HSV ANTIGENIC PEPTIDES AND HSV PROTEIN VACCINES
20200069792 ยท 2020-03-05
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2710/16634
CHEMISTRY; METALLURGY
C12N2710/16622
CHEMISTRY; METALLURGY
A61K2039/55555
HUMAN NECESSITIES
International classification
Abstract
The disclosure relates to HSV glycoprotein B and HSV glycoprotein C antigenic peptide constructs, HSV protein vaccines, and HSV DNA vaccines, as well as methods of using the vaccines and compositions comprising the vaccines.
Claims
1. An HSV virus vaccine comprising at least one isolated antigenic polypeptide selected from the group consisting of: (i) a mature HSV glycoprotein B amino acid sequence of SEQ ID NO: 1, or a variant thereof; (ii) a mature HSV glycoprotein C amino acid sequence of SEQ ID NO: 2, or variant thereof; (iii) a mature HSV glycoprotein C amino acid sequence of SEQ ID NO:3, or variant thereof (iv) a mature HSV glycoprotein C amino acid sequence of SEQ ID NO:4, or variant thereof; and (v) a mature HSV glycoprotein C amino acid sequence of SEQ ID NO: 5, or a variant thereof; wherein the variant of SEQ ID NO: 2 comprises an alanine at position 368; the variant of SEQ ID NO: 3 comprises an alanine at position 323; the variant of SEQ ID NO: 4 comprises an alanine at position 327; and the variant of SEQ ID NO: 5 comprises an alanine at position 333.
2. The HSV virus vaccine of claim 1, wherein the at least one isolated antigenic polypeptide is a variant of any one of SEQ ID NOs: 1-5, which variant comprises 1-10 conservative amino acid mutations as compared to the sequence of any one of SEQ ID NOs: 1-5.
3. The HSV virus vaccine of claim 1, wherein the at least one isolated antigenic polypeptide consists of the mature amino acid sequence of SEQ ID NOs: 1-5.
4. The HSV virus vaccine of claim 1 comprising at least two isolated antigenic polypeptides, wherein the first isolated antigenic polypeptide comprises a mature HSV glycoprotein B amino acid sequence of SEQ ID NO: 1, or a variant thereof, and the second isolated antigenic polypeptide comprises an HSV glycoprotein D or immunogenic fragment thereof.
5. The HSV virus vaccine of claim 4, further comprising a third isolated antigenic polypeptide, wherein the third isolated antigenic polypeptide comprises a mature HSV glycoprotein C amino acid sequence of any of SEQ ID NOs: 2-5.
6.-7. (canceled)
8. The HSV virus vaccine of claim 1 comprising at least two isolated antigenic polypeptides, wherein the first isolated antigenic polypeptide comprises a mature HSV glycoprotein C amino acid sequence of any of SEQ ID NOs: 2-5, or a variant thereof, and the second isolated antigenic polypeptide comprises an HSV glycoprotein D or immunogenic fragment thereof.
9. The HSV virus vaccine of claim 1 comprising at least two isolated antigenic polypeptides, wherein the first isolated antigenic polypeptide comprises a mature HSV glycoprotein B amino acid sequence of SEQ ID NO: 1, or a variant thereof, and the second polypeptide comprises a mature HSV glycoprotein C amino acid sequence of any of SEQ ID NOs: 2-5, or a variant thereof.
10. (canceled)
11. The HSV virus vaccine of claim 9, comprising a third isolated antigenic polypeptide, wherein the third isolated antigenic polypeptide comprises an HSV glycoprotein D or immunogenic fragment thereof.
12.-15. (canceled)
16. A pharmaceutical composition comprising the HSV virus vaccine of claim 1 in combination with one or more pharmaceutically acceptable excipients.
17.-29. (canceled)
30. A method of inducing an immune response in a subject, the method comprising administering to the subject the HSV virus vaccine of claim 1 in an amount effective to produce an antigen-specific immune response in the subject.
31.-37. (canceled)
38. An isolated peptide comprising the amino acid sequence of any one of SEQ ID NOs: 1-5 or the mature amino acid sequence of any one of SEQ ID NOs: 1-5, or a variant thereof, wherein the variant of SEQ ID NO: 2 comprises an alanine at position 368; the variant of SEQ ID NO: 3 comprises an alanine at position 323; the variant of SEQ ID NO: 4 comprises an alanine at position 327; and the variant of SEQ ID NO: 5 comprises an alanine at position 333.
39.-48. (canceled)
49. The HSV virus vaccine of claim 1, the at least one isolated antigenic polypeptide comprising a mature amino acid sequence of SEQ ID NO: 1, or variant thereof.
50. The HSV virus vaccine of claim 49, wherein the at least one isolated antigenic polypeptide is a variant of the mature amino acid sequence of SEQ ID NO: 1, the variant of SEQ ID NO: 1 comprising 1-10 conservative amino acid mutations as compared to the sequence of SEQ ID NO: 1.
51. The HSV virus vaccine of claim 1, the at least one isolated antigenic polypeptide comprising a mature amino acid sequence of SEQ ID NO: 2, or variant thereof, wherein the variant of SEQ ID NO: 2 comprises an alanine at position 368.
52. The HSV virus vaccine of claim 51, wherein the at least one isolated antigenic polypeptide is a variant of the mature amino acid sequence of SEQ ID NO: 2, the variant of SEQ ID NO: 2 comprising 1-10 conservative amino acid mutations as compared to the sequence of SEQ ID NO: 2.
53. The HSV virus vaccine of claim 1, the at least one isolated antigenic polypeptide comprising a mature amino acid sequence of SEQ ID NO: 3, or variant thereof, wherein the variant of SEQ ID NO: 3 comprises an alanine at position 323.
54. The HSV virus vaccine of claim 53, wherein the isolated antigenic polypeptide is the variant of SEQ ID NO: 3, the variant of SEQ ID NO: 3 comprising 1-10 conservative amino acid mutations as compared to the sequence of SEQ ID NO: 3.
55. The HSV virus vaccine of claim 1, the at least one isolated antigenic polypeptide comprising a mature amino acid sequence of SEQ ID NO: 4, or variant thereof, wherein the variant of SEQ ID NO: 4 comprises an alanine at position 327.
56. The HSV virus vaccine of claim 55, wherein the isolated antigenic polypeptide is the variant of SEQ ID NO: 4, the variant of SEQ ID NO: 4 comprising 1-10 conservative amino acid mutations as compared to the sequence of SEQ ID NO: 4.
57. The HSV virus vaccine of claim 1, the isolated antigenic polypeptide comprising a mature amino acid sequence of SEQ ID NO: 5, or variant thereof, wherein the variant of SEQ ID NO: 5 comprises an alanine at position 333.
58. The HSV virus vaccine of claim 57, wherein the isolated antigenic polypeptide is a variant of SEQ ID NO: 5, the variant of SEQ ID NO: 5 comprising 1-10 conservative amino acid mutations as compared to the sequence of SEQ ID NO: 5.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] The foregoing and other objects, features and advantages will be apparent from the following description of particular embodiments of the invention, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating the principles of various embodiments of the invention.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
DETAILED DESCRIPTION
[0035] Isolated polypeptides or polynucleotides are at least partially free of other biological molecules from the cells or cell cultures in which they are produced. Such biological molecules include other nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. It may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof. Generally, the term isolated is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the polypeptides or polynucleotides.
Lipid Nanoparticles
[0036] As used herein, lipid nanoparticle or LNP refers to any lipid composition that can be used to deliver a product, including, but not limited to, liposomes or vesicles, wherein an aqueous volume is encapsulated by amphipathic lipid bilayers single; unilamellar or multiple; multilamellar), or, in other embodiments, wherein the lipids coat an interior comprising a prophylactic product or lipid aggregates or micelles, wherein the lipid encapsulated therapeutic product is contained within a relatively disordered lipid mixture. Except where noted, the lipid nanoparticle does not need to have the antigenic polypeptide incorporated therein and may be used to deliver a product when in the same formulation.
[0037] As used herein, polyamine means compounds having two or more amino groups. Examples include putrescine, cadaverine, spermidine, and spermine.
[0038] Unless otherwise specified, mole % refers to a mole percent of total lipids. Generally, the LNPs of the compositions of the invention are composed of one or more cationic lipids (including ionizable cationic lipids) and one or more poly(ethyleneglycol)-lipids (PEG-lipids). In certain embodiments, the LNPs further comprise one or more non-cationic lipids. The one or more non-cationic lipids can include a phospholipid, phospholipid derivative, a sterol, a fatty acid, or a combination thereof.
[0039] Cationic lipids and ionizable cationic lipids suitable for the LNPs are described herein. Ionizable cationic lipids are characterized by the weak basicity of their lipid head groups, which affects the surface charge of the lipid in a pH-dependent manner, rendering them positively charged at acidic pH but close to charge-neutral at physiologic pH. Cationic lipids are characterized by monovalent or multivalent cationic charge on their headgroups, which renders them positively charged at neutral pH. In certain embodiments, the cationic and ionizable lipid is capable of complexing with hydrophilic bioactive molecules to produce a hydrophobic complex that partitions into the organic phase of a two-phase aqueous/organic system. It is contemplated that both monovalent and polyvalent cationic lipids may be utilized to form hydrophobic complexes with bioactive molecules.
[0040] Preferred cationic and ionizable cationic lipids for use in forming the LNPs include, but are not limited to, N,N-dioleyl-N,N-dimethylammonium chloride (DODAC); N-(2,3dioleyloxy)propyl)-N,N,Ntrimethylammonium chloride (DOTMA); N,NdistearylN,N-dimethylammonium bromide (DDAB); N-(2,3dioleoyloxy)propyl)-N,N,N-trimethylammonium chloride (DODAP); 1,2 bis (oleoyloxy)-3-(trimethylammonio) propane (DOTAP); 3-(N(N,N-dimethylaminoethane)-carbam-oyl)cholesterol (DC-Chol); diheptadecylamidoglycylspermidine (DHGS) and N-(1,2-dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hycloxyethyl ammonium bromide (DMRIE). Additionally, a number of commercial preparations of cationic lipids, as well as other components, are available which can be used in the present invention. These include, for example, LIPOFECTIN (commercially available cationic lipid nanoparticles comprising DOTMA and 1,2dioleoyl-sn-3-phosphoethanolamine (DOPE), from GIBCOBRL, Grand Island, N.Y., USA); and LIPOFECTAMINE (commercially available cationic lipid nanoparticles comprising N-(1-(2,3dioleyloxy)propyl)N-(2-(sperminecarboxamido)ethyl)-N,N-dimethylammonium trifluoroacetate (DOSPA) and (DOPE), from (GIBCOBRL). The following lipids are cationic and have a positive charge at below physiological pH: DODAP, DODMA, DMDMA, 1,2-DiLinoleyloxy-N,N-dimethylaminopropane (DLinDMA), 4-(2,2-diocta-9,12-dienyl-[1,3]dioxolan-4-ylmethyl)-dimethylamine, DLinKDMA (WO 2009/132131 A1), DLin-K-C2-DMA (WO2010/042877), DLin-M-C3-DMA (WO2010/146740 and/or WO2010/105209), DLin-MC3-DMA (heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate; Jayaraman et al., 2012, Angew. Chem. Int. Ed. Engl. 51:8529-8533), 2-{4-[(3)-cholest-5-en-3-yloxy]butoxy}-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dienlyloxyl]propan-1-amine) (CLinDMA), and the like. Other cationic lipids suitable for use in the invention include, e.g., the cationic lipids described, in U.S. Pat. Nos. 5,208,036, 5,264,618, 5,279,833 and 5,283,185, and U.S. Patent Application Publication Nos. 2008/0085870 and 2008/0057080. Other cationic lipids suitable for use in the invention include, e.g., Lipids E0001-E0118 or E0119-E0180 as disclosed in Table 6 (pages 112-139) of International Patent Application Publication No. WO2011/076807 (which also discloses methods of making, and methods of using these cationic lipids).
[0041] In certain aspects of this embodiment of the invention, the LNPs comprise one or more of the following ionizable cationic lipids: DLinDMA, DlinKC2DMA DLin-MC3-DMA, CLinDMA, or S-Octyl CLinDMA (See International Patent Application Publication No. WO2010/021865).
[0042] In certain aspects of this embodiment of the invention, LNPs comprise one or more ionizable cationic lipids described in International Patent Application Publication No. WO2011/022460 A1, or any pharmaceutically acceptable salt thereof, or a stereoisomer of any of the compounds or salts therein.
[0043] When structures of the same constitution differ in respect to the spatial arrangement of certain atoms or groups, they are stereoisomers, and the considerations that are significant in analyzing their interrelationships are topological. If the relationship between two stereoisomers is that of an object and its nonsuperimposable mirror image, the two structures are enantiomeric, and each structure is said to be chiral. Stereoisomers also include diastereomers, cis-trans isomers and conformational isomers. Diastereoisomers can be chiral or achiral, and are not mirror images of one another. Cis-trans isomers differ only in the positions of atoms relative to a specified plane in cases where these atoms are, or are considered as if they were, parts of a rigid structure. Conformational isomers are isomers that can be interconverted by rotations about formally single bonds. Examples of such conformational isomers include cyclohexane conformations with chair and boat conformers, carbohydrates, linear alkane conformations with staggered, eclipsed and gauche conformers, etc. See J. Org. Chem. 35, 2849 (1970).
[0044] Many organic compounds exist in optically active forms having the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L or R and S are used to denote the absolute configuration of the molecule about its chiral center(s). The prefixes d and l or (+) and () are employed to designate the sign of rotation of plane-polarized light by the compound, with () or meaning that the compound is levorotatory. A compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, enantiomers are identical except that they are non-superimposable mirror images of one another. A mixture of enantiomers is often called an enantiomeric mixture. A 50:50 mixture of enantiomers is referred to as a racemic mixture. Many of the compounds described herein can have one or more chiral centers and therefore can exist in different enantiomeric forms. If desired, a chiral carbon can be designated with an asterisk (*). When bonds to the chiral carbon are depicted as straight lines in the Formulas of the invention, it is understood that both the (R) and (S) configurations of the chiral carbon, and hence both enantiomers and mixtures thereof; are embraced within the Formula. As is used in the art, when it is desired, to specify the absolute configuration about a chiral carbon, one of the bonds to the chiral carbon can be depicted as a wedge (bonds to atoms above the plane) and the other can be depicted as a series or wedge of short parallel lines (bonds to atoms below the plane). The Cahn-Inglod-Prelog system can be used to assign the (R) or (S) configuration to a chiral carbon.
[0045] When the compounds of the present invention contain one chiral center, the compounds exist in two enantiomeric forms and the present invention includes both enantiomers and mixtures of enantiomers, such as the specific 50:50 mixture referred to as a racemic mixtures. The enantiomers can be resolved by methods known to those skilled in the art, such as formation of diastereoisomeric salts which may be separated, for example, by crystallization (see, CRC Handbook of Optical Resolutions via Diastereomeric Salt Formation by David Kozma (CRC Press, 2001)); formation of diastereoisomeric derivatives or complexes which may be separated, for example, by crystallization, gas-liquid or liquid chromatography; selective reaction of one enantiomer with an enantiomer-specific reagent, for example enzymatic esterification; or gas-liquid or liquid chromatography in a chiral environment, for example on a chiral support for example silica with a bound chiral ligand or in the presence of a chiral solvent. It will be appreciated that where the desired enantiomer is converted into another chemical entity by one of the separation procedures described above, a further step is required to liberate the desired enantiomeric form. Alternatively, specific enantiomers may be synthesized by asymmetric synthesis using optically active reagents, substrates, catalysts or solvents, or by converting one enantiomer into the other by asymmetric transformation.
[0046] Designation of a specific absolute configuration at a chiral carbon of the compounds of the invention is understood to mean that the designated enantiomeric form of the compounds is in enantiomeric excess (ee) or in other words is substantially free from the other enantiomer. For example, the R forms of the compounds are substantially free from the S forms of the compounds and are, thus, in enantiomeric excess of the S forms. Conversely, S forms of the compounds are substantially free of R forms of the compounds and are, thus, in enantiomeric excess of the R forms. Enantiomeric excess, as used herein, is the presence of a particular enantiomer at greater than 50%. In a particular embodiment when a specific absolute configuration is designated, the enantiomeric excess of depicted compounds is at least about 90%.
[0047] When a compound of the present invention has two or more chiral carbons it can have more than two optical isomers and can exist in diastereoisomeric forms. For example, when there are two chiral carbons, the compound can have up to 4 optical isomers and 2 pairs of enantiomers ((S,S)/(R,R) and (R,S)/(S,R)). The pairs of enantiomers (e.g., (S,S)/(R,R)) are mirror image stereoisomers of one another. The stereoisomers that are not mirror-images (e.g., (S,S) and (R,S)) are diastereomers. The diastereoisomeric pairs may be separated by methods known to those skilled in the art, for example chromatography or crystallization and the individual enantiomers within each pair may be separated as described above. The present invention includes each diastereoisomer of such compounds and mixtures thereof.
[0048] The LNPs may also comprise any combination of two or more of the cationic lipids described herein. In certain aspects, the cationic lipid typically comprises from about 0.1 to about 99.9 mole % of the total lipid present in said particle. In certain aspects, the cationic lipid can comprise from about 80 to about 99.9% mole %. ln other aspects, the cationic lipid comprises from about 2% to about 70%, from about 5% to about 50%, from about 10% to about 45%, from about 20% to about 99.8%, from about 30% to about 70%, from about 34% to about 59%, from about 20% to about 40%, or from about 30% to about 40% (mole %) of the total lipid present in said particle.
[0049] The LNPs described herein can further comprise a noncationic lipid, which can be any of a variety of neutral uncharged, zwitterionic or anionic lipids capable of producing a stable complex. They are preferably neutral, although they can be negatively charged. Examples of noncationic lipids useful in the present invention include phospholipid-related materials, such as natural phospholipids, synthetic phospholipid derivatives, fatty acids, sterols, and combinations thereof. Natural phospholipids include phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylglycerol (PG), phosphatidylserine (PS), phosphatidylinositol (PI), Phosphatidic acid (phosphatidate) (PA), dipalmitoylphosphatidylcholine, monoacyl-phosphatidylcholine (lyso PC), 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), N-Acyl-PE, phosphoinositides, and phosphosphingolipids. Phospholipid derivatives include phosphatidic acid (DMPA, DPPA, DSPA), phosphatidylcholine (DDPC, DLPC, DMPC, DPPC, DSPC, DOPC, POPC, DEPC), phosphatidylglycerol (DMPG, DPPG, DSPG, POPG), phosphatidylethanolamine (DMPE, DPPE, DSPE DOPE), and phosphatidylserine (DOPS). Fatty acids include C14:0, palmitic acid (C16:0), stearic acid (C18:0), oleic acid (C18:1), linoleic acid (C18:2), linolenic acid (C18:3), and arachidonic acid (C20:4), C20:0, C22:0 and lethicin.
[0050] In certain embodiments of the invention the non-cationic lipid is selected from lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, sphingomyelin, cephalin, cardiolipin, phosphatidic acid, cerebrosides, dicetylphosphate, distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoyl-phosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoyl-phosphatidylet-hanolamine (POPE) and dioleoyl-phosphatidylethanolamine 4-(N-maleimidomethyl)-cyclohexane-1-carboxylate (DOPE-mal). Noncationic lipids also include sterols such as cholesterol, stigmasterol or stigmastanol. Cholesterol is known in the art. See U.S. Patent Application Publication Nos: U.S. 2006/0240554 and U.S. 2008/0020058. In certain embodiments, the LNP comprise a combination of a phospholipid and a sterol.
[0051] Where present, the non-cationic lipid typically comprises from about 0.1% to about 65%, about 2% to about 65%, about 10% to about 65%, or about 25% to about 65% expressed as mole percent of the total lipid present in the LNP. The LNPs described herein further include a polyethyleneglycol (PEG) lipid conjugate (PEG-lipid) which may aid as a bilayer stabilizing component. The lipid component of the PEG lipid may be any non-cationic lipid described above including natural phospholipids, synthetic phospholipid derivatives, fatty acids, sterols, and combinations thereof. In certain embodiments of the invention, the PEG-lipids include, PEG coupled to dialkyloxypropyls (PEG-DAA) as described in, e.g., International Patent Application Publication No. WO 05/026372, PEG coupled to diacylglycerol (PEG-DAG) as described in, e.g., U.S. Patent Publication Nos. 20030077829 and 2005008689; PEG coupled to phosphatidylethanolamine (PE) (PEG-PE), or PEG conjugated to 1,2-Di-O-hexadecyl-sn-glyceride (PEG-DSG), or any mixture thereof (see, e.g., U.S. Pat. No. 5,885,613).
[0052] In one embodiment, the PEG-DAG conjugate is a dilaurylglycerol (C12)-PEG conjugate, a PEG dimyristylglycerol (C14) conjugate, a PEG-dipalmitoylglycerol (C16) conjugate, a PEG-dilaurylglycamide (C12) conjugate, a PEG-dimyristylglycamide (C14) conjugate, a PEG-dipalmitoylglycamide (C16) conjugate, or a PEG-disterylglycamide (C18). Those of skill in the art will readily appreciate that other diacylglycerols can be used in the PEG-DAG conjugates.
[0053] In certain embodiments, PEG-lipids include, but are not limited to, PEG-dimyristolglycerol (PEG-DMG), PEG-disteryl glycerol (PEG-DSG), PEG-dipalmetoleyl, PEG-dioleyl, PEG-distearyl, PEG-diacylglycamide (PEG-DAG), PEG-dialmitoyl phosphatidylethanolamine (PEG-DPPE), and PEG-1,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA).
[0054] In certain embodiments, the PEG-lipid is PEG coupled to dimyristoylglycerol (PEG-DMG), e.g., as described in Abrams et al., 2010, Molecular Therapy 18(1):171, and U.S. Patent Application Publication Nos. US 2006/0240554 and US 2008/0020058, including for example, 2KPEG/PEG2000-DMG.
[0055] In certain embodiments, the PEG-lipid, such as a PEG-DAG, PEG-cholesterol, PEG-DMB, comprises a polyethylene glycol having an average molecular weight ranging of about 500 daltons to about 10,000 daltons, of about 750 daltons to about 5,000 daltons, of about 1,000 daltons to about 5,000 daltons, of about 1,500 daltons to about 3,000 daltons or of about 2,000 daltons. In certain embodiments, the PEG-lipid comprises PEG400, PEG1500, PEG2000 or PEG5000.
[0056] The acyl groups in any of the lipids described above are preferably acyl groups derived from fatty acids having about C10 to about C24 carbon chains. In one embodiment, the acyl group, is lauroyl, myristoyl palmitoyl, stearoyl or oleoyl.
[0057] The PEG-lipid conjugate typically comprises from about 0.1% to about 15%, from about 0.5% to about 20%, from about 1.5% to about 18%, from about 4% to about 15%, from about 5% to about 12%, from about 1% to about 4%, or about 2% expressed as a mole % of the total lipid present in said particle.
[0058] In certain embodiments of the invention, the LNPs comprise one or more cationic lipids, cholesterol and 1,2-Dimyristoyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG).
[0059] In certain embodiments the invention, the LNPs comprise one or more cationic lipids, cholesterol, 1,2-Distearoyl-sn-glycero-3-phosphocholine (DSPC), and 1,2-Dimyristoyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG).
[0060] In certain embodiments of the invention, the LNPs comprise lipid compounds assembled within the following molar ratios:
[0061] Cationic Lipid (20-99.8 mole %)
[0062] Non-cationic lipid (0.1-65 mole %) and
[0063] PEG-DMG (0.1-20 mole %).
[0064] In certain embodiments of the invention, the LNPs comprise lipid compounds assembled within the following molar ratios:
[0065] Cationic Lipid (30-70 mole %)
[0066] Non-cationic lipid (20-65 mole %) and
[0067] PEG-DMG (1-15 mole %).
[0068] In certain aspects of this embodiment, the non-cationic lipid is cholesterol. Exemplary LNPs may include cationic lipid/cholesterol/PEG-DMG at about the following molar ratios: 58/30/10.
[0069] In certain aspects of this embodiment, the non-cationic lipid is cholesterol and DSPC. Exemplary LNPs may include cationic lipid/cholesterol/DSPC/PEG-DMG at about the following molar ratios: 59/30/10/1; 58/30/10/2; 43/41/15/1; 42/41/15/2; 40/48/10/2; 39/41/19/1; 38/41/19/2; 34/41/24/1; and 33/41/24/2.
Preparation of LNPs
[0070] LNPs can be formed, for example, by a rapid precipitation process which entails micro-mixing the lipid components dissolved in ethanol with an aqueous solution using a confined volume mixing apparatus such as a confined volume T-mixer, a multi-inlet vortex mixer (MIVM), or a microfluidics mixer device as described below. The lipid solution contains one or more cationic lipids, one or more noncationic lipids (e.g., DSPC), PEG-DMG, and optionally cholesterol, at specific molar ratios in ethanol. The aqueous solution consists of a sodium citrate or sodium acetate buffered salt solution with pH in the range of 2-6, preferably 3.5-5.5. The two solutions are heated to a temperature in the range of 25 C.-45 C., preferably 30 C.-40 C., and then mixed in a confined volume mixer thereby instantly forming the LNP. When a confined volume T-mixer is used, the T-mixer has an internal diameter (ID) range from 0.25 to 1.0 mm. The alcohol and aqueous solutions are delivered to the inlet of the T-mixer using programmable syringe pumps, and with a total flow rate from 10-600 mL/minute. The alcohol and aqueous solutions are combined in the confined-volume mixer with a ratio in the range of 1:1 to 1:3 vol:vol, but targeting 1:1.1 to 1:2.3. The combination of ethanol volume fraction, reagent solution flow rates and t-mixer tubing ID utilized at this mixing stage has the effect of controlling the particle size of the LNPs between 30 and 300 nm. The resulting LNP suspension is twice diluted into higher pH buffers in the range of 6-8 in a sequential, multi-stage in-line mixing process. For the first dilution, the LNP suspension is mixed with a buffered solution at a higher pH (pH 6-7.5) with a mixing ratio in the range of 1:1 to 1:3 vol:vol, but targeting 1:2 vol:vol. This buffered solution is at a temperature in the range of 15-40 C., targeting 30-40 C. The resulting LNP suspension is further mixed with a buffered solution at a higher pH, e.g, 6-8 and with a mixing ratio in the range of 1:1 to 1:3 vol:vol, but targeting 1:2 vol:vol. This later buffered solution is at a temperature in the range of 15-40 C., targeting 16-25 C. The mixed LNPs are held from 30 minutes to 2 hours prior to an anion exchange filtration step. The temperature during incubation period is in the range of 15-40 C., targeting 30-40 C. After incubation, the LNP suspension is filtered through a 0.8 m filter containing an anion exchange separation step. This process uses tubing IDs ranging from 1 mm ID to 5 mm ID and a flow rate from 10 to 2000 mL/minute. The LNPs are concentrated and diafiltered via an ultrafiltration process where the alcohol is removed and the buffer is exchanged for the final buffer solution such as phosphate buffered saline or a buffer system suitable for cryopreservation (for example containing sucrose, trehalose or combinations thereof). The ultrafiltration process uses a tangential flow filtration format (TFF). This process uses a membrane nominal molecular weight cutoff range from 30-500 KD, targeting 100 KD. The membrane format can be hollow fiber or flat sheet cassette. The TFF processes with the proper molecular weight cutoff retains the LNP in the retentate and the filtrate or permeate contains the alcohol and final buffer wastes. The TFF process is a multiple step process with an initial concentration to a lipid concentration of 20-30 mg/mL. Following concentration, the LNP suspension is diafiltered against the final buffer (for example, phosphate buffered saline (PBS) with pH 7-8, 10 mM Tris, 140 mM NaCl with pH 7-8, or 10 mM Tris, 70 mM NaCl, 5 wt % sucrose, with pH 7-8) for 5-20 volumes to remove the alcohol and perform buffer exchange. The material is then concentrated an additional 1-3 fold via ultrafiltration. The final steps of the LNP manufacturing process are to sterile filter the concentrated LNP solution into a suitable container under aseptic conditions. Sterile filtration is accomplished by passing the LNP solution through a pre-filter (Acropak 500 PES 0.45/0.8 m capsule) and a bioburden reduction filter (Acropak 500 PES 0.2/0.8 m capsule). Following filtration, the vialed LNP product is stored under suitable storage conditions (2 C.-8 C., or 20 C. if frozen formulation).
[0071] In some embodiments, the LNPs of the compositions provided herein have a mean geometric diameter that is less than 1000 nm. In some embodiments, the LNPs have mean geometric diameter that is greater than 50 nm but less than 500 nm. In some embodiments, the mean geometric diameter of a population of LNPs is about 60 nm, 75 nm, 100 nm, 125 nm, 150 nm, 175 nm, 200 nm, 225 nm, 250 nm, 275 nm, 300 nm, 325 nm, 350 nm, 375 nm, 400 nm, 425 nm, 450 nm, or 475 nm. In some embodiments, the mean geometric diameter is between 100-400 nm, 100-300 nm, 100-250 nm, or 100-200 nm. In some embodiments, the mean geometric diameter is between 60-400 nm, 60-350 nm, 60-300 nm, 60-250 nm, or 60-200 nm. In some embodiments, the mean geometric diameter is between 75-250 nm. In some embodiments, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the LNPs of a population of LNPs have a diameter that is less than 500 nm. In some embodiments, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the LNPs of a population of LNPs have a diameter that is greater than 50 nm but less than 500 nm. In some embodiments, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the LNPs of a population of LNPs have a diameter of about 60 nm, 75 nm, 100 nm, 125 nm, 150 nm, 175 nm, 200 nm, 225 nm, 250 nm, 275 nm, 300 nm, 325 nm, 350 nm, 375 nm, 400 nm, 425 nm, 450 nm, or 475 nm. In some embodiments, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the LNPs of a population of LNPs have a diameter that is between 100-400 nm, 100-300 nm, 100-250 nm, or 100-200 nm. In some embodiments, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the LNPs of a population of LNPs have a diameter that is between 60-400 nm, 60-350 nm, 60-300 nm, 60-250 nm, or 60-200 nm.
[0072] In a particular embodiment, the size of the LNPs ranges between about 1 and 1000 nm, preferably between about 10 and 500 nm, more preferably between about 100 to 300 nm, and preferably 100 nm.
Nucleic Acids/Polynucleotides
[0073] DNA of the present disclosure, in some embodiments, are codon optimized. Codon optimization methods are known in the art and may be used as provided herein. Codon optimization, in some embodiments, may be used to match codon frequencies in target and host organisms to ensure proper folding; bias GC content to increase mRNA stability or reduce secondary structures; minimize tandem repeat codons or base runs that may impair gene construction or expression; customize transcriptional and translational control regions; insert or remove protein trafficking sequences; remove/add post translation modification sites in encoded protein (e.g. glycosyIation sites); add, remove or shuffle protein domains; insert or delete restriction sites; modify ribosome binding sites and mRNA degradation sites; adjust translational rates to allow the various domains of the protein to fold properly; or to reduce or eliminate problem secondary structures within the polynucleotide. Codon optimization tools, algorithms and services are known in the artnon-limiting examples include services from GeneArt (Life Technologies), DNA2.0 (Menlo Park Calif.) and/or proprietary methods. In some embodiments, the open reading frame (ORF) sequence is optimized using optimization algorithms.
[0074] In some embodiments, a codon optimized sequence shares less than 95% sequence identity, less than 90% sequence identity, less than 85% sequence identity, less than 80% sequence identity, or less than 75% sequence identity to a naturally-occurring or wild-type sequence.
[0075] In some embodiments, a codon-optimized sequence shares between 65% and 85% (e.g., between about 67% and about 85%, or between about 67% and about 80%) sequence identity to a naturally-occurring sequence or a wild-type sequence. In some embodiments, a codon-optimized sequence shares between 65% and 75%, or about 80% sequence identity to a naturally-occurring sequence or wild-type sequence.
Antigens/Antigenic Polypeptides
[0076] In some embodiments, an antigenic polypeptide includes gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing. A polypeptide may be a single molecule or may be a multi-molecular complex such as a dimer, trimer or tetramer. Polypeptides may also comprise single chain polypeptides or multichain polypeptides, such as antibodies or insulin, and may be associated or linked to each other. Most commonly, disulfide linkages are found in multichain polypeptides. The term polypeptide may also apply to amino acid polymers in which at least one amino acid residue is an artificial chemical analogue of a corresponding naturally-occurring amino acid.
[0077] The genome of Herpes Simplex Viruses (HSV-1 and HSV-2) contains about 85 open reading frames, such that HSV can generate at least 85 unique proteins. HSV glycoprotein C (gC) is a glycoprotein involved in the viral attachment to host cells. gC plays a role in host immune evasion (aka viral immunoevasion) by inhibiting the host complement cascade activation. An HSV vaccine ideally will induce gC specific antibodies that block gC/C3b binding. The HSV glycoprotein C constructs set forth herein as SEQ ID NO: 2-5 are variants with reduced binding to C3 protein and thus are potentially more immunogenic than wildtype gC antigen.
[0078] Glycoprotein B (gB) is a viral glycoprotein involved in the viral cell activity of HSV and is required for the fusion of the HSV envelope with the cellular membrane. An example of an HSV glycoprotein B is set forth in SEQ ID NO: 9. Also described herein in SEQ ID NO: 1 is an HSV glycoprotein B containing the extracellular domain of HSV-2 glycoprotein B fused with the transmembrane and cytoplasmic domains from vesicular stomatitis virus (VSV)-G protein. This construct is designed to improve the HSV gB neutralizing antibody response.
[0079] Glycoprotein D (gD) is an envelope glycoprotein that binds to cell surface receptors and/or is involved in cell attachment via poliovirus receptor-related protein and/or herpes virus entry mediator, facilitating virus entry. An example of an HSV glycoprotein D is set forth in SEQ ID NO: 7.
[0080] In epithelial cells, the heterodimer glycoprotein E (gE)/glycoprotein I (gI) is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. An example of an HSV glycoprotein E is set forth in SEQ ID NO: 13. An example of an HSV glycoprotein I is set forth in SEQ ID NO: 15.
[0081] As used herein, the term immunogenic fragment as used herein refers to fragments which are capable of inducing an immune response to HSV. As a non-limiting example, a soluble ectodomain of glycoprotein E (SgE) is an immunogenic fragment of HSV glycoprotein E, a soluble ectodomain of glycoprotein D (SgD) is an immunogenic fragment of an HSV glycoprotein D, a soluble ectodomain of glycoprotein B (SgB) is an immunogenic fragment of an HSV glycoprotein B, a soluble ectodomain of glycoprotein C (SgC) is an immunogenic fragment of an HSV glycoprotein C, and a soluble ectodomain of glycoprotein I (SgI) is an immunogenic fragment of an HSV glycoprotein I. Non limiting examples of immunogenic fragments are set forth in SEQ ID NOs: 8, 10, 12, 14, and 16.
[0082] As used herein, the term variant is a molecule that differs in its amino acid sequence relative to a native sequence or a reference sequence. Amino acid sequence variants may possess substitutions, deletions, insertions; or a combination of any two or three of the foregoing, at certain positions within the amino acid sequence, as compared to a native sequence or a reference sequence. Ordinarily, variants possess at least 50% identity to a native sequence or a reference sequence. In some embodiments, variants share at least 80% identity or at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with a native sequence or a reference sequence.
[0083] Analogs is meant to include polypeptide variants that differ by one or more amino acid alterations, for example, substitutions, additions or deletions of amino acid residues that still maintain one or more of the properties of the parent or starting polypeptide.
[0084] The present disclosure provides several types of compositions that are polynucleotide or polypeptide based, including variants and derivatives. These include, for example, substitutional, insertional, deletion and covalent variants and derivatives. The term derivative is synonymous with the term variant and generally refers to a molecule that has been modified and/or changed in any way relative to a reference molecule or a starting molecule.
[0085] As such, polynucleotides encoding peptides or polypeptides containing substitutions, insertions and/or additions, deletions and covalent modifications with respect to reference sequences, in particular the polypeptide sequences disclosed herein, are included within the scope of this disclosure. For example, sequence tags or amino acids, such as one or more lysines, can be added to peptide sequences (e.g., at the N-terminal or C-terminal ends). Sequence tags can be used for peptide detection, purification or localization. Lysines can be used to increase peptide solubility onto allow for biotinylation. Alternatively, amino acid residues located at the carboxy and amino terminal regions of the amino acid sequence of a peptide or protein may optionally be deleted providing for truncated sequences. Certain amino acids (e.g., C-terminal residues or N-terminal residues) alternatively may be deleted depending on the use of the sequence, as for example, expression of the sequence as part of a larger sequence that is soluble, or linked to a solid support.
[0086] Substitutional variants when referring to polypeptides are those that have at least one amino acid residue in a native or starting sequence removed and a different amino acid inserted in its place at the same position. Substitutions may be single, where only one amino acid in the molecule has been substituted, or they may be multiple, where two or more (e.g, 3, 4 or 5) amino acids have been substituted in the same molecule.
[0087] As used herein the term conservative amino acid substitution refers to the substitution of an amino acid that is normally present in the sequence with a different amino acid of similar size, charge, or polarity. Examples of conservative substitutions include the substitution of a non-polar (hydrophobic) residue such as isoleucine, valine and leucine for another non-polar residue. Likewise, examples of conservative substitutions include the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, and between glycine and serine. Additionally, the substitution of a basic residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue such as aspartic acid or glutamic acid for another acidic residue are additional examples of conservative substitutions. Examples of non-conservative substitutions include the substitution of a non-polar (hydrophobic) amino acid residue such as isoleucine, valine, leucine, alanine, methionine for a polar (hydrophilic) residue such as cysteine, glutamine, glutamic acid or lysine and/or a polar residue for a non-polar residue.
[0088] As used herein when referring to polypeptides the term domain refers to a motif of a polypeptide having one or more identifiable structural or functional characteristics or properties (e.g., binding capacity, serving as a site for protein-protein interactions).
[0089] As used herein when referring to polypeptides the terms site as it pertains to amino acid based embodiments is used synonymously with amino acid residue and amino acid side chain. As used herein when referring to polynucleotides the terms site as it pertains to nucleotide based embodiments is used synonymously with nucleotide. A site represents a position within a peptide or polypeptide or polynucleotide that may be modified, manipulated, altered, derivatized or varied within the polypeptide-based or polynucleotide-based molecules.
[0090] As used herein the terms termini or terminus when referring to polypeptides or polynucleotides refers to an extremity of a polypeptide or polynucleotide respectively. Such extremity is not limited only to the first or final site of the polypeptide or polynucleotide but may include additional amino acids or nucleotides in the terminal regions. Polypeptide-based molecules may be characterized as having both an N-terminus (terminated by an amino acid with a free amino group (NH2)) and a C-terminus (terminated by an amino acid with a free carboxyl group (COOH)). Proteins are in some cases made up of multiple polypeptide chains brought together by disulfide bonds or by non-covalent forces (multimers, oligomers). These proteins have multiple N- and C-termini. Alternatively, the termini of the polypeptides may be modified such that they begin or end, as the case may be, with a non-polypeptide based moiety such as an organic conjugate.
[0091] As recognized by those skilled in the art, protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of polypeptides of interest. For example, provided herein is any protein fragment (meaning a polypeptide sequence at least one amino acid residue shorter than a reference polypeptide sequence but otherwise identical) of a reference protein having a length of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or longer than 100 amino acids. In another example, any protein that includes a stretch of 20, 30, 40, 50, or 100 (contiguous) amino acids that are 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to any of the sequences described herein can be utilized in accordance with the disclosure. In some embodiments, a polypeptide includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as shown in any of the sequences provided herein or referenced herein. In another example, any protein that includes a stretch of 20, 30, 40, 50, or 100 amino acids that are greater than 80%, 90%, 95%, or 100% identical to any of the sequences described herein, wherein the protein has a stretch of 5, 10, 15, 20, 25, or 30 amino acids that are less than 80%, 75%, 70%, 65% to 60% identical to any of the sequences described herein can be utilized in accordance with the disclosure.
[0092] Polypeptide or polynucleotide molecules of the present disclosure may share a certain degree of sequence similarity or identity with the reference molecules (e.g., reference polypeptides or reference polynucleotides), for example, with art-described molecules (e.g., engineered or designed molecules or wild-type molecules). The term identity, as known in the art, refers to a relationship between the sequences of two or more polypeptides or polynucleotides, as determined by comparing the sequences. In the art, identity also means the degree of sequence relatedness between two sequences as determined by the number of matches between strings of two or more amino acid residues or nucleic acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (e.g., algorithms). Identity of related peptides can be readily calculated by known methods. % identity as it applies to polypeptide or polynucleotide sequences is defined as the percentage of residues (amino acid residues or nucleic acid residues) in the candidate amino acid or nucleic acid sequence that are identical with the residues in the amino acid sequence or nucleic acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity. Methods and computer programs for the alignment are well known in the art. Identity depends on a calculation of percent identity but may differ in value due to gaps and penalties introduced in the calculation. Generally, variants of a particular polynucleotide or polypeptide have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art. Such tools for alignment include those of the BLAST suite (Stephen F. Altschul, et al. (1997). Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402). Another popular local alignment technique is based on the Smith-Waterman algorithm (Smith, T. F. & Waterman, M. S. (1981) Identification of common molecular subsequences. J. Mol. Biol. 147:195-197). A general global alignment technique based on dynamic programming is the Needleman-Wunsch algorithm (Needleman, S. B. & Wunsch, C. D. (1970) A general method applicable to the search for similarities in the amino acid sequences of two proteins. J. Mol. Biol. 48:443-453). More recently, a Fast Optimal Global Sequence Alignment Algorithm (FOGSAA) was developed that purportedly produces global alignment of nucleotide and protein sequences faster than other optimal global alignment methods, including the Needleman-Wunsch algorithm. Other tools are described herein, specifically in the definition of identity below.
[0093] As used herein, the term homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules) and/or between polypeptide molecules. Polymeric molecules (e.g. nucleic acid molecules (e.g. DNA molecules) and/or polypeptide molecules) that share a threshold level of similarity or identity determined by alignment of matching residues are termed homologous. Homology is a qualitative term that describes a relationship between molecules and can be based upon the quantitative similarity or identity. Similarity or identity is a quantitative term that defines the degree of sequence match between two compared sequences. In some, embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical or similar. The term homologous necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences). Two polynucleotide sequences are considered homologous if the polypeptides they encode are at least 50%, 60%, 70%, 80%, 90%, 95%, or even 99% for at least one stretch of at least 20 amino acids. In some embodiments, homologous polynucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. For polynucleotide sequences less than 60 nucleotides in length, homology is determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. Two protein sequences are considered homologous if the proteins are at least 50%, 60%, 70%, 80%, or 90% identical for at least one stretch of at least 20 amino acids.
[0094] Homology implies that the compared sequences diverged in evolution from a common origin. The term homolog refers to a first amino acid sequence or nucleic acid sequence (e.g., gene (DNA or RNA) or protein sequence) that is related to a second amino acid sequence or nucleic acid sequence by descent from a common ancestral sequence. The term homolog may apply to the relationship between genes and/or proteins separated by the event of speciation or to the relationship between genes and/or proteins separated by the event of genetic duplication. Orthologs are genes (or proteins) in different species that evolved from a common ancestral gene (or protein) by speciation. Typically, orthologs retain the same function in the course of evolution. Paralogs are genes (or proteins) related by duplication within a genome. Orthologs retain the same function in the course of evolution, whereas paralogs evolve new functions, even if these are related to the original one.
[0095] The term identity refers to the overall relatedness between polymeric molecules, for example, between polynucleotide molecules (e.g. DNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleic acid sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; each of which is incorporated herein by reference. For example, the percent identity between two nucleic acid sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleic acid sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, H, and Lipman, D., SIAM J Applied Math, 48:1073 (1988); incorporated herein by reference. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al., Nucleic Acids Research, 12, 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al, J. Molec. Biol., 215, 403 (1990)).
Signal Peptides
[0096] In some embodiments, antigenic polypeptides comprise a signal peptide. Signal peptides, comprising the N-terminal 15-60 amino acids of proteins, are typically needed for the translocation across the membrane on the secretory pathway and, thus, universally control the entry of most proteins both in eukaryotes and prokaryotes to the secretory pathway. ER processing produces mature proteins, wherein the signal peptide is cleaved from precursor proteins, typically by a ER-resident signal peptidase of the host cell, or they remain uncleaved and function as a membrane anchor. As referred herein, mature amino acid sequence does not contain the signal peptide sequence.
Methods of Treatment
[0097] Provided herein are compositions (e.g., pharmaceutical compositions), methods, kits and reagents for prevention and/or treatment of HSV virus in humans and other mammals. HSV virus vaccines can be used as therapeutic or prophylactic agents. They may be used in medicine to prevent and/or treat infectious disease. In exemplary aspects, the HSV virus vaccines of the present disclosure are used to provide prophylactic protection from HSV virus. Prophylactic protection from HSV virus can be achieved following administration of an HSV virus vaccine of the present disclosure. Vaccines can be administered once, twice, three times, four times or more. It is possible, although less desirable, to administer the vaccine to an infected individual to achieve a therapeutic response. Dosing may need to be adjusted accordingly.
[0098] In some embodiments, the HSV virus vaccines of the present disclosure can be used as a method of preventing an HSV virus infection in a subject, the method comprising administering to said subject at least one HSV virus vaccine as provided herein. In some embodiments, the HSV virus vaccines of the present disclosure can be used as a method of treating an HSV virus infection in a subject, the method comprising administering to said subject at least one HSV virus vaccine as provided herein. In some embodiments, the HSV virus vaccines of the present disclosure can be used as a method of reducing an incidence of HSV virus infection in a subject, the method comprising administering to said subject at least one HSV virus vaccine as provided herein. In some embodiments, the HSV virus vaccines of the present disclosure can be used as a method of inhibiting spread of HSV virus from a first subject infected with HSV virus to a second subject not infected with HSV virus, the method comprising administering to at least one of said first subject and said second subject at least one HSV virus vaccine as provided herein.
[0099] A method of eliciting an immune response in a subject against an HSV virus is provided in aspects of the invention. The method involves administering to the subject an HSV virus vaccine described herein, thereby inducing in the subject an immune response specific to HSV virus antigenic polypeptide or an immunogenic fragment thereof.
[0100] A prophylactically effective dose is a therapeutically effective dose that prevents infection with the virus at a clinically acceptable level. In some embodiments the therapeutically effective dose is a dose listed in a package insert for the vaccine.
Therapeutic and Prophylactic Compositions
[0101] Provided herein are compositions (e.g., pharmaceutical compositions), methods, kits and reagents for prevention, treatment or diagnosis of HSV in humans and other mammals, for example. HSV virus vaccines can be used as therapeutic or prophylactic agents. They may be used in medicine to prevent and/or treat infectious disease. In some embodiments, the respiratory vaccines of the present disclosure are used for the priming of immune effector cells, for example, to activate peripheral blood mononuclear cells (PBMCs) ex vivo, which are then infused (re-infused) into a subject. In some embodiments, vaccines in accordance with the present disclosure may be used for treatment of HSV.
[0102] HSV virus vaccines may be administered prophylactically or therapeutically as part of an active immunization scheme to healthy individuals or early in infection during the incubation phase or during active infection after onset of symptoms. In some embodiments, the amount of vaccine of the present disclosure provided to a cell, a tissue or a subject may be an amount effective for immune prophylaxis.
[0103] HSV virus vaccines may be administrated with other prophylactic or therapeutic compounds. As a non-limiting example, a prophylactic or therapeutic compound may be an adjuvant or a booster. As used herein, when referring to a prophylactic composition, such as a vaccine, the term booster refers to an extra administration of the prophylactic (vaccine) composition. A booster (or booster vaccine) may be given after an earlier administration of the prophylactic composition. The tune of administration between the initial administration of the prophylactic composition and the booster may be, but is not limited to, 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 6 minutes, 7 minutes, 8 minutes, 9 minutes, 10 minutes, 15 minutes, 20 minutes 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 1 day, 36 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 10 days, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 18 months, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years, 11 years, 12 years, 13 years, 14 years, 15 years, 16 years, 17 years, 18 years, 19 years, 20 years, 25 years, 30 years, 35 years, 40 years, 45 years, 50 years, 55 years, 60 years, 65 years, 70 years, 75 years, 80 years, 85 years, 90 years, 95 years or more than 99 years. In some embodiments, the time of administration between the initial administration of the prophylactic composition and the booster may be, but is not limited to, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 6 months or 1 year.
[0104] In some embodiments, HSV virus vaccines may be administered intramuscularly or intradermally. In some embodiments, HSV virus vaccines are administered intramuscularly.
[0105] HSV virus vaccines may be utilized in various settings depending on the prevalence of the infection or the degree or level of unmet medical need. Vaccines have superior properties in that they produce much larger antibody titers and produce responses early than commercially available anti-viral agents/compositions.
[0106] Provided herein are pharmaceutical compositions including HSV virus vaccines optionally in combination with one or more pharmaceutically acceptable excipients.
[0107] HSV virus vaccines may be formulated or administered alone or in conjunction with one or more other components. For instance, HSV virus vaccines (vaccine compositions) may comprise other components including, but not limited to, adjuvants.
[0108] In some embodiments, HSV vaccines do not include an adjuvant (they are adjuvant free).
[0109] Aluminium has long been shown to stimulate the immune response against co-administered antigens, primarily by stimulating a TH2 response. It is preferred that the aluminium adjuvant of the compositions provided herein is not in the form of an aluminium precipitate. Aluminium-precipitated vaccines may increase the immune response to a target antigen, but have been shown to be highly heterogeneous preparations and have had inconsistent results {see Lindblad E. B. Immunology and Cell Biology 82: 497-505 (2004)). Aluminium-adsorbed vaccines, in contrast, can be preformed in a standardized manner, which is an essential characteristic of vaccine preparations for administration into humans. Moreover, it is thought that physical adsorption of a desired antigen onto the aluminium adjuvant has an important role in adjuvant function, perhaps in part by allowing a slower clearing from the injection site or by allowing a more efficient uptake of antigen by antigen presenting cells.
[0110] The aluminium adjuvant of the present invention may be in the form of aluminium hydroxide (Al(OH).sub.3), aluminium phosphate (AlPO.sub.4), aluminium hydroxyphosphate, amorphous aluminium hydroxyphosphate sulfate (AAHS) or so-called alum (KA1(S04)-12H20) {see Klein et al, Analysis of aluminium hydroxyphosphate vaccine adjuvants by (27)A1 MAS NMR., J. Pharm. Sci. 89(3): 311-21 (2000)). In exemplary embodiments of the invention provided herein, the aluminium adjuvant is aluminium hydroxyphosphate or AAHS. The ratio of phosphate to aluminium in the aluminium adjuvant can range from 0 to 1.3. In preferred embodiments of this aspect of the invention, the phosphate to aluminium ratio is within the range of 0.1 to 0.70. In particularly preferred embodiments, the phosphate to aluminium ratio is within the range of 0.2 to 0.50. APA is an aqueous suspension of aluminum hydroxyphosphate. APA is manufactured by blending aluminum chloride and sodium phosphate in a 1:1 volumetric ratio to precipitate aluminum hydroxyphosphate. After the blending process, the material is size-reduced with a high-shear mixer to achieve a target aggregate particle size in the range of 2-8 m. The product is then diafiltered against physiological saline and steam sterilized. See, e.g., International Patent Application Publication No. WO2013/078102.
[0111] In some embodiments of the invention, the aluminium adjuvant is in the form of AAHS (referred to interchangeably herein as Merck aluminium adjuvant (MAA)). MAA carries zero charge at neutral pH, while AIOH carries a net positive charge and AIPO.sub.4 typically carries a net negative charge at neutral pH.
[0112] One of skill in the art will be able to determine an optimal dosage of aluminium adjuvant that is both safe and effective at increasing the immune response to the targeted antigenic polypeptides. For a discussion of the safety profile of aluminium, as well as amounts of aluminium included in FDA-licensed vaccines, see Baylor et al., Vaccine 20: S18-S23 (2002). Generally, an effective and safe dose of aluminium adjuvant varies from 150 to 600 g/dose (300 to 1200 g/mL concentration). In specific embodiments of the formulations and compositions of the present invention, there is between 200 and 300 g aluminium adjuvant per dose of vaccine. In alternative embodiments of the formulations and compositions of the present invention, there is between 300 and 500 g aluminium adjuvant per dose of vaccine.
[0113] HSV virus vaccines may be formulated or administered in combination with one or more pharmaceutically-acceptable excipients. In some embodiments, vaccine compositions comprise at least one additional active substances, such as, for example, a therapeutically-active substance, a prophylactically-active substance, or a combination of both. Vaccine compositions may be sterile, pyrogen-free or both sterile and pyrogen-free. General considerations in the formulation and/or manufacture of pharmaceutical agents, such as vaccine compositions, may be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference in its entirety). In some embodiments, HSV virus vaccines are administered to humans, human patients or subjects.
[0114] Formulations of the HSV vaccine compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient (e.g., polypeptide or polynucleotide) into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.
[0115] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the disclosure will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100%, e.g., between 0.5 and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active ingredient.
Modes of Vaccine Administration
[0116] HSV vaccines may be administered by any route which results in a therapeutically effective outcome. These include, but are not limited, to intradermal, intramuscular, intranasal and/or subcutaneous administration. The present disclosure provides methods comprising administering vaccines to a subject in need thereof. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. HSV vaccines compositions are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of vaccine compositions may be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
[0117] In some embodiments, HSV vaccines compositions may be administered at dosage levels sufficient to deliver 0.0001 mg/kg to 100 mg/kg, 0.001 mg/kg to 0.05 mg/kg, 0.005 mg/kg to 0.05 mg/kg, 0.001 mg/kg to 0.005 mg/kg, 0.05 mg/kg to 0.5 mg/kg, 0.01 mg/kg to 50 mg/kg, 0.1 mg/kg to 40 mg/kg, 0.5 mg/kg to 30 mg/kg, 0.01 mg/kg to 10 mg/kg, 0.1 mg/kg to 10 mg/kg, or 1 mg/kg to 25 mg/kg, of subject body weight per day, one or more times a day, per week, per month, etc. to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect (see, e.g., the range of unit doses described in International Publication No WO2013078199, the contents of which are herein incorporated by reference in their entirety). The desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, every four weeks, every 2 months, every three months, every 6 months, etc. In some embodiments, the desired dosage may be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations). When multiple administrations are employed, split dosing regimens such as those described herein may be used. In exemplary embodiments, HSV vaccines compositions may be administered at dosage levels sufficient to deliver 0.0005 mg/kg to 0.01 mg/kg, e.g., about 0.0005 mg/kg to about 0.0075 mg/kg, e.g., about 0.0005 mg/kg, about 0.001 mg/kg, about 0.002 mg/kg, about 0.003 mg/kg, about 0.004 mg/kg or about 0.005 mg/kg.
[0118] In some embodiments, HSV vaccine compositions may be administered once or twice (or more) at dosage levels sufficient to deliver 0.025 mg/kg to 0.250 mg/kg, 0.025 mg/kg to 0.500 mg/kg, 0.025 mg/kg to 0.750 mg/kg, or 0.025 mg/kg to 1.0 mg/kg.
[0119] An HSV vaccine pharmaceutical composition described herein can be formulated into a dosage form described herein, such as an intranasal, intratracheal, or injectable (e.g., intravenous, intraocular, intravitreal, intramuscular, intradermal, intracardiac, intraperitoneal, intranasal and subcutaneous).
HSV Virus Vaccine Formulations and Methods of Use
[0120] Some aspects of the present disclosure provide formulations of the HSV vaccine, wherein the vaccine is formulated in an effective amount to produce an antigen specific immune response in a subject (e.g., production of antibodies specific to an HSV antigenic polypeptide). An effective amount is a dose of a vaccine effective to produce an antigen-specific immune response. Also provided herein are methods of inducing an antigen-specific immune response in a subject.
[0121] In some embodiments, the antigen-specific immune response is characterized by measuring an anti-HSV antigenic polypeptide antibody titer produced in a subject administered an HSV vaccine as provided herein. An antibody titer is a measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen (e.g., an HSV antigenic polypeptide) or epitope of an antigen. Antibody titer is typically expressed as the inverse of the greatest dilution that provides a positive result. Enzyme-linked immunosorbent assay (ELISA) is a common assay for determining antibody titers, for example.
[0122] In some embodiments, an antibody titer is used to assess whether a subject has had an infection or to determine whether immunizations are required. In some embodiments, an antibody titer is used to determine the strength of an autoimmune response, to determine whether a booster immunization is needed, to determine whether a previous vaccine was effective, and to identify any recent or prior infections. In accordance with the present disclosure, an antibody titer may be used to determine the strength of an immune response induced in a subject by the HSV vaccine.
[0123] This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways. Also, the phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. The use of including, comprising, or having, containing, involving, and variations thereof herein, is meant to encompass the items listed thereafter and equivalents thereof as well as additional items.
EXAMPLES
Example 1
Preparation of New Antigenic Constructs for HSV Glycoprotein B and HSV Glycoprotein C
[0124] HSV-2 Glycoprotein B Chimeric Construct
[0125] Glycoprotein B (gB) is one of the most conserved glycoproteins encoded by herpes viruses, with homologues in each of the subfamilies, such as HSV, EBV, and CMV. During virus entry, gB functions as a fusogen to mediate the merger of the viral envelope and cellular membrane. gB is also a major target of neutralizing antibodies and CD8+ T cells in naturally infected humans. Given its universal role in virus entry and naturally acquired immunity, gB has been one of the major focuses of vaccine development for CMV and HSV.
[0126] Based on the crystal structure, the recombinantly expressed gB ectodomain likely adopts the postfusion conformation. The prefusion form of gB has not yet been characterized, but may contain more potent neutralizing epitopes that are not present in the postfusion form. A stable and native prefusion gB might therefore enhance the neutralizing antibody responses against virus infection. Recently, it was reported that full extracellular domain of CMV gB fused with the transmembrane and cytoplasmic domains from vesicular stomatitis virus (VSV)-G protein (CMC gB-G) potentially preserved the conformation as prefusion form. Kirchmeir et al., Clin Vaccine Immunol, February 2014 21(2): 174-180. When expressed on the enveloped virus like particles, such chimeric vaccine could elicit neutralizing antibody titers about 10 times higher than those induced by the recombinant postfusion gB. Described herein is the generation of an HSV gB-G construct to improve the HSV gB neutralizing antibody response.
[0127] The extracellular domain of HSV-2 glycoprotein B is fused with the transmembrane and cytoplasmic domains from vesicular stomatitis virus (VSV)-G protein, and the sequence of such construct is set forth in SEQ ID NO:1 in Table 1. The HSV-2 glycoprotein corresponds to amino acids 1-768 of SEQ ID NO:1 and the cytoplasmic domain from VSV-G protein corresponds to amino acids 769-812 of SEQ ID NO: 1.
[0128] HSV-2 Glycoprotein C Construct
[0129] HSV gC protein binds human plasma protein C3 and C3B as a mechanism of immune evasion by blocking complement activation. An HSV vaccine would ideally induce gC specific antibodies that block gC/C3b binding. The wildtype HSV glycoprotein C is masked by C3 proteins in plasma and weakly immunogenic. The variant gC antigens described in Table 2 have reduced binding to C3 protein and are thus potentially more immunogenic than wildtype gC antigen.
TABLE-US-00001 TABLE1 AntigenicPolypeptideSequences SEQ Name Sequence IDNO: MRK_HSV-2gB-G1 MRCTGGLVCALVVGALVAAVASAAPAAPRASGGVAAT 1 VSV-Gprotein VAANGGPASQPPPVPSPATTKARKRKTKKPPKRPEATPP aminoacidsequence PDANATVAAGHATLRAHLREIKVENADAQFYVCPPPIG isunderlined ATVVQFEQPRRCPTRPEGQNYTEGIAVVEKENIAPYKEK ATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVI DKINAKGVCRSTAKYVRNNMETTAFFIRDDHETDMELK PAKVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIV EEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEH TSYAADRFKQVDGFYARDLTTKARATSPTTRNLLTTPK FTVAWDWVPKRPAVCTMTKWQEVDEMLRAEYGGSFR FSSDAISTTFTTNLTQYSLSRVDLGDCIGRDAREAIDRMF ARKYNATHIKVGQPQYYLATGGFLIAYQPLESNTLAEL YVREYMREQDRXPRNATPAPLREAPSANASVERIKTTSS IEFARLQFTYNHIQRHVNDMLGRIAVAWCELQNHELTL WNEARKLNPNAIASATVGRRVSARMLGDVMAVSTCVP VAPDNVIVQNSMRVSSRPGTCYSRPLVSFRYEDQGPLIE GQLGENNELRLTRDALEPCTVGHRRYFIFGGGYVYFEE YAYSHQLSRADVTTVSTFIDLNITMLEDHEFVPLEVYTR HEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIRADANA AMFAGLCAFFEGMGDLGRAVGKVVMGVVGGVVSAVS GVSSFMSNPFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKRQI YTDIEMNRLGK MRK_HSV-2gC_DX_ MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 2 W3687A RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVTSAAVGG QGPPRTFTCQLTWHRDSVSFSRRNASGTASVLPRPTITM EFTGDHAVCTAGCVPEGVTFAAFLGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLE HHGSHQPPPRDPTERQVIRAVEGAGIGVAVLVAVVLAG TAVVYLTHASSVRYRRLR MRK_HSV-2gC_DX MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 3 D323A RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVESAAVGG QGPPRTFTCQLTWHRASVSFSRRNASGTASVLPRPTITM EFTGDHAVCTAGCVPEGVTFAWFLGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLE HHGSHIQPPPRDPTERQVIRAVEGAGIGVAVLVAVVLAG TAVVYLTHASSVRYRRLR MRK_HSV-2gC_DX_ MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 4 F327A RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVTSAAVGG QGPPRTFTCQLTWHRDSVSASRRNASGTASVLPRPTITM EFTGDHAVCTAGCVPEGVTFAWELGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLE HHGSHQPPPRDPTERQVIRAVEGAGIGVAVLVAVVLAG TAVVYLTHASSVRYRRLR MRK_HSV-2gC_DX_ MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 5 S333A RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVTSAAVGG QGPPRTFTCQLTWHRDSVSFSRRNAAGTASVLPRPTITM EFTGDHAVCTAGCVPEGVTFAWFLGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLE HHGSHQPPPRDPTERQVIRAVEGAGIGVAVLVAVVLAG TAVVYLTHASSVRYRRLR
TABLE-US-00002 TABLE2 DNASequences Name Sequence SEQIDNO: MRK_HSV-2gB-GI TCAAGCTTTTGGACCCTCGTACAGAAGCTAATACGAC 6 TCACTATAGGGAAATAAGAGAGAAAAGAAGAGTAAG AAGAAATATAAGAGCCACCATGAGAGGCGGCGGCCT TGTGTGCGCCCTAGTGGTGGGAGCCCTTGTGGCCGCC GTAGCAAGCGCCGCCCCTGCGGCCCCAAGAGCCAGC GGCGGCGTGGCAGCAACAGTTGCCGCTAACGGCGGC CCAGCCAGCCAGCCTCCTCCAGTGCCTAGCCCAGCTA CCACCAAGGCCAGAAAGAGAAAGACCAAGAAGCCTC CTAAGCGTCCTGAGGCCACCCCACCACCAGACGCCAA TGCGACCGTGGCCGCAGGCCACGCCACCCTGAGAGC CCACCTGAGAGAGATCAAGGTGGAGAACGCCGACGC CCAGTTCTACGTGTGTCCTCCGCCTACCGGTGCAACA GTGGTGCAGTTCGAGCAGCCTAGAAGATGCCCTACCC GACCAGAGGGTCAGAACTACACCGAGGGCATCGCCG TGGTGTTCAAGGAGAACATCGCCCCTTACAAGTTCAA GGCCACCATGTACTACAAGGACGTGACCGTGAGCCA GGTGTGGTTCGGCCACAGATACAGCCAGTTCATGGGC ATCTTCGAGGACAGAGCCCCAGTACCTTTCGAGGAGG TGATCGACAAGATCAACGCCAAGGGCGTGTGCAGAA GCACCGCCAAGTACGTGAGAAACAACATGGAGACAA CCGCCTTCCACAGAGACGACCACGAAACCGACATGG AGCTGAAGCCTGCCAAGGTGGCCACCAGAACCAGCA GAGGCTGGCACACCACCGACCTGAAGTACAACCCTA GCAGAGTGGAGGCGTTCCACCGATACGGCACCACCG TGAACTGCATCGTGGAAGAGGTCGACGCCAGAAGCG TGTACCCTTACGACGAGTTCGTGCTGGCCACCGGCGA CTTCGTGTACATGAGCCCTTTCTACGGCTACAGAGAG GGCAGCCACACCGAGCACACCAGCTACGCCGCCGAC AGATTCAAGCAAGTTGACGGCTTCTACGCCCGGGATC TTACAACTAAGGCTAGAGCAACTAGCCCTACTACTAG GAACCTGCTTACTACCCCTAAGTTCACAGTGGCCTGG GACTGGGTGCCTAAGAGGCCTGCCGTGTGCACCATGA CCAAGTGGCAGGAAGTCGACGAGATGCTTCGCGCAG AGTACGGCGGCAGCTTCAGATTCAGCAGCGACGCCAT CAGCACCACCTTCACCACAAACCTGACCCAGTACAGC CTGTCTCGAGTCGACCTGGGCGATTGTATCGGCAGAG ATGCAAGAGAGGCCATCGACAGAATGTTCGCCAGGA AGTATAACGCTACCCACATTAAGGTGGGTCAGCCACA GTACTACCTAGCAACTGGCGGCTTCCTGATCGCCTAC CAGCCTCTGCTGAGCAACACCCTGGCCGAGCTCTACG TACGGGAATATATGAGAGAGCAGGACAGAAAGCCAA GGAACGCAACTCCTGCCCCTCTGAGGGAAGCTCCTAG CGCCAACGCCAGCGTGGAGAGAATCAAGACCACCAG CAGCATCGAATTCGCCCGGCTGCAGTTCACCTACAAC CACATCCAGAGACACGTGAACGACATGCTGGGCAGA ATCGCTGTGGCTTGGTGCGAGCTGCAGAACCACGAGC TGACCCTGTGGAACGAGGCGCGCAAGCTGAACCCTA ACGCCATCGCCTCCGCCACCGTGGGTAGGAGAGTGA GCGCCAGAATGCTCGGAGATGTGATGGCCGTGAGCA CCTGCGTGCCTGTGGCCCCTGACAACGTGATCGTGCA GAACAGCATGCGGGTTAGCAGCAGACCTGGCACCTG CTACTCACGACCTCTGGTGTCATTCAGATACGAGGAC CAGGGCCCTCTGATCGAAGGACAGTTGGGCGAGAAC AACGAGCTTAGACTGACCCGTGATGCGCTGGAGCCTT GTACCGTGGGACATCGAAGATACTTCATCTTCGGAGG TGGATACGTGTATTTCGAAGAATACGCCTACAGTCAT CAGCTTTCTCGAGCCGATGTGACTACCGTGAGTACCT TCATCGATCTTAACATCACCATGCTGGAGGATCATGA ATTCGTGCCTCTGGAGGTGTACACCAGACACGAGATT AAGGATTCTGGACTTCTGGACTATACCGAAGTGCAGA GAAGAAACCAGCTGCACGACCTGAGATTCGCCGACA TCGACACCGTGATCAGGGCAGATGCTAACGCAGCCAT GTTCGCAGGCCTGTGCGCCTTCTTCGAAGGCATGGGC GATCTAGGACGGGCCGTTGGAAAGGTGGTGATGGGC GTGGTCGGCGGAGTTGTAAGTGCTGTGTCTGGCGTTT CCTCATTCATGAGCAACCCTTTCTTCTTCATCATCGGC CTGATCATAGGATTGTTCCTGGTCCTCCGAGTGGGCA TCCACCTGTGCATCAAGTTGAAGCATACTAAGAAGAG ACAGATTTATACGGACATTGAGATGAACAGACTGGG CAAGTGATAATAGGCTGGAGCCTCGGTGGCCATGCTT CTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTT CCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCT GAGTGGGCGGC
Example 2
Combination Vaccines
[0130] A study was conducted in mice to confirm that combinations of mRNA antigens can elicit appropriate immune responses against each vaccine component. Each vaccine antigen was administered at an equivalent dose (2 ug), so that the effect of additional antigens were not confounded by dose differences. Doses of LNPs were increased with additional mRNA antigens, aiming to maintain the same lipid to nucleic acid ratio in each group.
TABLE-US-00003 Vaccine Dose/mouse Group Number (MC3 formulation) (g) 1 15 gD 2 1 15 gD + gC 4 (2 of each antigen) 3 15 gD + gC + gE 6 (2 of each antigen) 4 15 gD + gC + gE + gI 8 (2 of each antigen) 5 15 gD + gC + gE + gI + 10 (2 ofeach gB antigen) 6 15 gD + gC + gE + gB 8 (2 of each antigen) 7 15 MC3 N/A
[0131] Female Balb/c (CRL) mice (6-8 weeks old; N=15 mice per group) were administered with 10 g or 2 g per mouse mRNA vaccines. The mRNA vaccines were generated and formulated in MC3 lipid nanoparticles. The animals were immunized on day 0 and day 21 of the experiment. On day 35, blood was drawn from each animal and tested by ELISA for binding to HSV antigens. On day 40, four animals from each group were sacrificed for spleen collection.
[0132] ELISA assays: Immulon 2HB microtiter plates (NUNC) were coated with 50 l HSV antigens per well at a concentration of 2.0 g/ml in PBS and incubated at 4 C. overnight. The plates were then washed and blocked for 1 h with PBST containing 3% milk at room temperature. Test samples were serially diluted 4-fold in blocking buffer starting at 1:100 dilution, transferred to the antigen coated plates, and incubated for 2 h at room temperature. Following three washes with PBST, goat anti-mouse IgG-HRP diluted to 1:2000 in blocking buffer was added to the plates, and incubated for an additional 1 h at room temperature. Plates were washed again and developed with SuperBlu Turbo TMB in the dark. The reaction was stopped after 5 minutes and absorbance was read at 450 nm on a VersaMax ELISA microplate reader. Titers are reported as the reciprocal of the last dilution that is 2 fold greater than the background.
[0133] Cytokine Production Assay: Three weeks post final immunization, four animals from each group were sacrificed for spleen collection. Spleens from each group were pooled and processed to isolate splenocytes. One million splenocytes/well were incubated with 2 g/ml of specific peptide pools (15mer overlapping by 11, custom order JPT Peptide Solns, Germany) for HSV-2 gC, HSV-2 gD, HSV-2 gE, and HSV-2 gB in the presence of brefeldin A, anti-mouse CD28 and CD49b antibodies. As a negative control, a sample for each was set up with a matched volume of DMSO and costimulatory antibodies. Five hours post incubation at 37 C., splenocytes were incubated with mouse FC block, surface stained with viability dye, anti-mouse-CD3, CD4 and CD8 followed by permeabilization and intracellular staining for anti-mouse IFN, TNF, IL-2. Fixed samples were then run on FACS LSRII flow cytometer (BD Biosciences) and data were analyzed using FlowJo software (Treestar Inc.). All peptide stimulated responses were reported after subtraction of the unstimulated controls.
[0134] Results: Vaccines containing multiple antigens are immunogenic. As shown in
[0135] Functional immune responses were also induced in multivalent vaccines. As shown in
[0136] As observed in earlier studies, inclusion of gC mRNA antigen elicits antibody responses capable of blocking the binding of C3B complement by gC. In this study, all groups receiving gC antigen produced C3B/gC blocking antibodies, although the group receiving the pentavalent combination had significantly lower competition titers than the group receiving gD+gC. This decrease in antibodies capable of blocking C3B/gC does not appear to affect either antigen binding ELISA titers or SNA titers against HSV-1 or HSV-2.
[0137] Cellular immune responses for certain antigens are also slightly lower in combination vaccines (when compared to previous results of antigen being administered alone). CD4+ T cell responses are lower for gE and gB antigens, but are unaffected for gD and gC; while CD8+ T cell responses are statistically lower for gC and gB antigens, but gE specific CD8+ cells are unaffected (gD specific CD8+ T cells are near background levels).
Example 3
Antigen Combinations and Neutralizing Antibodies
[0138] To identify the most immunogenic HSV-2 mRNA antigen combinations and to determine the durability of immune responses against mRNA antigens, eight mRNA combinations were further evaluated in the guinea pig model. Guinea pigs (6 each per group) were administered intramuscularly with 20 g HSV2 mRNA each at week 0, 4, and 8. The animals were bled two weeks after each vaccination.
TABLE-US-00004 Dose/guinea Group Number Vaccine pig (g) 1 6 gD (LNP 1) 20 2 6 gD (MC3 LNP) 20 3 6 gD + gC (MC3 40 (20 + 20) LNP) 4 6 gD + gC + gE + gI 80 (20 + 20 + 20 + (MC3 LNP) 20) 5 6 gD + gC + gE + gI + 100 (20 + 20 + gB (MC3 LNP) 20 + 20 + 20) 6 6 gD + gC + gE + gB 80(20 + 20 + 20 + (MC3 LNP) 20) 7 6 gD + gB (MC3 40(20 + 20) LNP) 8 6 gD + gC + SgE + gB 80(20 + 20 + 20 + (MC3 LNP) 20) 9 6 gD + gC + gB (MC3 60(20 + 20 + 20) LNP) 10 6 gD + gE + gI + gB 80(20 + 20 + 20 + (MC3 LNP) 20) 11 6 MC3 LNP control N/A
[0139] The EC10 ELISA titers for all antigens reach to around 10.sup.6 at day 42 except for gI which reaches 10.sup.6 at around day 70. ELISA titers for all antigens start to go down at day 112. There is very little difference in ELISA titers by group.
[0140] NT50 titers (Neutralizing) peak at day 42 with gD, gD+gC, gD+gC+gE+gI groups reaching around 10.sup.4 and the multiple antigen groups containing gB reaching near 10.sup.6 with complement. As shown in
[0141] As shown in
Example 4
C3 Binding Studies
[0142] The HSV glycoprotein C constructs set forth herein as SEQ ID NO: 2-5 are variants which exhibit reduced binding to C3. Wild type and mutant gC2 constructs expressed on BEK293T cells were tested for reactivity with two anti-gC2 mAbs and purified human complement proteins C3 and C3b. The binding activity was measured on an Intellicyt high-throughput flow cytometer. As shown in
Example 5
Evaluation of Efficacy of HSV2 mRNA Vaccines Against Genital HSV-2 Challenge in the Guinea Pig Model
[0143] Nave female Hartley guinea pigs (Charles River Laboratories) were treated with vehicle and vaccine at the following time points (day 0, day 28, and day 56) as follows:
TABLE-US-00005 Dose/guinea Group Number Vaccine pig (g) 1 18 Vehicle 20 (LNP) 2 12 gD2 protein + MPL/ 20 alum 3 12 gD + gB 40 (20 + 20) 4 12 gD + gB + gC 60 (20 + 20 + 20) 5 12 gD + gB + gC + SgE 8-(20 + 20 + 20 + 20)
[0144] Group 3 corresponds to a positive vaccine control. Groups 3-4 correspond to mRNA LNP formulation containing the specified antigen formulated in a LNP. Genital lesions were scored on days 78-118. At day 118, the animals were sacrificed and the dorsal root ganglia and spleen were collected. The animals were challenged with 510.sup.5 PFU HSV-2 strain MS on day 77. HSV-2 neutralization assays, with and without complement, were performed on sera from groups 2-5 and from 6 animals in group 1.
[0145] HSV Neutralization Titers: Serum bleeds were conducted at days 4, 14, 42, and 70. The neutralizing antibody titers were determined on vero cells with or without complement as described below.
[0146] Vero cells were seeded at 310.sup.5 (310.sup.4 cells/well) into 96 well flat-bottomed plates and incubated overnight to achieve confluent monolayers. Four-fold serial dilutions of the heat inactivated serum samples were prepared in 199 medium starting at 1:40 dilution. The complement dependent neutralization activities were measure by diluting heat inactivated sera in a 199 medium containing 5% baby rabbit complement. Fifty microliter of diluted serum was added to 96-well plates and mixed with 200 PFU of HSV2 MS strain in 100 l total volume. The virus/antibody mixture was incubated for 1 h at 37 C. Following incubation, fifty microliter of the virus/antibody mixture was added to Vero cells. The plates were incubated for 24 h at 37 C. The cells were then fixed with 3.7% formaldehyde in PBS for 10 min, and washed twice with 100 ul/well of 0.1% Triton X-100/PBS, and four times with 150 ul/well of PBS/0.1% Tween-20. HSV2 infected cells were then immunostained with rabbit anti-HSV polyclonal antibody. Briefly, a HSV2 polyclonal antibody was diluted at 1:400 in blocking buffer, and then added to the test plates with fixed cells and incubated for 1 h at room temperature. After washing, Alexafluor 488 anti-rabbit IgG diluted at 1:400 was added and incubated for 1 h. The plates were washed again and the signal was read on Perkin Elmer Envision at 488 nm. To determine neutralizing titers (NT50), data is transformed to % neutralization using the below equation.
% Neutralization=(1((sample readingcell control)/(sample readingcell control))*100
[0147] Vaginal Lesions: Guinea pigs (n=12 or 18/group) were scored daily for 19 days after vaginal challenge with HSV-2 strain MS (510.sup.5PFU) using the follow vaginal lesion scoring system: 0=no disease, 0.5=redness OR swelling of <50% of the vagina, 1=redness OR swelling of 50% of the vagina, 1.5=redness AND swelling of 50% of the vagina, 2=1 to 5 non-coalesced (coalesced=individual lesions that have combined together to form a larger lesion) lesions on the external genital skin, 2.5=1 to 5. lesions including at least 1 coalesced lesion on the external genital skin, 3=6 non-coalesced lesions on the external genital skin, 3.5=6 lesions including at least 1 coalesced lesion on the external genital skin, 4=any number of ulcerated (ulcerated=a lesion where the top white portion has been lost leaving an open lesion) or necrotic (necrotic=a lesion where the top white portion has been lost leaving a blackened area on the lesion) lesions on the external genital skin. Daily scores for each group (n=5) were averaged and plotted as meanstandard error.
[0148] Vaginal Swabs: Vaginal swabs were collected two days post vaginal challenge and placed into 1.5 mL tubes with 0.6 mL of DMEM with 5% FBS and gentamicin and frozen until further processing. Viral load was determined by Plaque assay and PCR. For the plaque assay 24 well tissue culture plates were seeded with Vero cells at 510{circumflex over ()}5 cells per well and grown overnight at 37 C., 5% CO.sub.2. The following day, vaginal swab samples were thawed in a 37 C. water bath, vortexed for 10 seconds and then serially diluted 1:10 in Serum-free William's E medium, containing 2 mM L-glutamine and 50 g/ml Neomycin (SFMM). Samples were tested at Neat, 1:10 and 1:100 dilutions. Media was aspirated from 24 well plates and cells were washed with 1 ml of SFMM. SFMM wash was aspirated and 75 l of sample was added to wells and plates were incubated at 37 C., 5% CO.sub.2 for 1 hour with manual rocking every 15 minutes. After 1 hour incubation, samples were aspirated from wells and 1 ml of 0.75% Methyl Cellulose (4000 cPs) in William's E medium containing 1.6% FBS, 2 mM L-glutamine and 50 g/ml Neomycin, was added to each well. Plates were incubated at 37 C., 5% CO.sub.2 for 3 days. Methyl cellulose was aspirated, cells were washed with 1 ml PBS and cells were fixed and stained with 5% glutaric dialdehyde containing crystal violet for 1 hour. Stain was then aspirated, cells were washed with 1 ml H.sub.2O, plates were allowed to air dry and plaques were counted. For PCR, DNA was extracted using Qiagen blood and tissue DNA extraction kit. A 112 bp HSV2 gB DNA fragment was quantified by real time PCR.
[0149] Tissue Analysis: Dorsal root ganglia (DRG) from each surviving guinea pig were collected 48 days post HSV-2 challenge. The DRG DNA was extracted using Qiagen blood and tissue DNA extraction kit.
Results:
HSV Neutralization Titers
[0150]
Vaginal Lesions
[0151] As shown in
Vaginal Swabs
[0152]
Tissue Analysis
[0153]
Example 6
Mutated HSV-c Constructs and Neutralizing Antibodies
[0154] Female Balb/C (CRL) mice (16/group) were administered 2 ug per mouse of vehicle (LNP only) of mRNA vaccine formulated in an LNP.
TABLE-US-00006 Group Vaccine (mRNA Dose per (N = 16 formulated mouse Challenge per in LNP) (Delivered by Dose (delivered group) (2 g per mouse) IM injection) intravaginally) 1 LNP only (Vehicle) 2 g 9 10.sup.4 pfu of HSV-2 2 gC2 2 g 9 10.sup.4 pfu of HSV-2 3 gC2 D323 2 g 9 10.sup.4 pfu of HSV-2 4 gC2 F327A 2 g 9 10.sup.4 pfu of HSV-2 5 gC2 S333A 2 g 9 10.sup.4 pfu of HSV-2 6 gC2 W368A 2 g 9 10.sup.4 pfu of HSV-2
[0155] Animals were immunized on day 0 and day 21. On day 35 blood was drawn from each animal to determine (i) HSV-2 neutralizing antibody titers and (ii) c3b binding competition antibodies titers. In addition, on day 35 four animals from each group were sacrificed for spleen collection. On day 42 animals were injected subcutaneously with 2 mg medoxyprogesterone (Depo-Provera; Pfizer, Inc., New York, N.Y.) on DAY 49 animals were challenged with 910{circumflex over ()}4 PFU of HSV2 MS strain. On days 50-63 HSV2 disease progression was monitored daily. Vaginal swabs were collected on days 51 and 54 (i.e., day 2 and day 4 post HSV-2 challenge). Animals were sacrificed and dorsal root ganglia were collected on day 63 (i.e., 2 weeks post HSV-2 challenge).
[0156] HSV-2 Neutralization Titers were determined as described above in Example 5.
[0157] C3b binding competition antibodies induced by gC2 wild type and c3b binding mutants c3b binding competition antibodies titers were determined by Alphalisa assay.
[0158] Testing samples were serially diluted first, then 10 ul per well of rgC2 (Merck) conjugated with acceptor beads (Perkin Elmer) at concentration of 150 ug/ml were added in area of 96 well assay plate (Perkin Elmer). Then 10 ul per well of series diluted samples were transferred into the assay plate that containing the rgC2 with acceptor beads, followed by a 30 minute incubation. 10 ul of biotinylated (Perkin Elmer) human C3b (Complement Technology) at concentration of 15 nm were added and followed by a 60 minute incubation. Streptavidin donor beads (Perkin Elmer) at concentration of 20 ug/ml were added with final 30 minute incubation before reading the plate. Plate was read at EnSight machine (Perkin Elmer). Data were analyzed in GraphPad Prism and % inhibition (Y-axis) was plotted against the log transformed serum dilution and the IC50 were calculated using 4-parameter curve-fitting. The competition titers are expressed as IC50, the serum dilution at which gC2/C3b binding is inhibited by 50%
[0159] Cytokine production assay was performed substantially as described in Example 2.
[0160] Vaginal Swabs were collected at day 2 and 4 post HSV-2 challenge and _placed into 1.5 mL tubes with 0.6 mL of DMEM with 5% FBS and gentamicin and frozen until further processing. The viral load of the vaginal swabs was determined by plaque assay as described in Example 5.
[0161] Results:
[0162]
TABLE-US-00007 Mean Time to Clinical Incidence Mean Survival Survival Group Signs SE (days) % Time SE (days) % 1 5.6 0.3 92 9.0 0.3 17 2 7.3 0.7 25 11 92 3 7.3 0.3 25 13 92 4 6.4 0.4 42 12.5 0.5 83 5 7.4 0.7 42 11 92 6 6.8 0.7 42 11.7 0.7 75
Example 7
[0163] Female Balb/C (CRL) mice (16/group) were administered 2 ug per mouse of vehicle (LNP only) of mRNA vaccine formulated in an LNP.
TABLE-US-00008 Group Dose of mRNA (N = 16 per mouse Challenge Dose per Vaccine (mRNA (Delivered by (delivered group) formulated in LNP) IM injection) intravaginally) 1 LNP only (Vehicle) 9 10.sup.4 pfu of HSV-2 2 gD 2 g 9 10.sup.4 pfu of HSV-2 3 gD + gB + gC2-F327A 2 g + 2 g + 9 10.sup.4 pfu of HSV-2 2 g
[0164] Animals were immunized on day 0 and day 21. On day 35, blood was drawn from each animal to determine HSV-2 neutralizing antibody titers. In addition, on day 35 four animals from each group were sacrificed for spleen collection. On day 42 animals were injected subcutaneously with 2 mg medoxyprogesterone (Depo-Provera; Pfizer, Inc., New York, N.Y.), on DAY 49 animals were challenged with 910{circumflex over ()}4 PFU of HSV2 MS strain. On days 50-63 disease development was monitored daily. Vaginal swabs were collected on days 51 and 54 (i.e., day 2 and day 4 post HSV-2 challenge). HSV-2 Neutralization Titers were determined as described above in Example 5. As shown in
TABLE-US-00009 TABLE3 HSVAminoAcidSequences Name Sequence SEQIDNO: MRK_HSV-2gD, MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKM 7 SQ-32180 ADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQP PSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARK HTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPI RTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRL VKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKA YQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKP PYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTV SSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLA VLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPL FY MRK_HSV-2SgD, MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKM 8 SQ-032172 ADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQP PSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARK HTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPI RTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRL VKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKA YQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKP PYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTV SSQIPPNWHIPSIQDVAPHHAPAAPSNP MRK_HSV-2gB, MRGGGLVCALVVGALVAAVASAAPAAPRASGGVAAT 9 SQ-032178 VAANGGPASQPPPVPSPATTKARKRKTKKPPKRPEATPP PDANATVAAGHATLRAHLREIKVENADAQFYVCPPPTG ATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFK ATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVI DKINAKGVCRSTAKYVRNNMETTAFHRDDHETDMELK PAKVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIV EEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEH TSYAADRFKQVDGFYARDLTTKARATSPTTRNLLTTPK FTVAWDWVPKRPAVCTMTKWQEVDEMLRAEYGGSFR FSSDAISTTFTTNLTQYSLSRVDLGDCIGRDAREAIDRMF ARKYNATHIKVGQPQYYLATGGFLIAYQPLLSNTLAEL YVREYMREQDRKPRNATPAPLREAPSANASVERIKTTSS IEFARLQFTYNHIQRHVNDMLGRIAVAWCELQNHELTL WNEARKLNPNAIASATVGRRVSARMLGDVMAVSTCVP VAPDNVIVQNSMRVSSRPGTCYSRPLVSFRYEDQGPLIE GQLGENNELRLTRDALEPCTVGHRRYFIFGGGYVYFEE YAYSHQLSRADVTTVSTFIDLNITMLEDHEFVPLEVYTR HEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIRADANA AMFAGLCAFFEGMGPLGRAVGKVVMGVVGGVVSAVS GVSSFMSNPFGALAVGLLVLAGLVAAFFAFRYVLQLQR NPMKALYPLTTKELKTSDPGGVGGEGEEGAEGGGFDEA KLAEAPREMIRYMALVSAMERTEHKARKKGTSALLSSK VTNMVLRKRNKARYSPLHNEDEAGDEDEL MRK_HSV-2SgB, MRGGGLVCALVVGALVAAVASAAPAAPRASGGVAAT 10 SQ-032210 VAANGGPASQPPPVPSPATTKARKRKTKKPPKRPEATPP PDANATVAAGHATLRAHLREIKVENADAQFYVCPPPTG ATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFK ATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVI DKINAKGVCRSTAKYVRNNMETTAFHRDDHETDMELK PAKVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIV EEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEH TSYAADRFKQVDGFYARDLTTKARATSPTTRNLLTTPK FTVAWDWVPKRPAVCTMTKWQBVDEMLRAEYGGSFR FSSDAISTTFTTNLTQYSLSRVDLGDCIGRDAREAIDRMF ARKYNATHIKVGQPQYYLATGGFLIAYQPLLSNTLAEL YVREYMREQDRKPRNATPAPLREAPSANASVERIKTTSS IEFARLQFTYNHIQRHVNDMLGRIAVAWCELQNHELTL WNEARKLNPNAIASATVGRRVSARMLGDVMAVSTCVP VAPDNVIVQNSMRVSSRPGTCYSRPLVSFRYEDQGPLIE GQLGENNELRLTRDALEPCTVGHRRYFIFGGGYVYFEE YAYSHQLSRADVTTVSTFIDLNITMLEDHEFVPLEVYTR HEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIRADANA AMFAGLCAFFEGMGDLGRAVGKVVMGVVGGVVSAVS GVSSFMSNP MRK_HSV-2gC, MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 11 SQ-032179 RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVTSAAVGG QGPPRTFTCQLTWHRDSVSFSRRNASGTASVLPRPTITM EFTGDHAVCTAGCVPEGVTFAWFLGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLE HHGSHQPPPRIDPTERQVIRAVEGAGIGVAVLVAVVLAG TAVVYLTHASSVRYRRLR MRK_HSV-2SgC, MALGRVGLAVGLWGLLWVGVVVVLANASPGRTITVGP 12 SQ-032835 RGNASNAAPSASPRNASAPRTTPTPPQPRKATKSKASTA KPAPPPKTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFP NSTRTESRLQIWRYATATDAEIGTAPSLEEVMVNVSAPP GGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPL GRQRLIIEELTLETQGMYYWVWGRTDRPSAYGTWVRV RVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFV WFEDGRRVFDPAQIHTQTQENPDGFSTVSTVTSAAVGG QGPPRTFTCQLTWHRDSVSFSRRNASGTASVLPRPTTTM EFTGDHAVCTAGCVPEGVTFAWFLGDDSSPAEKVAVAS QTSCGRPGTATIRSTLPYVSYEQTEYICRLAGYPDGIPVLE HHGSHQPPPRDPTERQVIRAVEG MRK_HSV-2gE MARGAGLVFFVGVWVVSCLAAAPRTSWKRVTSGEDV 13 SQ-032181 VLLPAPAGPEERTRAHKLLWAAEPLDACGPLRPSWVAL WPPRRVLETVVDAACMRAPEPLAIAYSPPFPAGDEGLY SELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSD EARQVASVVLVVEPAPVPTPTPDDYDEEDDAGVSERTP VSVPPPTPPRRPPVAPPTHPRVIPEVSHVRGVTVHMETPE AILFAPGETFGTNVSIHAIAHDDGPYAMDVVWMRFDVP SSCAEMRIYEACLYHPQLPECLSPADAPCAVSSWAYRL AVRSYAGCSRTTPPPRCFAEARMEPVPGLAWLASTVNL EFQHASPQHAGLYLCVVYVDDHIHAWGHMTISTAAQY RNAVVEQHLPQRQPEPVEPTRPHVRAPPPAPSARGPLRL GAVLGAALLLAALGLSAWACMTCWRRRSWRAVKSRA SATGPTYIRVADSELYADWSSDSEGERDGSLWQDPPER PDSPSTNGSGFEILSPTAPSVYPHSEGRKSRRPLTTFGSGS PGRRHSQASYSSVLW MRK_HSV-2SgE, MARGAGLVFFVGVWVVSCLAAAPRTSWKRVTSGEDV 14 SQ-032211 YLLPAPAGPEERTRAHKLLWAAEPLDACGPLRPSWVAL WPPRRVLETVVDAACMRAPEPLAIAYSPPFPAGDEGLY SELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSD EARQVASVVLVVEPAPVPTPTPDDYDEEDDAGVSERTP VSVPPPTPPRRPPVAPPTHPRVIPEVSHVRGVTVHMETPE AILFAPGETFGTNVSIHAIAHDDGPYAMDVVWMRFDVP SSCAEMRIYEACLYHPQLPECLSPADAPCAVSSWAYRL AVRSYAGCSRTTPPPRCFAEARMEPVPGLAWLASTVNL EFQHASPQHAGLYLCVVYVDDHIHAWGHMTISTAAQY RNAVVEQHLPQRQPEPVEPTRPHVRAPPPAPSARGPLR MRK_HSV-2gI, MPGRSLQGLAILGLWVCATGLVVRGPTVSLVSDSLVDA 15 SQ-032182 GAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELF HYPLGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAH SPAYPTLELGLARQPLLRVRTATRDYAGLYVLRVWVGS ATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSA PRLGPSSVYTPGASRPTPPRTTTSPSSPRDPTPAPGDTGTP APASGERAPPNSTRSASESRHRLTVAQVIQIAIPASIIAFV FLGSCICFIHRCQRRYRRPRGQIYNPGGVSCAVNEAAMA RLGAELRSHPNTPPKPRRRSSSSTTMPSLTSIAEESEPGPV VLLSVSPRPRSGPTAPQEV MRK_HSV-2SgI, MPGRSLQGLAILGLWVCATGLVVRGPTVSLVSDSLVDA 16 SQ-032323 GAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELF HYPLGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAH SPAYPTLELGLARQPLLRVRTATRDYAGLYVLRVWVGS ATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSA PRLGPSSVYTPGASRPTPPRTTTSPSSPRDPTPAPGDTGTP APASGERAPPNSTRSASESRHRLTVAQVIQ
[0165] All references, including patent documents, disclosed herein are incorporated by reference in their entirety.