIC Q9UDX5 MTFP1 Mitochondrial fission process protein 1 P11586 MTHFD1 C-1-tetrahydrofolate synthase, cytoplasmic Q6UB35 MTHFD1L Monofunctional C1- tetrahydrofolate synthase, mitoc P13995 MTHFD2 Bifunctional methylenetetrahydrofolate dehydrogena P42898 MTHFR Methylenetetrahydrofolate reductase Q13505 MTX1 Metaxin-1 O75431 MTX2 Metaxin-2 Q969V5 MUL1 Mitochondrial ubiquitin ligase activator of NFKB 1 Q9BQG0 MYBBP1A Myb-binding protein 1A P35580 MYH10 Myosin-10 P35749 MYH11 Myosin-11 P35579 MYH9 Myosin-9 O14950 MYL12B Myosin regulatory light chain 12B P60660 MYL6 Myosin light polypeptide 6 Q96H55 MYO19 Unconventional myosin-XIX P41227 NAA10 N-alpha-acetyltransferase 10 Q9BXJ9 NAA15 N-alpha-acetyltransferase 15, NatA auxiliary subun Q6N069 NAA16 N-alpha-acetyltransferase 16, NatA auxiliary subun Q14CX7 NAA25 N-alpha-acetyltransferase 25, NatB auxiliary subun Q86UY6 NAA40 N-alpha-acetyltransferase 40 Q13765 NACA Nascent polypeptide-associated complex subunit alp Q4G0N4 NADKD1 NAD kinase domain- containing protein 1 Q13564 NAE1 NEDD8-activating enzyme E1 regulatory subunit P54802 NAGLU Alpha-N-acetylglucosaminidase P43490 NAMPT Nicotinamide phosphoribosyltransferase P55209 NAP1L1 Nucleosome assembly protein 1-like 1 Q99733 NAP1L4 Nucleosome assembly protein 1-like 4 F5HFY4 NAP1L4b Nucleosome assembly protein 1-like 4 P54920 NAPA Alpha-soluble NSF attachment protein P49321 NASP Nuclear autoantigenic sperm protein Q9H0A0 NAT10 N-acetyltransferase 10 Q15021 NCAPD2 Condensin complex subunit 1 Q9BPX3 NCAPG Condensin complex subunit 3 Q15003 NCAPH Condensin complex subunit 2 Q09161 NCBP1 Nuclear cap-binding protein subunit 1 Q9UBB6 NCDN Neurochondrin Q6PIU2 NCEH1 Neutral cholesterol ester hydrolase 1 Q969V3 NCLN Nicalin Q9HCD5 NCOA5 Nuclear receptor coactivator 5 Q92542 NCSTN Nicastrin O95299 NDUFA10 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex Q86Y39 NDUFA11 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex Q9P0J0 NDUFA13 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex O95167 NDUFA3 NADH dehydrogenase P51970 NDUFA8 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex Q16795 NDUFA9 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex O14561 NDUFAB1 Acyl carrier protein, mitochondrial O96000 NDUFB10 NADH dehydrogenase [ubiquinone] 1 beta subcomplex O43676 NDUFB3 NADH dehydrogenase O95168 NDUFB4 NADH dehydrogenase [ubiquinone] 1 beta subcomplex O95169 NDUFB8 NADH dehydrogenase [ubiquinone] 1 beta subcomplex Q9Y6M9 NDUFB9 NADH dehydrogenase [ubiquinone] 1 beta subcomplex P28331 NDUFS1 NADH-ubiquinone oxidoreductase 75 kDa subunit, mit O75306 NDUFS2 NADH dehydrogenase [ubiquinone] iron-sulfur protei O75489 NDUFS3 NADH dehydrogenase [ubiquinone] iron-sulfur protei O75251 NDUFS7 NADH dehydrogenase O00217 NDUFS8 NADH dehydrogenase [ubiquinone] iron-sulfur protei P49821 NDUFV1 NADH dehydrogenase P19404 NDUFV2 NADH dehydrogenase [ubiquinone] flavoprotein 2, mi P07197 NEFM Neurofilament medium polypeptide Q9UMX5 NENF Neudesin Q8NBF2 NHLRC2 NHL repeat-containing protein 2 P55769 NHP2L1 NHP2-like protein 1 Q9Y221 NIP7 60S ribosome subunit biogenesis protein NIP7 homol Q9BPW8 NIPSNAP1 Protein NipSnap homolog 1 O15226 NKRF NF-kappa-B-repressing factor Q9BYT8 NLN Neurolysin, mitochondrial P30419 NMT1 Glycylpeptide N- tetradecanoyltransferase 1 P40261 NNMT Nicotinamide N- methyltransferase Q13423 NNT NAD(P) transhydrogenase, mitochondrial Q9Y3T9 NOC2L Nucleolar complex protein 2 homolog Q8WTT2 NOC3L Nucleolar complex protein 3 homolog Q9BVI4 NOC4L Nucleolar complex protein 4 homolog Q5SY16 NOL9 Polynucleotide 5-hydroxyl-kinase NOL9 Q15155 NOMO1 Nodal modulator 1 Q5JPE7 NOMO2 Nodal modulator 2 P69849 NOMO3 Nodal modulator 3 Q15233 NONO Non-POU domain-containing octamer-binding protein O00567 NOP56 Nucleolar protein 56 Q9Y2X3 NOP58 Nucleolar protein 58 Q8IVI9 NOSTRIN Nostrin O15118 NPC1 Niemann-Pick C1 protein P61916 NPC2 Epididymal secretory protein E1 P55786 NPEPPS Puromycin-sensitive aminopeptidase P06748 NPM1 Nucleophosmin O75607 NPM3 Nucleoplasmin-3 P15559 NQO1 NAD(P)H dehydrogenase [quinone] 1 P04150 NR3C1 Glucocorticoid receptor P01111 NRAS GTPase NRas O43847 NRD1 Nardilysin Q8IXM6 NRM Nurim Q15738 NSDHL Sterol-4-alpha-carboxylate 3- dehydrogenase, decath P46459 NSF Vesicle-fusing ATPase Q08J23 NSUN2 tRNA (cytosine(34)-C(5))- methyltransferase P49902 NT5C2 Cytosolic purine 5-nucleotidase Q9HOP0 NT5C3 Cytosolic 5-nucleotidase 3 Q969T7 NT5C3L Cytosolic 5-nucleotidase III-like protein Q5TFE4 NT5DC1 5-nucleotidase domain- containing protein 1 Q9H857 NT5DC2 5-nucleotidase domain- containing protein 2 Q86UY8 NT5DC3 5-nucleotidase domain- containing protein 3 Q9BV86 NTMT1 N-terminal Xaa-Pro-Lys N- methyltransferase 1 Q9BSD7 NTPCR Cancer-related nucleoside- triphosphatase Q02818 NUCB1 Nucleobindin-1 P80303 NUCB2 Nucleobindin-2 Q9Y266 NUDC Nuclear migration protein nudC Q96RS6 NUDCD1 NudC domain-containing protein 1 Q9BQG2 NUDT12 Peroxisomal NADH pyrophosphatase NUDT12 Q9NV35 NUDT15 Probable 8-oxo-dGTP diphosphatase NUDT15 A8MXV4 NUDT19 Nucleoside diphosphate-linked moiety X motif 19, m O43809 NUDT21 Cleavage and polyadenylation specificity factor su Q9BW91 NUDT9 ADP-ribose pyrophosphatase, mitochondrial Q14980 NUMA1 Nuclear mitotic apparatus protein 1 P57740 NUP107 Nuclear pore complex protein Nup107 Q8WUM0 NUP133 Nuclear pore complex protein Nup133 P49790 NUP153 Nuclear pore complex protein Nup153 O75694 NUP155 Nuclear pore complex protein Nup155 Q12769 NUP160 Nuclear pore complex protein Nup160 Q92621 NUP205 Nuclear pore complex protein Nup205 Q8TEM1 NUP210 Nuclear pore membrane glycoprotein 210 P35658 NUP214 Nuclear pore complex protein Nup214 Q8NFH5 NUP35 Nucleoporin NUP53 Q8NFH4 NUP37 Nucleoporin Nup37 Q8NFH3 NUP43 Nucleoporin Nup43 Q9UKX7 NUP50 Nuclear pore complex protein Nup50 Q7Z3B4 NUP54 Nucleoporin p54 P37198 NUP62 Nuclear pore glycoprotein p62 Q9BW27 NUP85 Nuclear pore complex protein Nup85 Q99567 NUP88 Nuclear pore complex protein Nup88 Q8N1F7 NUP93 Nuclear pore complex protein Nup93 P52948 NUP98 Nuclear pore complex protein Nup98-Nup96 P61970 NUTF2 Nuclear transport factor 2 Q9UBU9 NXF1 Nuclear RNA export factor 1 Q6DKJ4 NXN Nucleoredoxin P04181 OAT Ornithine aminotransfemse, mitochondrial Q9NX40 OCIAD1 OCIA domain-containing protein 1 Q5SWX8 ODR4 Protein odr-4 homolog Q02218 OGDH 2-oxoglutarate dehydrogenase, mitochondrial O15294 OGT UDP-N-acetylglucosamine--peptide N-acetylglucosami Q9NTK5 OLA1 Obg-like ATPase 1 Q96E52 OMA1 Metalloendopeptidase OMA1, mitochondrial O60313 OPA1 Dynamin-like 120 kDa protein, mitochondrial Q9H6K4 OPA3 Optic atrophy 3 protein Q9UBD5 ORC3 Origin recognition complex subunit 3 P22059 OSBP Oxysterol-binding protein 1 Q9BZF1 OSBPL8 Oxysterol-binding protein- related protein 8 Q96SU4 OSBPL9 Oxysterol-binding protein- related protein 9 Q96FW1 OTUB1 Ubiquitin thioestemse OTUB1 Q15070 OXA1L Mitochondrial inner membrane protein OXA1L P13674 P4HA1 Prolyl 4-hydroxylase subunit alpha-1 P07237 P4HB Protein disulfide-isomerase Q9UQ80 PA2G4 Proliferation-associated protein 2G4 P11940 PABPC1 Polyadenylate-binding protein 1 Q9H361 PABPC3 Polyadenylate-binding protein 3 Q13310 PABPC4 Polyadenylate-binding protein 4 Q86U42 PABPN1 Polyadenylate-binding protein 2 P68402 PAFAH1B2 Platelet-activating factor acetylhydrolase IB subu P22234 PAICS Multifunctional protein ADE2 Q9H074 PAIP1 Polyadenylate-binding protein- interacting protein Q13177 PAK2 Serine/threonine-protein kinase PAK 2 Q9NVE7 PANK4 Pantothenate kinase 4 P51003 PAPOLA Poly(A) polymerase alpha O43252 PAPSS1 Bifunctional 3- phosphoadenosine 5-phosphosulfate P09874 PARP1 Poly [ADP-ribose] polymerase 1 Q96KB5 PBK Lymphokine-activated killer T-cell- originated prot Q86U86 PBRM1 Protein polybromo-1 Q15365 PCBP1 Poly(rC)-binding protein 1 Q15366 PCBP2 Poly(rC)-binding protein 2 P57721 PCBP3 Poly(rC)-binding protein 3 Q16822 PCK2 Phosphoenolpyruvate carboxykinase [GTP], mitochond Q15154 PCM1 Pericentriolar material 1 protein P22061 PCMT1 Protein-L-isoaspartate(D- aspartate) O-methyltransf P12004 PCNA Proliferating cell nuclear antigen Q9UHG3 PCYOX1 Prenylcysteine oxidase 1 Q8NBM8 PCYOX1L Prenylcysteine oxidase-like P49585 PCYT1A Choline-phosphate cytidylyltransferase A Q14690 PDCD11 Protein RRP5 homolog Q53EL6 PDCD4 Programmed cell death protein 4 O14737 PDCD5 Programmed cell death protein 5 O75340 PDCD6 Programmed cell death protein 6 Q8WUM4 PDCD6IP Programmed cell death 6- interacting protein Q9H2J4 PDCL3 Phosducin-like protein 3 Q6L8Q7 PDE12 2,5-phosphodiesterase 12 P08559 PDHA1 Pyruvate dehydrogenase E1 component subunit alpha, P11177 PDHB Pyruvate dehydrogenase E1 component subunit beta, P30101 PDIA3 Protein disulfide-isomerase A3 P13667 PDIA4 Protein disulfide-isomerase A4 Q15084 PDIA6 Protein disulfide-isomerase A6 O00151 PDLIM1 PDZ and LIM domain protein 1 Q9P0J1 PDP1 Q9NUG6 PDRG1 p53 and DNA damage-regulated protein 1 Q29RF7 PDS5A Sister chromatid cohesion protein PDS5 homolog A O00764 PDXK Pyridoxal kinase P30086 PEBP1 Phosphatidylethanolamine- binding protein 1 Q9BY49 PECR Peroxisomal trans-2-enoyl-CoA reductase Q9UBV8 PEF1 Peflin Q9BRX2 PELO Protein pelota homolog Q8IZL8 PELP1 Proline-, glutamic acid- and leucine-rich protein O00541 PES1 Pescadillo homolog O96011 PEX11B Peroxisomal membrane protein 11B Q9Y5Y5 PEX16 Peroxisomal membrane protein PEX16 P40855 PEX19 Peroxisomal biogenesis factor 19 PFAS O15067 Phosphoribosylformylglycinamidine synthase Q9UHV9 PFDN2 Prefoldin subunit 2 Q99471 PFDN5 Prefoldin subunit 5 P17858 PFKL 6-phosphofructokinase, liver type P08237 PFKM 6-phosphofructokinase, muscle type Q01813 PFKP 6-phosphofructokinase type C P07737 PFN1 Profilin-1 Q96HS1 PGAM5 Serine/threonine-protein phosphatase PGAM5, mitoch P00558 PGK1 Phosphoglycerate kinase 1 P07205 PGK2 Phosphoglycerate kinase 2 P36871 PGM1 Phosphoglucomutase-1 O95394 PGM3 Phosphoacetylglucosamine mutase O00264 PGRMC1 Membrane-associated progesterone receptor componen O15173 PGRMC2 Membrane-associated progesterone receptor componen P35232 PHB Prohibitin Q99623 PHB2 Prohibitin-2 O43175 PHGDH D-3-phosphoglycerate dehydrogenase Q9BTU6 PI4K2A Phosphatidylinositol 4-kinase type 2-alpha Q9UBF8 PI4KB Phosphatidylinositol 4-kinase beta Q13492 PICALM Phosphatidylinositol-binding clathrin assembly pro Q92643 PIGK GPI-anchor transamidase Q969N2 PIGT GPI transamidase component PIG-T Q9H490 PIGU Phosphatidylinositol glycan anchor biosynthesis cl Q13526 PIN1 Peptidyl-prolyl cis-trans isomerase NIMA-interacti Q9UG56 PISD Phosphatidylserine decarboxylase proenzyme Q00169 PITPNA Phosphatidylinositol transfer protein alpha isofor P48739 PITPNB Phosphatidylinositol transfer protein beta isoform Q5JRX3 PITRM1 Presequence protease, mitochondrial P30613 PKLR Pyruvate kinase isozymes R/L P14618 PKM Pyruvate kinase isozymes M1/M2 Q99640 PKMYT1 Membrane-associated tyrosine- and threonine-specif Q16512 PKN1 Serine/threonine-protein kinase N1 Q16513 PKN2 Serine/threonine-protein kinase N2 Q9Y446 PKP3 Plakophilin-3 Q8NCC3 PLA2G15 Group XV phospholipase A2 Q8NHP8 PLBD2 Putative phospholipase B-like 2 P19174 PLCG1 1-phosphatidylinositol 4,5- bisphosphate phosphodie Q8IV08 PLD3 Phospholipase D3 Q15149 PLEC Plectin Q99541 PLIN2 Perilipin-2 O60664 PLIN3 Perilipin-3 P53350 PLK1 Serine/threonine-protein kinase PLK1 Q02809 PLOD1 Procollagen-lysine, 2- oxoglutarate 5-dioxygenase 1 P13797 PLS3 Plastin-3 Q10713 PMPCA Mitochondrial-processing peptidase subunit alpha O75439 PMPCB Mitochondrial-processing peptidase subunit beta Q9H307 PNN Pinin Q96AD5 PNPLA2 Patatin-like phospholipase domain-containing prote Q8TCS8 PNPT1 Polyribonucleotide nucleotidyltransferase 1, mitoc F8VUJ3 POC1B-GALNT4 Protein POC1B- GALNT4 Q14181 POLA2 DNA polymerase alpha subunit B P28340 POLD1 DNA polymerase delta catalytic subunit Q9Y257 POLDIP2 Polymerase delta-interacting protein 2 P24928 POLR2A DNA-directed RNA polymerase II subunit RPB1 P30876 POLR2B DNA-directed RNA polymerase II subunit RPB2 O00411 POLRMT DNA-directed RNA polymerase, mitochondrial Q15165 PON2 Serum paraoxonase/arylesterase 2 Q99575 POP1 Ribonucleases P/MRP protein subunit POP1 P16435 POR NADPH--cytochrome P450 reductase Q9H2U2 PPA2 Inorganic pyrophosphatase 2, mitochondrial Q9NQ55 PPAN Suppressor of SWI4 1 homolog C9J3F9 PPAN-P2RY11 Protein PPAN-P2RY11 Q06203 PPAT Amidophosphoribosyltransferase Q13356 PPIL2 Peptidyl-prolyl cis-trans isomerase-like 2 P49593 PPM1F Protein phosphatase 1F O15355 PPM1G Protein phosphatase 1G Q9Y570 PPME1 Protein phosphatase methylesterase 1 P62136 PPP1CA Serine/threonine-protein phosphatase PP1-alpha cat P62140 PPP1CB Serine/threonine-protein phosphatase PP1-beta cata P36873 PPP1CC Serine/threonine-protein phosphatase PP1-gamma cat P67775 PPP2CA Serine/threonine-protein phosphatase 2A catalytic P62714 PPP2CB Serine/threonine-protein phosphatase 2A catalytic P30153 PPP2R1A Serine/threonine-protein phosphatase 2A 65 kDa reg P30154 PPP2R1B Serine/threonine-protein phosphatase 2A 65 kDa reg P63151 PPP2R2A Serine/threonine-protein phosphatase 2A 55 kDa reg Q15172 PPP2R5A Serine/threonine-protein phosphatase 2A 56 kDa reg Q13362 PPP2R5C Serine/threonine-protein phosphatase 2A 56 kDa reg Q14738 PPP2R5D Serine/threonine-protein phosphatase 2A 56 kDa reg P60510 PPP4C Serine/threonine-protein phosphatase 4 catalytic s O00743 PPP6C Serine/threonine-protein phosphatase 6 catalytic s Q9UPN7 PPP6R1 Serine/threonine-protein phosphatase 6 regulatory Q5H9R7 PPP6R3 Serine/threonine-protein phosphatase 6 regulatory P50897 PPT1 Palmitoyl-protein thioesterase 1 Q9UMR5 PPT2 Lysosomal thioesterase PPT2 O43663 PRC1 Protein regulator of cytokinesis 1 P42785 PRCP Lysosomal Pro-X carboxypeptidase Q06830 PRDX1 Peroxiredoxin-1 P32119 PRDX2 Peroxiredoxin-2 P30048 PRDX3 Thioredoxin-dependent peroxide reductase, mitochon Q13162 PRDX4 Peroxiredoxin-4 P30044 PRDX5 Peroxiredoxin-5, mitochondrial P30041 PRDX6 Peroxiredoxin-6 Q9HCU5 PREB Prolactin regulatory element- binding protein P48147 PREP Prolyl endopeptidase Q4J6C6 PREPL Prolyl endopeptidase-like P49643 PRIM2 DNA primase large subunit P17612 PRKACA cAMP-dependent protein kinase catalytic subunit a1 P54619 PRKAG1 5-AMP-activated protein kinase subunit gamma-1 P10644 PRKAR1A cAMP-dependent protein kinase type I-alpha regulat P13861 PRKAR2A cAMP-dependent protein kinase type II-alpha regula P31323 PRKAR2B cAMP-dependent protein kinase type II-beta regulat P05771 PRKCB Protein kinase C beta type P14314 PRKCSH Glucosidase 2 subunit beta P78527 PRKDC DNA-dependent protein kinase catalytic subunit O75569 PRKRA Interferon-inducible double stranded RNA-dependent Q99873 PRMT1 Protein arginine N- methyltransferase 1 O60678 PRMT3 Protein arginine N- methyltransferase 3 O14744 PRMT5 Protein arginine N- methyltransferase 5 Q9UMS4 PRPF19 Pre-mRNA-processing factor 19 Q5VTL8 PRPF38B Pre-mRNA-splicing factor 38B O75400 PRPF40A Pre-mRNA-processing factor 40 homolog A O94906 PRPF6 Pre-mRNA-processing factor 6 Q6P2Q9 PRPF8 Pre-mRNA-processing-splicing factor 8 P48634 PRRC2A Protein PRRC2A Q9Y520 PRRC2C Protein PRRC2C P07602 PSAP Proactivator polypeptide P49768 PSEN1 Presenilin-1 P49810 PSEN2 Presenilin-2 O75475 PSIP1 PC4 and SFRS1-interacting protein P25786 PSMA1 Proteasome subunit alpha type-1 P25787 PSMA2 Proteasome subunit alpha type-2 P25788 PSMA3 Proteasome subunit alpha type-3 P25789 PSMA4 Proteasome subunit alpha type-4 P28066 PSMA5 Proteasome subunit alpha type-5 P60900 PSMA6 Proteasome subunit alpha type-6 O14818 PSMA7 Proteasome subunit alpha type-7 P20618 PSMB1 Proteasome subunit beta type-1 P49721 PSMB2 Proteasome subunit beta type-2 P49720 PSMB3 Proteasome subunit beta type-3 P28070 PSMB4 Proteasome subunit beta type-4 P28074 PSMB5 Proteasome subunit beta type-5 P28072 PSMB6 Proteasome subunit beta type-6 Q99436 PSMB7 Proteasome subunit beta type-7 P62191 PSMC1 26S protease regulatory subunit 4 P35998 PSMC2 26S protease regulatory subunit 7 P17980 PSMC3 26S protease regulatory subunit 6A P43686 PSMC4 26S protease regulatory subunit 6B P62195 PSMC5 26S protease regulatory subunit 8 P62333 PSMC6 26S protease regulatory subunit 10B Q99460 PSMD1 26S proteasome non-ATPase regulatory subunit 1 O75832 PSMD10 26S proteasome non-ATPase regulatory subunit 10 O00231 PSMD11 26S proteasome non-ATPase regulatory subunit 11 Q9UNM6 PSMD13 26S proteasome non-ATPase regulatory subunit 13 O00487 PSMD14 26S proteasome non-ATPase regulatory subunit 14 Q13200 PSMD2 26S proteasome non-ATPase regulatory subunit 2 O43242 PSMD3 26S proteasome non-ATPase regulatory subunit 3 Q16401 PSMD5 26S proteasome non-ATPase regulatory subunit 5 Q15008 PSMD6 26S proteasome non-ATPase regulatory subunit 6 P51665 PSMD7 26S proteasome non-ATPase regulatory subunit 7 P48556 PSMD8 26S proteasome non-ATPase regulatory subunit 8 Q06323 PSME1 Proteasome activator complex subunit 1 Q9UL46 PSME2 Proteasome activator complex subunit 2 P61289 PSME3 Proteasome activator complex subunit 3 Q92530 PSMF1 Proteasome inhibitor PI31 subunit O95456 PSMG1 Proteasome assembly chaperone 1 Q8WXF1 PSPC1 Paraspeckle component 1 P26599 PTBP1 Polypyrimidine tract-binding protein 1 O95758 PTBP3 Polypyrimidine tract-binding protein 3 Q96EY7 PTCD3 Pentatricopeptide repeat- containing protein 3, mit P48651 PTDSS1 Phosphatidylserine synthase 1 Q9BVG9 PTDSS2 Phosphatidylserine synthase 2 Q9H7Z7 PTGES2 Prostaglandin E synthase 2 Q15185 PTGES3 Prostaglandin E synthase 3 Q8N8N7 PTGR2 Prostaglandin reductase 2 Q9P035 PTPLAD1 3-hydroxyacyl-CoA dehydratase 3 P18031 PTPN1 Tyrosine-protein phosphatase non-receptor type 1 Q06124 PTPN11 Tyrosine-protein phosphatase non-receptor type 11 Q9H3S7 PTPN23 Tyrosine-protein phosphatase non-receptor type 23 Q6NZI2 PTRF Polymerase I and transcript release factor Q9Y3E5 PTRH2 Peptidyl-tRNA hydrolase 2, mitochondrial Q9UHX1 PUF60 Poly(U)-binding-splicing factor PUF60 Q14671 PUM1 Pumilio homolog 1 Q96PZ0 PUS7 Pseudouridylate synthase 7 homolog Q15269 PWP2 Periodic tryptophan protein 2 homolog Q9NR77 PXMP2 Peroxisomal membrane protein 2 P32322 PYCR1 Pyrroline-5-carboxylate reductase 1, mitochondrial Q96C36 PYCR2 Pyrroline-5-carboxylate reductase 2 P11216 PYGB Glycogen phosphorylase, brain form P06737 PYGL Glycogen phosphorylase, liver form P20742 PZP Pregnancy zone protein Q5XKP0 QIL1 Protein QIL1 Q96PU8 QKI Protein quaking P61026 RAB10 Ras-related protein Rab-10 P62491 RAB11A Ras-related protein Rab-11A Q15907 RAB11B Ras-related protein Rab-11B P61106 RAB14 Ras-related protein Rab-14 Q9NP72 RAB18 Ras-related protein Rab-18 P62820 RAB1A Ras-related protein Rab-1A Q9H0U4 RAB1B Ras-related protein Rab-1B Q9UL25 RAB21 Ras-related protein Rab-21 Q969Q5 RAB24 Ras-related protein Rab-24 P61019 RAB2A Ras-related protein Rab-2A Q8WUD1 RAB2B Ras-related protein Rab-2B Q15042 RAB3GAP1 Rab3 GTPase-activating protein catalytic subunit Q9H2M9 RAB3GAP2 Rab3 GTPase-activating protein non-catalytic subun Q8TBN0 RAB3IL1 Guanine nucleotide exchange factor for Rab-3A P20339 RAB5A Ras-related protein Rab-5A P61020 RAB5B Ras-related protein Rab-5B P51148 RAB5C Ras-related protein Rab-5C P51149 RAB7A Ras-related protein Rab-7a P51151 RAB9A Ras-related protein Rab-9A Q7Z6M1 RABEPK Rab9 effector protein with kelch motifs P54727 RAD23B UV excision repair protein RAD23 homolog B Q92878 RAD50 DNA repair protein RAD50 P78406 RAE1 mRNA export factor P11233 RALA Ras-related protein Ral-A Q9UKM9 RALY RNA-binding protein Raly P62826 RAN GTP-binding nuclear protein Ran P43487 RANBP1 Ran-specific GTPase-activating protein P49792 RANBP2 E3 SUMO-protein ligase RanBP2 P62834 RAP1A Ras-related protein Rap-1A P61224 RAP1B Ras-related protein Rap-1b P61225 RAP2B Ras-related protein Rap-2b Q9Y3L5 RAP2C Ras-related protein Rap-2c P54136 RARS Arginine--tRNA ligase, cytoplasmic Q8IY67 RAVER1 Ribonucleoprotein PTB- binding 1 Q09028 RBBP4 Histone-binding protein RBBP4 Q16576 RBBP7 Histone-binding protein RBBP7 Q9NWB1 RBFOX1 RNA binding protein fox-1 homolog 1 O43251 RBFOX2 RNA binding protein fox-1 homolog 2 P98175 RBM10 RNA-binding protein 10 Q8IXT5 RBM12B RNA-binding protein 12B Q96PK6 RBM14 RNA-binding protein 14 B0LM41 RBM14/RBM4 Protein RBM14-RBM4 Q96T37 RBM15 Putative RNA-binding protein 15 P49756 RBM25 RNA-binding protein 25 Q9NW13 RBM28 RNA-binding protein 28 P98179 RBM3 Putative RNA-binding protein 3 Q14498 RBM39 RNA-binding protein 39 Q9BWF3 RBM4 RNA-binding protein 4 Q9BQ04 RBM4B RNA-binding protein 4B P29558 RBMS1 RNA-binding motif, single- stranded-interacting pro P38159 RBMX RNA-binding motif protein, X chromosome Q96E39 RBMXL1 RNA binding motif protein, X- linked-like-1 Q15293 RCN1 Reticulocalbin-1 Q14257 RCN2 Reticulocalbin-2 Q8TC12 RDH11 Retinol dehydrogenase 11 Q8NBN7 RDH13 Retinol dehydrogenase 13 Q9HBH5 RDH14 Retinol dehydrogenase 14 P35241 RDX Radixin P46063 RECQL ATP-dependent DNA helicase Q1 Q00765 REEP5 Receptor expression-enhancing protein 5 O15258 RER1 Protein RER1 Q6NUM9 RETSAT All-trans-retinol 13,14- reductase P35250 RFC2 Replication factor C subunit 2 P40938 RFC3 Replication factor C subunit 3 P35249 RFC4 Replication factor C subunit 4 P40937 RFC5 Replication factor C subunit 5 Q96AA3 RFT1 Protein RFT1 homolog Q15382 RHEB GTP-binding protein Rheb P61586 RHOA Transforming protein RhoA P08134 RHOC Rho-related GTP-binding protein RhoC Q8IXI1 RHOT2 Mitochondrial Rho GTPase 2 Q5UIP0 RIF1 Telomere-associated protein RIF1 Q6NUQ1 RINT1 RAD50-interacting protein 1 Q9BVS4 RIOK2 Serine/threonine-protein kinase RIO2 O43353 RIPK2 Receptor-interacting serine/threonine-protein kina Q9NWS8 RMND1 Required for meiotic nuclear division protein 1 ho O00584 RNASET2 Ribonuclease T2 Q9H920 RNF121 RING finger protein 121 Q9UBS8 RNF14 E3 ubiquitin-protein ligase RNF14 Q5VTR2 RNF20 E3 ubiquitin-protein ligase BRE1A Q9H4A4 RNPEP Aminopeptidase B P27694 RPA1 Replication protein A 70 kDa DNA-binding subunit P15927 RPA2 Replication protein A 32 kDa subunit P62906 RPL10A 60S ribosomal protein L10a Q02543 RPL18A 60S ribosomal protein L18a P62750 RPL23 A 60S ribosomal protein L23a P61254 RPL26 60S ribosomal protein L26 P62888 RPL30 60S ribosomal protein L30 P36578 RPL4 60S ribosomal protein L4 P18124 RPL7 60S ribosomal protein L7 P62424 RPL7A 60S ribosomal protein L7a Q6DKI1 RPL7L1 60S ribosomal protein L7-like 1 P62917 RPL8 60S ribosomal protein L8 P05387 RPLP2 60S acidic ribosomal protein P2 P04843 RPN1 Dolichyl- diphosphooligosaccharide-protein glycosy P04844 RPN2 Dolichyl- diphosphooligosaccharide-protein glycosy Q9NQG5 RPRD1B Regulation of nuclear pre- mRNA domain-containing p P46783 RPS10 40S ribosomal protein S10 P62277 RPS13 40S ribosomal protein S13 P62244 RPS15A 40S ribosomal protein S15a P62249 RPS16 40S ribosomal protein S16 P62269 RPS18 40S ribosomal protein S18 P15880 RPS2 40S ribosomal protein S2 P62266 RPS23 40S ribosomal protein S23 P62847 RPS24 40S ribosomal protein S24 P62979 RPS27A Ubiquitin-40S ribosomal protein S27a P23396 RPS3 40S ribosomal protein S3 P61247 RPS3A 40S ribosomal protein S3a Q15418 RPS6KA1 Ribosomal protein S6 kinase alpha-1 Q15349 RPS6KA2 Ribosomal protein S6 kinase alpha-2 P51812 RPS6KA3 Ribosomal protein S6 kinase alpha-3 P62241 RPS8 40S ribosomal protein S8 A6NE09 RPSAP58 Protein RPSAP58 Q8IZ73 RPUSD2 RNA pseudouridylate synthase domain-containing pro Q9HB90 RRAGC Ras-related GTP-binding protein C Q9P2E9 RRBP1 Ribosome-binding protein 1 P23921 RRM1 Ribonucleoside-diphosphate reductase large subunit P31350 RRM2 Ribonucleoside-diphosphate reductase subunit M2 P56182 RRP1 Ribosomal RNA processing protein 1 homolog A Q5JTH9 RRP12 RRP12-like protein Q14684 RRP1B Ribosomal RNA processing protein 1 homolog B O76021 RSL1D1 Ribosomal L1 domain- containing protein 1 Q92541 RTF1 RNA polymerase-associated protein RTF1 homolog O95197 RTN3 Reticulon-3 Q9NQC3 RTN4 Reticulon-4 Q8WWV3 RTN4IP1 Reticulon-4-interacting protein 1, mitochondrial Q9Y265 RUVBL1 RuvB-like 1 Q9Y230 RUVBL2 RuvB-like 2 Q9NTJ5 SACM1L Phosphatidylinositide phosphatase SAC1 Q15424 SAFB Scaffold attachment factor B1 Q14151 SAFB2 Scaffold attachment factor B2 Q9Y512 SAMM50 Sorting and assembly machinery component 50 homolo Q9NSI8 SAMSN1 SAM domain-containing protein SAMSN-1 Q9NR31 SAR1A GTP-binding protein SAR1a Q9Y6B6 SAR1B GTP-binding protein SAR1b P49591 SARS Serine--tRNA ligase, cytoplasmic Q9NP81 SARS2 Serine--tRNA ligase, mitochondrial O43290 SART1 U4/U6.U5 tri-snRNP-associated protein 1 Q15020 SART3 Squamous cell carcinoma antigen recognized by T-ce O14828 SCAMP3 Secretory carrier-associated membrane protein 3 Q8WTV0 SCARB1 Scavenger receptor class B member 1 Q14108 SCARB2 Lysosome membrane protein 2 Q8NBX0 SCCPDH Saccharopine dehydrogenase- like oxidoreductase O00767 SCD Acyl-CoA desaturase Q8WVM8 SCFD1 Sec1 family domain-containing protein 1 O75880 SCO1 Protein SCO1 homolog, mitochondrial O43819 SCO2 Protein SCO2 homolog, mitochondrial P22307 SCP2 Non-specific lipid-transfer protein Q9HB40 SCPEP1 Retinoid-inducible serine carboxypeptidase O00560 SDCBP Syntenin-1 Q9BRK5 SDF4 45 kDa calcium-binding protein P31040 SDHA Succinate dehydrogenase [ubiquinone] flavoprotein P21912 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur s P67812 SEC11A Signal peptidase complex catalytic subunit SEC11A P55735 SEC13 Protein SEC13 homolog O15027 SEC16A Protein transport protein Sec16A O75396 SEC22B Vesicle-trafficking protein SEC22b Q15436 SEC23A Protein transport protein Sec23A Q15437 SEC23B Protein transport protein Sec23B Q9Y6Y8 SEC23IP 5EC23-interacting protein P53992 SEC24C Protein transport protein Sec24C O94979 SEC31A Protein transport protein Sec31A P61619 SEC61A1 Protein transport protein Sec61 subunit alpha isof Q99442 SEC62 Translocation protein SEC62 Q9UGP8 SEC63 Translocation protein SEC63 homolog Q9UBV2 SEL1L Protein sel-1 homolog 1 Q15019 SEPT2 Septin-2 Q16181 SEPT7 Septin-7 Q8NC51 SERBP1 Plasminogen activator inhibitor 1 RNA-binding prot P30740 SERPINB1 Leukocyte elastase inhibitor P29508 SERPINB3 Serpin B3 P35237 SERPINB6 Serpin B6 P50454 SERPINH1 Serpin H1 P58004 SESN2 Sestrin-2 Q01105 SET Protein SET Q15637 SF1 Splicing factor 1 Q15459 SF3A1 Splicing factor 3A subunit 1 Q12874 SF3A3 Splicing factor 3A subunit 3 O75533 SF3B1 Splicing factor 3B subunit 1 Q13435 SF3B2 Splicing factor 3B subunit 2 Q9BWJ5 SF3B5 Splicing factor 3B subunit 5 P23246 SFPQ Splicing factor, proline- and glutamine-rich Q9H9B4 SFXN1 Sideroflexin-1 Q96NB2 SFXN2 Sideroflexin-2 Q6P4A7 SFXN4 Sideroflexin-4 O95470 SGPL1 Sphingosine-1-phosphate lyase 1 O43765 SGTA Small glutamine-rich tetratricopeptide repeat-cont Q99961 SH3GL1 Endophilin-A2 Q9Y371 SH3GLB1 Endophilin-B1 P34896 SHMT1 Serine hydroxymethyltransferase, cytosolic P34897 SHMT2 Serine hydroxymethyltransferase, mitochondrial Q9HAT2 SIAE Sialate O-acetylesterase Q99720 SIGMAR1 Sigma non-opioid intracellular receptor 1 Q96ST3 SIN3A Paired amphipathic helix protein Sin3a P42285 SKIV2L2 Superkiller viralicidic activity 2-like 2 P63208 SKP1 S-phase kinase-associated protein 1 P41440 SLC19A1 Folate transporter 1 P43007 SLC1A4 Neutral amino acid transporter A Q15758 SLC1A5 Neutral amino acid transporter B(0) P53007 SLC25A1 Tricarboxylate transport protein, mitochondrial Q9UBX3 SLC25A10 Mitochondrial dicarboxylate carrier Q02978 SLC25A11 Mitochondrial 2- oxoglutarate/malate carrier protei O75746 SLC25A12 Calcium-binding mitochondrial carrier protein Aral Q9UJS0 SLC25A13 Calcium-binding mitochondrial carrier protein Aral Q9Y619 SLC25A15 Mitochondrial ornithine transporter 1 P16260 SLC25A16 Graves disease carrier protein Q9HC21 SLC25A19 Mitochondrial thiamine pyrophosphate carrier O43772 SLC25A20 Mitochondrial carnitine/acylcarnitine carrier prot Q9H936 SLC25A22 Mitochondrial glutamate carrier 1 Q6NUK1 SLC25A24 Calcium-binding mitochondrial carrier protein SCaM Q70HW3 SLC25A26 S-adenosylmethionine mitochondrial carrier protein Q00325 SLC25A3 Phosphate carrier protein, mitochondrial Q5SVS4 SLC25A30 Kidney mitochondrial carrier protein 1 Q9H2D1 SLC25A32 Mitochondrial folate transporter/carrier Q9BSK2 SLC25A33 Solute carrier family 25 member 33 P12235 SLC25A4 ADP/ATP translocase 1 Q8TBP6 SLC25A40 Solute carrier family 25 member 40 P05141 SLC25A5 ADP/ATP translocase 2 P12236 SLC25A6 ADP/ATP translocase 3 O14975 SLC27A2 Very long-chain acyl-CoA synthetase P11166 SLC2A1 Solute carrier family 2, facilitated glucose trans Q8TAD4 SLC30A5 Zinc transporter 5 Q6NXT4 SLC30A6 Zinc transporter 6 Q8NEW0 SLC30A7 Zinc transporter 7 Q6PML9 SLC30A9 Zinc transporter 9 O00400 SLC33A1 Acetyl-coenzyme A transporter 1 Q8TB61 SLC35B2 Adenosine 3-phospho 5- phosphosulfate transporter Q8IXU6 SLC35F2 Solute carrier family 35 member F2 Q96QD8 SLC38A2 Sodium-coupled neutral amino acid transporter 2 P08195 SLC3A2 4F2 cell-surface antigen heavy chain P30825 SLC7A1 High affinity cationic amino acid transporter 1 Q9H2G2 SLK STE20-like serine/threonine-protein kinase Q8WU79 SMAP2 Stromal membrane-associated protein 2 P28370 SMARCA1 Probable global transcription activator SNF2L1 P51532 SMARCA4 Transcription activator BRG1 O60264 SMARCA5 SWI/SNF-related matrix- associated actin-dependent Q12824 SMARCB1 SWI/SNF-related matrix- associated actin-dependent Q92922 SMARCC1 SWI/SNF complex subunit SMARCC1 Q14683 SMC1A Structural maintenance of chromosomes protein 1A O95347 SMC2 Structural maintenance of chromosomes protein 2 Q9UQE7 SMC3 Structural maintenance of chromosomes protein 3 Q9NTJ3 SMC4 Structural maintenance of chromosomes protein 4 A6NHR9 SMCHD1 Structural maintenance of chromosomes flexible hin Q16637 SMN1 Survival motor neuron protein P17405 SMPD1 Sphingomyelin phosphodiesterase Q9NXE4 SMPD4 Sphingomyelin phosphodiesterase 4 Q2TAY7 SMU1 WD40 repeat-containing protein SMU1 Q9H7B4 SMYD3 SET and MYND domain- containing protein 3 O00161 SNAP23 Synaptosomal-associated protein 23 O95721 SNAP29 Synaptosomal-associated protein 29 Q7KZF4 SND1 Staphylococcal nuclease domain- containing protein O75643 SNRNP200 U5 small nuclear ribonucleoprotein 200 kDa helicas Q96DI7 SNRNP40 U5 small nuclear ribonucleoprotein 40 kDa protein P08621 SNRNP70 U1 small nuclear ribonucleoprotein 70 kDa P09012 SNRPA U1 small nuclear ribonucleoprotein A P62314 SNRPD1 Small nuclear ribonucleoprotein Sm D1 Q13573 SNW1 SNW domain-containing protein 1 Q13596 SNX1 Sorting nexin-1 O60749 SNX2 Sorting nexin-2 Q96L92 SNX27 Sorting nexin-27 Q9Y5X3 SNX5 Sorting nexin-5 Q9UNH7 SNX6 Sorting nexin-6 Q9Y5X1 SNX9 Sorting nexin-9 P35610 SOAT1 Sterol O-acyltransferase 1 P04179 SOD2 Superoxide dismutase P18583 SON Protein SON Q99523 SORT1 Sortilin O60271 SPAG9 C-Jun-amino-terminal kinase- interacting protein 4 Q8NB90 SPATA5 Spermatogenesis-associated protein 5 Q8NBT2 SPC24 Kinetochore protein Spc24 Q9HBM1 SPC25 Kinetochore protein Spc25 Q15005 SPCS2 Signal peptidase complex subunit 2 Q8N0X7 SPG20 Spartin Q9H2V7 SPNS1 Protein spinster homolog 1 P35270 SPR Sepiapterin reductase P02549 SPTA1 Spectrin alpha chain, erythrocytic 1 Q13813 SPTAN1 Spectrin alpha chain, non- erythrocytic 1 Q01082 SPTBN1 Spectrin beta chain, non- erythrocytic 1 O15269 SPTLC1 Serine palmitoyltransferase 1 O15270 SPTLC2 Serine palmitoyltransferase 2 Q14534 SQLE Squalene monooxygenase P30626 SRI Sorcin P19623 SRM Spermidine synthase P61011 SRP54 Signal recognition particle 54 kDa protein Q9UHB9 SRP68 Signal recognition particle 68 kDa protein O76094 SRP72 Signal recognition particle 72 kDa protein Q965B4 SRPK1 SRSF protein kinase 1 P08240 SRPR Signal recognition particle receptor subunit alpha Q9Y5M8 SRPRB Signal recognition particle receptor subunit beta Q9UQ35 SRRM2 Serine/arginine repetitive matrix protein 2 Q9BXP5 SRRT Serrate RNA effector molecule homolog O75494 SRSF10 Serine/arginine-rich splicing factor 10 P84103 SRSF3 Serine/arginine-rich splicing factor 3 Q16629 SRSF7 Serine/arginine-rich splicing factor 7 Q13242 SRSF9 Serine/arginine-rich splicing factor 9 Q04837 SSBP1 Single-stranded DNA-binding protein, mitochondrial P43307 SSR1 Translocon-associated protein subunit alpha P51571 SSR4 Translocon-associated protein subunit delta Q08945 SSRP1 FACT complex subunit SSRP1 P50502 ST13 Hsc70-interacting protein Q8N3U4 STAG2 Cohesin subunit SA-2 Q92783 STAM Signal transducing adapter molecule 1 O95772 STARD3NL MLN64 N-terminal domain homolog Q9NQZ5 STARD7 StAR-related lipid transfer protein 7, mitochondri P42224 STAT1 Signal transducer and activator of transcription 1 P52630 STAT2 Signal transducer and activator of transcription 2 P40763 STAT3 Signal transducer and activator of transcription 3 P42229 STAT5A Signal transducer and activator of transcription 5 P51692 STAT5B Signal transducer and activator of transcription 5 O95793 STAU1 Double-stranded RNA-binding protein Staufen homolo Q13586 STIM1 Stromal interaction molecule 1 P31948 STIP1 Stress-induced-phosphoprotein 1 Q9Y6E0 STK24 Serine/threonine-protein kinase 24 Q13188 STK3 Serine/threonine-protein kinase 3 Q13043 STK4 Serine/threonine-protein kinase 4 P16949 STMN1 Stathmin Q9UJZ1 STOML2 Stomatin-like protein 2 Q9Y3F4 STRAP Serine-threonine kinase receptor- associated protei Q96519 STRBP Spermatid perinuclear RNA- binding protein P46977 STT3A Dolichyl- diphosphooligosaccharide--protein glycosy Q8TCJ2 STT3B Dolichyl- diphosphooligosaccharide--protein glycosy Q9UNE7 STUB1 E3 ubiquitin-protein ligase CHIP O60499 STX10 Syntaxin-10 Q86Y82 STX12 Syntaxin-12 Q9P2W9 STX18 Syntaxin-18 Q13190 STX5 Syntaxin-5 O43752 STX6 Syntaxin-6 Q15833 STXBP2 Syntaxin-binding protein 2 O00186 STXBP3 Syntaxin-binding protein 3 Q96I99 SUCLG2 Succinyl-CoA ligase [GDP- forming] subunit beta, mi Q8IWZ8 SUGP1 SURP and G-patch domain- containing protein 1 O94901 SUN1 SUN domain-containing protein 1 Q9UH99 SUN2 SUN domain-containing protein 2 Q9Y5B9 SUPT16H FACT complex subunit SPT16 O00267 SUPT5H Transcription elongation factor SPT5 Q7KZ85 SUPT6H Transcription elongation factor SPT6 O15260 SURF4 Surfeit locus protein 4 Q15022 SUZ12 Polycomb protein SUZ12 Q96A49 SYAP1 Synapse-associated protein 1 Q92797 SYMPK Symplekin O60506 SYNCRIP Heterogeneous nuclear ribonucleoprotein Q Q9Y6A5 TACC3 Transforming acidic coiled-coil- containing protein Q9BSH4 TACO1 Translational activator of cytochrome c oxidase 1 Q92804 TAF15 TATA-binding protein-associated factor 2N P37802 TAGLN2 Transgelin-2 Q13148 TARDBP TAR DNA-binding protein 43 P26639 TARS Threonine--tRNA ligase, cytoplasmic Q9BW92 TARS2 Threonine--tRNA ligase, mitochondrial Q8TC07 TBC1D15 TBC1 domain family member 15 Q99426 TBCB Tubulin-folding cofactor B Q9BTW9 TBCD Tubulin-specific chaperone D Q15813 TBCE Tubulin-specific chaperone E Q9Y4P3 TBL2 Transducin beta-like protein 2 Q12788 TBL3 Transducin beta-like protein 3 Q969Z0 TBRG4 Protein TBRG4 P23193 TCEA1 Transcription elongation factor A protein 1 Q13428 TCOF1 Treacle protein P17987 TCP1 T-complex protein 1 subunit alpha Q9Y2W6 TDRKH Tudor and KH domain- containing protein Q9NZ01 TECR Trans-2,3-enoyl-CoA reductase Q9Y4R8 TELO2 Telomere length regulation protein TEL2 homolog Q9NXF1 TEX10 Testis-expressed sequence 10 protein Q00059 TFAM Transcription factor A, mitochondrial Q92734 TFG Protein TFG P02786 TFRC Transferrin receptor protein 1 P21980 TGM2 Protein-glutamine gamma- glutamyltransferase 2 Q08188 TGM3 Protein-glutamine gamma- glutamyltransferase E Q96RS0 TGS1 Trimethylguanosine synthase Q8IXH7 TH1L Negative elongation factor C/D Q96FV9 THOC1 THO complex subunit 1 Q96J01 THOC3 THO complex subunit 3 P52888 THOP1 Thimet oligopeptidase Q9Y2W1 THRAP3 Thyroid hormone receptor- associated protein 3 Q9BV44 THUMPD3 THUMP domain-containing protein 3 P31483 TIA1 Nucleolysin TIA-1 isoform p40 Q01085 TIAL1 Nucleolysin TIAR P62072 TIMM10 Mitochondrial import inner membrane translocase su Q9Y5L4 TIMM13 Mitochondrial import inner membrane translocase su Q99595 TIMM17A Mitochondrial import inner membrane translocase su O60830 TIMM17B Mitochondrial import inner membrane translocase su O14925 TIMM23 Mitochondrial import inner membrane translocase su Q5SRD1 TIMM23B Putative mitochondrial import inner membrane trans O43615 TIMM44 Mitochondrial import inner membrane translocase su Q3ZCQ8 TIMM50 Mitochondrial import inner membrane translocase su Q9NPL8 TIMMDC1 Translocase of inner mitochondrial membmne domain O75663 TIPRL TIP41-like protein Q6JUT2 TIRAP3 TIR domain-containing adapter molecule 2 Q86UE8 TLK2 Serine/threonine-protein kinase tousled-like 2 E9PSI1 TM9SF1 Transmembrane 9 superfamily member 1 Q99805 TM9SF2 Transmembrane 9 superfamily member 2 Q9HD45 TM9SF3 Transmembrane 9 superfamily member 3 Q92544 TM9SF4 Transmembrane 9 superfamily member 4 P55061 TMBIM6 Bax inhibitor 1 Q9UM00 TMCO1 Transmembrane and coiled-coil domain-containing pr Q13445 TMED1 Transmembrane emp24 domain- containing protein 1 P49755 TMED10 Transmembrane emp24 domain-containing protein 10 Q15363 TMED2 Transmembrane emp24 domain- containing protein 2 Q9Y3A6 TMED5 Transmembrane emp24 domain- containing protein 5 Q9Y3B3 TMED7 Transmembrane emp24 domain- containing protein 7 Q9BVK6 TMED9 Transmembrane emp24 domain- containing protein 9 Q9H061 TMEM126A Transmembrane protein 126A Q8IUX1 TMEM126B Transmembrane protein 126B Q9P0S9 TMEM14C Transmembrane protein 14C Q9NX00 TMEM160 Transmembrane protein 160 Q9NX61 TMEM161A Transmembrane protein 161A Q9HC07 TMEM165 Transmembrane protein 165 Q86WV6 TMEM173 Transmembrane protein 173 O14524 TMEM194A Transmembrane protein 194A Q8N511 TMEM199 Transmembrane protein 199 Q6UW68 TMEM205 Transmembrane protein 205 Q9H813 TMEM206 Transmembrane protein 206 Q96SK2 TMEM209 Transmembrane protein 209 Q6NUQ4 TMEM214 Transmembrane protein 214 P57088 TMEM33 Transmembrane protein 33 Q9NVV0 TMEM38B Trimeric intracellular cation channel type B Q9BTV4 TMEM43 Transmembrane protein 43 Q9BTX1 TMEM48 Nucleoporin NDC1 Q9BXS4 TMEM59 Transmembrane protein 59 Q6PI78 TMEM65 Transmembrane protein 65 Q96MH6 TMEM68 Transmembrane protein 68 Q9BUB7 TMEM70 Transmembrane protein 70, mitochondrial Q8NBN3 TMEM87A Transmembrane protein 87A Q5BJF2 TMEM97 Transmembrane protein 97 P28289 TMOD1 Tropomodulin-1 Q9NYL9 TMOD3 Tropomodulin-3 P42166 TMPO Lamina-associated polypeptide 2, isoform alpha P42167 TMPO Lamina-associated polypeptide 2, isoforms beta/gam Q6ZXV5 TMTC3 Transmembrane and TPR repeat- containing protein 3 Q9H3N1 TMX1 Thioredoxin-related transmembrane protein 1 Q96JJ7 TMX3 Protein disulfide-isomerase TMX3 Q9H1E5 TMX4 Thioredoxin-related transmembrane protein 4 Q9C0C2 TNKS1BP1 182 kDa tankyrase-1-binding protein Q92973 TNPO1 Transportin-1 O14787 TNPO2 Transportin-2 Q9Y5L0 TNPO3 Transportin-3 O60784 TOM1 Target of Myb protein 1 Q9NS69 TOMM22 Mitochondrial import receptor subunit TOM22 homolo O96008 TOMM40 Mitochondrial import receptor subunit TOM40 homolo O94826 TOMM70A Mitochondrial import receptor subunit TOM70 P11388 TOP2A DNA topoisomerase 2-alpha Q02880 TOP2B DNA topoisomerase 2-beta O14656 TOR1A Torsin-1A Q5JTV8 TOR1AIP1 Torsin-1A-interacting protein 1 P04637 TP53 Cellular tumor antigen p53 O43399 TPD52L2 Tumor protein D54 P06753 TPM3 Tropomyosin alpha-3 chain P67936 TPM4 Tropomyosin alpha-4 chain O14773 TPP1 Tripeptidyl-peptidase 1 P12270 TPR Nucleoprotein TPR P13693 TPT1 Tmnslationally-controlled tumor protein Q9ULW0 TPX2 Targeting protein for Xklp2 Q13595 TRA2A Transformer-2 protein homolog alpha P62995 TRA2B Transformer-2 protein homolog beta Q9H4I3 TRABD TraB domain-containing protein Q15629 TRAM1 Translocating chain-associated membrane protein 1 Q12931 TRAP1 Heat shock protein 75 kDa, mitochondrial Q13263 TRIM28 Transcription intermediary factor 1-beta Q9UPN9 TRIM33 E3 ubiquitin-protein ligase TRIM33 Q14669 TRIP12 E3 ubiquitin-protein ligase TRIP12 Q15645 TRIP13 Pachytene checkpoint protein 2 homolog Q7L0Y3 TRMT10C Mitochondrial ribonuclease P protein 1 Q7Z4G4 TRMT11 tRNA (guanine(10)-N2)- methyltransferase homolog Q7Z2T5 TRMT1L TRMT1-like protein Q8IZ69 TRMT2A tRNA (uracil-5-)- methyltransferase homolog A P10155 TROVE2 60 kDa SS-A/Ro ribonucleoprotein P43897 TSFM Elongation factor Ts, mitochondrial Q99816 TSG101 Tumor susceptibility gene 101 protein Q15631 TSN Translin Q99598 TSNAX Translin-associated protein X O43657 TSPAN6 Tetraspanin-6 Q2NL82 TSR1 Pre-rRNA-processing protein TSR1 homolog Q99614 TTC1 Tetratricopeptide repeat protein 1 Q6DKK2 TTC19 Tetratricopeptide repeat protein 19, mitochondrial Q6P3X3 TTC27 Tetratricopeptide repeat protein 27 Q6PGP7 TTC37 Tetratricopeptide repeat protein 37 Q5R3I4 TTC38 Tetratricopeptide repeat protein 38 O95801 TTC4 Tetratricopeptide repeat protein 4 Q14166 TTLL12 Tubulin-tyrosine ligase-like protein 12 Q9C0H2 TTYH3 Protein tweety homolog 3 Q71U36 TUBA1A Tubulin alpha-1A chain P68363 TUBA1B Tubulin alpha-1B chain Q9BQE3 TUBA1C Tubulin alpha-1C chain Q13748 TUBA3C Tubulin alpha-3C/D chain P68366 TUBA4A Tubulin alpha-4A chain Q9NY65 TUBA8 Tubulin alpha-8 chain P07437 TUBB Tubulin beta chain Q9H4B7 TUBB1 Tubulin beta-1 chain Q13885 TUBB2A Tubulin beta-2A chain Q9BVA1 TUBB2B Tubulin beta-2B chain Q13509 TUBB3 Tubulin beta-3 chain P04350 TUBB4A Tubulin beta-4A chain P68371 TUBB4B Tubulin beta-4B chain Q9BUF5 TUBB6 Tubulin beta-6 chain Q3ZCM7 TUBB8 Tubulin beta-8 chain P23258 TUBG1 Tubulin gamma-1 chain Q9BSJ2 TUBGCP2 Gamma-tubulin complex component 2 P49411 TUFM Elongation factor Tu, mitochondrial Q6IBS0 TWF2 Twinfilin-2 P40222 TXLNA Alpha-taxilin P10599 TXN Thioredoxin Q99757 TXN2 Thioredoxin, mitochondrial O95881 TXNDC12 Thioredoxin domain- containing protein 12 Q9BRA2 TXNDC17 Thioredoxin domain- containing protein 17 Q8NBS9 TXNDC5 Thioredoxin domain- containing protein 5 O43396 TXNL1 Thioredoxin-like protein 1 Q16881 TXNRD1 Thioredoxin reductase 1, cytoplasmic P04818 TYMS Thymidylate synthase Q2T9J0 TYSND1 Peroxisomal leader peptide- processing protease Q01081 U2AF1 Splicing factor U2AF 35 kDa subunit P26368 U2AF2 Splicing factor U2AF 65 kDa subunit O15042 U2SURP U2 snRNP-associated SURP motif-containing protein P22314 UBA1 Ubiquitin-like modifier-activating enzyme 1 Q9UBT2 UBA2 SUMO-activating enzyme subunit 2 P62987 UBA52 Ubiquitin-60S ribosomal protein L40 A0AVT1 UBA6 Ubiquitin-like modifier-activating enzyme 6 Q9BSL1 UBAC1 Ubiquitin-associated domain- containing protein 1 Q5T6F2 UBAP2 Ubiquitin-associated protein 2 Q14157 UBAP2L Ubiquitin-associated protein 2- like J3QRK5 UBBP4 Protein UBBP4 P63279 UBE2I SUMO-conjugating enzyme UBC9 P68036 UBE2L3 Ubiquitin-conjugating enzyme E2 L3 P61081 UBE2M NEDD8-conjugating enzyme Ubc12 P61088 UBE2N Ubiquitin-conjugating enzyme E2 N Q9C0C9 UBE2O Ubiquitin-conjugating enzyme E2 O Q7Z7E8 UBE2Q1 Ubiquitin-conjugating enzyme E2 Q1 Q15386 UBE3C Ubiquitin-protein ligase E3C Q9UMX0 UBQLN1 Ubiquilin-1 Q9UHD9 UBQLN2 Ubiquilin-2 Q9NRR5 UBQLN4 Ubiquilin-4 P17480 UBTF Nucleolar transcription factor 1 Q04323 UBXN1 UBX domain-containing protein 1 P09936 UCHL1 Ubiquitin carboxyl-terminal hydrolase isozyme L1 P15374 UCHL3 Ubiquitin carboxyl-terminal hydrolase isozyme L3 Q9Y5K5 UCHL5 Ubiquitin carboxyl-terminal hydrolase isozyme L5 O94874 UFL1 E3 UFM1-protein ligase 1 Q16739 UGCG Ceramide glucosyltransferase Q9NYU2 UGGT1 UDP-glucose:glycoprotein glucosyltransferase 1 Q6BDS2 UHRF1BP1 UHRF1-binding protein 1 Q13432 UNC119 Protein unc-119 homolog A A6NIH7 UNC119B Protein unc-119 homolog B Q70J99 UNC13D Protein unc-13 homolog D Q9H3U1 UNC45A Protein unc-45 homolog A A4D2Q0 UNC84A SUN domain-containing protein 1 E9PBQ3 Uncharacterized protein H3BQZ7 Uncharacterized protein H7C417 Uncharacterized protein H7C455 Uncharacterized protein H7C469 Uncharacterized protein I3L2F9 Uncharacterized protein Q92900 UPF1 Regulator of nonsense transcripts 1 Q9BZI7 UPF3B Regulator of nonsense transcripts 3B Q9NVA1 UQCC Ubiquinol-cytochrome c reductase complex chaperone P31930 UQCRC1 Cytochrome b-c1 complex subunit 1, mitochondrial P22695 UQCRC2 Cytochrome b-c1 complex subunit 2, mitochondrial P47985 UQCRFS1 Cytochrome b-c1 complex subunit Rieske, mitochondr O14949 UQCRQ Cytochrome b-cl complex subunit 8 Q14694 USP10 Ubiquitin carboxyl-terminal hydrolase 10 P51784 USP11 Ubiquitin carboxyl-terminal hydrolase 11 P54578 USP14 Ubiquitin carboxyl-terminal hydrolase 14 Q9Y4E8 USP15 Ubiquitin carboxyl-terminal hydrolase 15 Q53GS9 USP39 U4/U6.U5 tri-snRNP-associated protein 2 Q96K76 USP47 Ubiquitin carboxyl-terminal hydrolase 47 Q86UV5 USP48 Ubiquitin carboxyl-terminal hydrolase 48 P45974 USP5 Ubiquitin carboxyl-terminal hydrolase 5 Q93009 USP7 Ubiquitin carboxyl-terminal hydrolase 7 Q9NQZ2 UTP3 Something about silencing protein 10 Q9NYH9 UTP6 U3 small nucleolar RNA- associated protein 6 homolo P51809 VAMP7 Vesicle-associated membrane protein 7 Q9P0L0 VAPA Vesicle-associated membrane protein-associated pro O95292 VAPB Vesicle-associated membrane protein-associated pro P26640 VARS Valine-tRNA ligase Q99536 VAT1 Synaptic vesicle membrane protein VAT-1 homolog P61758 VBP1 Prefoldin subunit 3 P18206 VCL Vinculin P55072 VCP Transitional endoplasmic reticulum ATPase Q96JH7 VCPIP1 Deubiquitinating protein VCIP135 P21796 VDAC1 Voltage-dependent anion- selective channel protein P45880 VDAC2 Voltage-dependent anion- selective channel protein Q9Y277 VDAC3 Voltage-dependent anion- selective channel protein P08670 VIM Vimentin Q96GC9 VMP1 Vacuole membrane protein 1 Q96RL7 VPS13A Vacuolar protein sorting- associated protein 13A Q9P253 VPS18 Vacuolar protein sorting- associated protein 18 hom Q96AX1 VPS33A Vacuolar protein sorting- associated protein 33A Q96QK1 VPS35 Vacuolar protein sorting- associated protein 35 Q9UN37 VPS4A Vacuolar protein sorting- associated protein 4A O75351 VPS4B Vacuolar protein sorting- associated protein 4B Q9UID3 VPS51 Vacuolar protein sorting- associated protein 51 hom Q99986 VRK1 Serine/threonine-protein kinase VRK1 Q7Z5K2 WAPAL Wings apart-like protein homolog P23381 WARS Tryptophan--tRNA ligase, cytoplasmic Q969T9 WBP2 WW domain-binding protein 2 O75083 WDR1 WD repeat-containing protein 1 Q9UNX4 WDR3 WD repeat-containing protein 3 Q8NI36 WDR36 WD repeat-containing protein 36 Q15061 WDR43 WD repeat-containing protein 43 Q9NNW5 WDR6 WD repeat-containing protein 6 Q9GZS3 WDR61 WD repeat-containing protein 61 Q9BQA1 WDR77 Methylosome protein 50 Q6UXN9 WDR82 WD repeat-containing protein 82 O96028 WHSC1 Probable histone-lysine N- methyltransferase NSD2 Q5T9L3 WLS Protein wntless homolog Q9NQW7 XPNPEP1 Xaa-Pro aminopeptidase 1 Q9NQH7 XPNPEP3 Probable Xaa-Pro aminopeptidase 3 O14980 XPO1 Exportin-1 Q9HAV4 XPO5 Exportin-5 Q96QU8 XPO6 Exportin-6 O43592 XPOT Exportin-T P13010 XRCC5 X-ray repair cross- complementing protein 5 P12956 XRCC6 X-ray repair cross- complementing protein 6 Q9H0D6 XRN2 5-3 exoribonuclease 2 P54577 YARS Tyrosine--tRNA ligase, cytoplasmic P67809 YBX1 Nuclease-sensitive element- binding protein 1 P07947 YES1 Tyrosine-protein kinase Yes O95070 YIF1A Protein YIF1A Q5BJH7 YIF1B Protein YIF1B P49750 YLPM1 YLP motif-containing protein 1 Q96TA2 YME1L1 ATP-dependent zinc metalloprotease YME1L1 Q96MU7 YTHDC1 YTH domain-containing protein 1 Q9Y5A9 YTHDF2 YTH domain family protein 2 P31946 YWHAB 14-3-3 protein beta/alpha P62258 YWHAE 14-3-3 protein epsilon P61981 YWHAG 14-3-3 protein gamma Q04917 YWHAH 14-3-3 protein eta P27348 YWHAQ 14-3-3 protein theta P63104 YWHAZ 14-3-3 protein zeta/delta Q8N4Q0 ZADH2 Zinc-binding alcohol dehydrogenase domain-containi Q8WU90 ZC3H15 Zinc finger CCCH domain- containing protein 15 Q7Z2W4 ZC3HAV1 Zinc finger CCCH-type antiviral protein 1 Q9NUD5 ZCCHC3 Zinc finger CCHC domain- containing protein 3 Q6NZY4 ZCCHC8 Zinc finger CCHC domain- containing protein 8 Q96KR1 ZFR Zinc finger RNA-binding protein O75844 ZMPSTE24 CAAX prenyl protease 1 homolog P17028 ZNF24 Zinc finger protein 24 O75312 ZNF259 Zinc finger protein ZPR1 Q5BKZ1 ZNF326 DBIRD complex subunit ZNF326 Q96F45 ZNF503 Zinc finger protein 503 Q86UK7 ZNF598 Zinc finger protein 598 Q15942 ZYX Zyxin

    [0303] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.