NEURONAL SURVIVAL AND AXONAL REGENERATION THROUGH INCREASING MITOCHONDRIAL MOTILITY

20200061154 ยท 2020-02-27

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed are compositions and methods for promoting survival of or axon regeneration in neurons by increasing mitochondrial motility in the neuron. Also disclosed are methods to treat neuronal injury and disease and disorders characterized by neuronal injury. Agents that increase Armcx1 activity, such as Armcx1 polypeptide or vectors comprising nucleic acid encoding Armcx1 polypeptide, are proposed for use in the methods. Pharmaceutical composition comprising the agents, and methods for identifying additional agents are also disclosed.

Claims

1. A method for promoting survival of, or axon regeneration in an injured mature central nervous system (CNS) neuron comprising contacting the neuron with an effective amount of an agent capable of increasing mitochondrial motility in the injured neuron, thereby promoting survival of, or axon regeneration in the injured neuron.

2. The method of claim 1, further comprising detecting the resultant promotion of the survival of, or axon regeneration in the injured neuron in the subject.

3. The method of claim 2, wherein the injured neuron results from traumatic injury, traumatic brain injury, optic nerve injury, acute spinal cord injury, stroke, restorative CNS surgery or CNS degeneration.

4. The method of claim 1, wherein the injured neuron is a sensory neuron.

5. The method of claim 2, wherein the injured neuron is in the spinal cord.

6. The method of claim 2, wherein the injured neuron is in the optic nerve.

7. The method of claim 1, wherein the agent is administered intravenously, intracortically, intracerebrally, intrathecally, intranasally, ocularly or locally at the injured neuron.

8. The method of claim 1, wherein the agent is Armcx1 polypeptide.

9. The method of claim 8, wherein the Armcx1 polypeptide is recombinant.

10. The method of claim 1, wherein the Armxc1 polypeptide comprises a carrier peptide or lipophilic molecular group and/or is encapsulated in a liposome or a nanoparticle.

11. The method of claim 1, wherein the agent is a vector comprising a nucleic acid sequence that encodes a Armcx1 polypeptide.

12. The method of claim 11, wherein the vector is a viral vector or non-viral vector.

13. The method of claim 12, wherein the viral vector is selected from the group consisting of retrovirus, lentivirus, adenovirus, herpesvirus, poxvirus, alpha virus, vaccinia virus, and adeno-associated viruses.

14. The method of claim 12, wherein the non-viral vector is selected from the group consisting of a nanoparticle, a cationic lipid, a cationic polymer, a metallic nanoparticle, a nanorod, a liposome, microbubbles, a cell penetrating peptide and a liposphere.

15. (canceled)

16. The method of claim 9, wherein the Armcx1 polypeptide comprises the sequence of SEQ ID NO:1.

17. The method of claim 1, wherein the Armcx1 polypeptide has at least 95% amino acid sequence identity to SEQ ID NO:1 and retains at least 80% of the biological activity of human Armcx1 of SEQ ID NO:1.

18-20. (canceled)

21. The method of claim 1, further comprising contacting the injured neuron with a PTEN inhibitor, inhibitor of suppressor of cytokine signaling 3 (SOCS3), inosine, oncomodulin, BNDF, NGF, CNTF, or combinations thereof.

22-24. (canceled)

25. A method of treating a subject for neuronal injury, comprising: administering to the subject an agent that increases mitochondrial motility in injured neurons, wherein the administering results in contacting the injured neurons of the subject with the agent in an amount sufficient to promote survival of, or axon regeneration in the injured neurons, such that the subject is treated.

26-42. (canceled)

43. A device for promoting survival of, or axon regeneration in an injured mature central nervous system (CNS) neuron comprising a therapeutically effective amount of an agent that increases mitochondrial motility in the neuron, and wherein the device locally releases the agent into the CNS for promoting survival of, or axon regeneration in an injured mature central system (CNS) neuron.

44-62. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0111] FIGS. 1A-1H show Armcx1 is up-regulated in high regeneration conditions in vivo and localizes to mitochondria. (FIG. 1A) In situ hybridization showing Armcx1 mRNA levels in mouse retina cross-sections of wild type and high regeneration mutant PTEN, SOCS3 double KO+CNTF (dKO) and PTEN single KO (PTEN.sup.-/-) in intact conditions or 3 days post optic nerve crush. Arrow head indicates the retinal ganglion cells layer (GCL). Scale bar: 50 m. (FIG. 1B) Immunohistochemistry showing the level of endogenous Armcx1 protein in intact retina or 3 days post optic nerve crush in wild type and high regeneration mutant dKO. Tuj1 antibody is used as a RGC marker. Scale bar: 50 m. (FIG. 1C) Quantification of the percentage of Armcx1 positive RGCs from matched sections of 2-3 animals per condition. One-way ANOVA with Tuckey's multiple comparison test. (FIG. 1D) Scheme of Armcx1 constructs full length and mutant. (FIG. 1E) Immunoblot using anti-HA antibody on HEK cell extract transfected either with Armcx1-HA full length or Armcx1-HA lacking the trans membrane domain (Armcx1TM-HA). Lower panel shows unspecific bands of lower molecular weights used as loading control. (FIG. 1F-1G) Immunohistochemistry using anti-HA antibody of mouse cortical neurons co-transfected with MitoDsRed2 and Armcx1-HA (FIG. 1F) or Armcx1TM-HA (FIG. 1G). Low magnification picture of transfected neurons can be seen in FIG. 7B, discussed below. Lower panel shows signal intensity measured by line scan. Scale bar: 25 m. (FIG. 1H) Representative immunoblot showing the specific co-immunoprecipitation (IP) of Miro1-Myc with Armcx1-HA in HEK cells (n=3).

[0112] FIGS. 2A-2G show Armcx1 increases mitochondrial transport and axonal outgrowth of adult RGCs. (FIG. 2A) Representative kymographs from live imaging of TMRM labeled mitochondria in RGC axons of adult retina explant from PTEN.sup.f/f mice co-injected with AAV-Cre and either AAV-PLAP, AAV-Armcx1 or AAV-Armcx1TM. (FIG. 2B) Percentage of motile and stationary mitochondria in adult RGC axons of the indicated genotypes. n=12-17 axons from 3 independent experiments. Kruskal-Wallis test with Dunn's multiple comparisons test on the number of axons. (FIG. 2C) Box plot showing the moving frequency of mitochondria in RGC axons of adult retina explants from the indicated genotypes. n=221-348 mitochondria from 3 independent experiments (11-16 axons). Kruskal-Wallis test with Dunn's multiple comparisons test (FIG. 2D) Mitochondrial density in adult RGCs axons. n=1116 axons from 3 independent experiments. One-way ANOVA with Tuckey's multiple comparisons test. (FIG. 2E) Tuj1 immunostaining of explants of the indicated genotype. Scale bar: 500 m (upper row) and 100 m (lower row). (FIG. 2F) Quantification of the number of axons growing out of the explant normalized by explant's size. n=14-16 explants (21-182 axons) from 2 independent experiments. One-way ANOVA with Tuckey's multiple comparisons test. (FIG. 2G) Quantification of the axonal outgrowth for explants of the indicated genotypes. n=14-16 explants from 2 independent experiments. PTEN.sup.-/-+Armcx1 vs PTEN.sup.-/-+PLAP: *p<0.05 and **p<0.01. PTEN.sup.-/-+Armcx1 vs PTEN.sup.-/-+ARMCX1TM: p<0.05 and p<0.01. One-way ANOVA with Tuckey's multiple

[0113] FIGS. 3A-3D show Effect of Armcx1 overexpression in E18 cortical neurons. (FIG. 3A) Representative kymographs from live imaging of mitochondria in E18 cortical neurons co-transfected with MitoDsRed and either GFP or Armcx1-F2A-GFP. Traces from motile mitochondria were isolated and represented by the bellow kymographs. (FIG. 3B) Percentage of motile and stationary mitochondria per axon of E18 cortical neurons transfected as in A. n=8-10 axons from 3 independent experiments. Two tailed Student's Unpaired t-test on the number of axons. (FIG. 3C) Box plot showing the moving frequency (percentage of time each mitochondria in motion) of mitochondria in axons from cortical neurons of the indicated genotypes. The horizontal line shows the median of the distribution. n=74-137 mitochondria from 3 independent experiments (8-10 axons). Mann-Whitney U test. (FIG. 3D) Representative images of E18 cortical neurons transfected with GFP or Armcx1-F2A-GFP. Scale bar: 100 m. (FIG. 3E) Box plots showing the distribution of the measurements of the longest neurite in E18 cortical neurons transfected as in (FIG. 3D). N=54-97 neurons from 3 independent experiments ran in duplicate. Mann-Whitney U test.

[0114] FIGS. 4A-4E shows Armcx1 promotes axonal regeneration and neuronal survival. (FIG. 4A) Optical sections (approximately 14 m) from whole mount cleared optic nerve from wild type mice injected with AAV-PLAP, AAV-Armcx1 or AAV-Armcx1TM, 15 days post optic nerve crush (dashed line). Axons were labeled with CTB injection. Scale bar: 100 m. (FIG. 4B) Full nerve thickness z projections of the cleared optic nerves shown in FIG. 4A. (FIG. 4C) Bar plot showing the average total number of axons growing past the injury site based on the z projection of the whole mount cleared optic nerve. Each dot represents one mouse. n=5-8 mice from 2 independent experiments. One-way ANOVA, Tuckey's multiple comparison test. (FIG. 4D) Tuj1 immunohistochemistry on whole mount retina from wild type mice shown in FIG. 4A. The retina from the crushed eye (right) and intact eye (left) of the same animal is shown. Scale bar: 40 m. (FIG. 4E) Average percentage of RGC survival as measured by Tuj1 staining. Each dot represents one animal. N=5-9 mice from two independent experiments. One-way ANOVA, Tuckey's multiple comparison test.

[0115] FIGS. 5A-5F show Armcx1 potentiates axonal regeneration of PTEN deleted RGCs. (FIG. 5A) Optic nerve sections of PTEN.sup.f/f mice co-injected with AAV-Cre and the indicated AAVs, 15 days post optic nerve crush (dashed line). Axons were labeled with intraocular CTB injection. Scale bar: 100 m. Pictures of the full nerve can be seen in FIG. 11, discussed below. (FIG. 5B) Bar plot showing the average estimated number of axons growing past the injury site. Each dot represents one animal (2-6 cryo-sections per animal). n=8-9 mice from 2 independent experiments. One-way ANOVA, Tuckey's multiple comparison test. (FIG. 5C) Tuj1 immunohistochemistry of whole mount retina from PTEN.sup.f/f mice shown in FIG. 5A. Retina from the crushed eye (right) and intact eye (left) of the same animal is shown. Scale bar: 40 m. (FIG. 5D) Average percentage of RGC survival per animal measured by Tuj1 staining. Each dot represents one animal. n=8-9 animals. One-way ANOVA, Tuckey's multiple comparison test. Scale bar: 40 m. (FIG. 5E) Optic nerve longitudinal sections 15 days post crush of Kcng4-YFP mice injected with CTB and the indicated AAVs. The YFP channel (was visualized as green) shows the axons projecting from the RGCs (Kcng4-YFP) and the RFP channel (was visualized as red) shows the CTB labeled axons from all RGCs. (FIG. 5F) CTB and YFP axons quantified 0.5 mm from the injury site. n=4 mice per condition. Mann-Whitney Utest. Scale bar: 300 m.

[0116] FIGS. 6A-6F show Armcx1 is necessary for axonal regeneration. (FIG. 6A) Experimental timeline and (left) immunohistochemistry using Armcx1 antibody on retina cross sections of dKO mice injected either with AAV-shScramble or AAV-shArmcx1. Mice were euthanized 3 days post optic nerve crush. (Right) Quantification of the number of Armcx1 positive RGCs 3 days post optic nerve crush in matching sections of the indicated genotypes. Scale bar: 40 m. n=3 mice randomly chosen from the cohort shown in (FIG. 6B). Two tailed Student's Unpaired t-test. (FIG. 6B) Experimental timeline and (left) optic nerve sections of dKO mice injected with indicated AAVs, 15 days post optic nerve crush (dashed line). Axons were labeled with CTB injection. Scale bar: 100 m. Pictures of the full nerve are shown in FIG. 121, discussed below. (Right) Bar plot showing the average estimated number of axons growing past the injury site per animal. Each dot represents one animal (2-6 cryo-sections per mice). n=4 per condition. One-way ANOVA, Tuckey's multiple comparison test. (FIG. 6C) (Left) Tuj 1 immunohistochemistry on whole mount retina from dKO mice injected with AAVs as shown in FIG. 6B. Retina from the crushed eye (upper) and intact eye (lower) of the same animal is shown. Scale bar: 40 m. (Right) Bar plot of the average percentage of RGC survival per animal measured by Tuj1 staining. Each dot represents one animal. N=5 per condition. Two tailed Student's Unpaired t-test.

[0117] FIGS. 7A-7B show expression of Armcx1 homologues in high regeneration capacities RGCs and Armcx1 co-localization with mitochondria. (FIG. 7A) In situ hybridization showing the mRNA levels of selected members of the Armcx cluster in mouse retina cross-sections of Wt and high regeneration mutant PTEN, SOCS3 double KO+CNTF (dKO) in intact conditions or 3 days post optic nerve crush. Scale bar=50 m. (FIG. 7B) Immunohistochemistry using anti-HA antibody of mouse cortical neurons co-transfected with MitoDsRed2 and either Armcx1-HA full length or Armcx1ATM-HA. Scale bar=20 m for the low magnification images and 5 m for the high magnification images.

[0118] FIGS. 8A-8C shows characterization of AAV infected adult retina explants. (FIG. 8A) Representative images of whole mount retinas from Wt mice injected with the indicated AAVs. 15 days post viral injections, mice were euthanized and immunohistochemistry using indicated antibodies was performed. Scale bar=100 m. (FIG. 8B) Quantification of the percentage of RGCs infected with AAV-Armcx1-HA (upper) and Armcx1ATM-HA (lower). n=1632-2331 RGCs from 2 retina per conditions. (FIG. 8C) Adult retina explant culture of PTEN.sup.f/f mice co-injected with indicated AAVs. Explants were immunostained with Tuj1 antibody. The majority of Cre infected RGCs axons were also infected with MitoDsRed Flex Switch. Scale bar=100 m. (FIG. 8D) Box plot showing the moving frequency of motile mitochondria in axons from adult retina explants of PTEN.sup.f/f mice injected with the indicated AAVs. The horizontal line indicates the median and the whiskers the maximum and minimum of the distribution. n=221-348 mitochondria from 11-16 axons, from 3 independent experiments. Kruskal-Wallis test with Dunn's multiple comparisons test.

[0119] FIGS. 9A-9C shows Armcx1 overexpression does not affect mitochondrial density and transport of BDNF positive vesicles. (FIG. 9A) Quantification of the mitochondrial density in axons of E18 cortical neurons co-transfected with MitoDsRed and either GFP or Armcx1-F2A-GFP. n=8-10 axons from 3 independent experiments. Two tailed Student's Unpaired t-test. (FIG. 9B) Representative kymographs from live imaging experiments of BDNF positive vesicles in E18 cortical neurons co-transfected with BDNF-RFP and either GFP or Armcx1-F2A-GFP. (FIG. 9C) Box plot showing the moving frequency of BDNF positive vesicles in axons from cortical neurons of the indicated genotypes. The horizontal line shows the median of the distribution. n=127-142 vesicles from 9 axons, 3 independent experiments. Mann-Whitney U test.

[0120] FIGS. 10A-10D show Armcx1 improve axonal regeneration independently of its survival effect. (FIG. 10A) Tuj1 immunohistochemistry on whole mount retina from mice of the indicated genotypes. Retina from the crushed eye and intact eye of the same animal is shown. Scale bar=40 m. (FIG. 10B) Average percentage of RGC survival as measured by Tuj 1 staining. Each dot represents one animal. n=4-5 animals per condition. One-way ANOVA, Tukey's multiple comparison test. (FIG. 10C) Optical sections (approximately 14 m) from whole mount cleared optic nerve collected 15 days post optic nerve crush (dashed red line) from Wt mice injected with AAV-PLAP, and Bc12 mice injected with either AAV-PLAP or AAV-Armcx1. Axons were labeled with intraocular CTB injection. Scale bar=100 m. (FIG. 10D) Quantification of the average total number of axons growing past the injury site based on the z projection of the whole mount cleared optic nerve. Each dot represents one animal. n=4-5 animals per condition. One-way ANOVA, Holm-Sidak's multiple comparison test.

[0121] FIGS. 11A-11C shows Armcx1 overexpression in PTEN.sup.-/- potentiates regeneration phenotype and partially recapitulates axonal regeneration phenotype of dKO. Related to FIG. 5. (FIG. 11A) Optic nerve sections of PTEN.sup.f/f mice co-injected with AAV Cre and the indicated AAVs, 15 days post optic nerve crush. Axons were labeled with CTB injection. Scale bar=500 m. (FIG. 11B) Side by side comparison of optic nerve sections of PTEN.sup.-/- mice injected with the indicated AAVs and dKO, 15 days post optic nerve crush (dashed red line). All AAVs were injected and incubated in parallel in all conditions. Axons were labeled with intraocular CTB injection. Scale bar=100 m. (FIG. 11C) Bar plot showing the average estimated number of axons at 0.2 mm from the injury site. Each dot represents one animal (2-6 cryo-sections per animal). n=4 animals per condition. One-way ANOVA, Tuckey's multiple comparison test.

[0122] FIGS. 12A-12K Armcx1 is necessary for dKO high regeneration phenotype. (FIG. 12A) Immunohistochemistry using the indicated antibody of HEK cells co-transfected with Armcx1-HA and either shRNA-Scramble-GFP, shRNA-Armcx1#2, shRNA-Armcx1#5. Scale bar=100 m (FIG. 12B) Quantification of the intensity ratio from HA and GFP antibody signal. n=5 per conditions from 2 independent experiments with 2-3 technical replicates. One-way ANOVA, Tukey's multiple comparison test. (FIG. 12C) Representative kymographs from live imaging of mitochondria in E18 cortical neurons co-transfected with MitoDsRed and either shRNA Scramble or shRNA Armcx1. (FIG. 12D) Percentage of motile and stationary mitochondria per axon of E18 cortical neurons transfected as in C. n=12-14 axons from 3 independent experiments. Two tailed Student's Unpaired t-test on the number of axons. (FIG. 12E) Box plot showing the moving frequency of mitochondria in axons from cortical neurons transfected as in C. n=142-149 mitochondria from 3 independent experiments (12-14 axons). Mann-Whitney Utest. (FIG. 12F) Quantification of the mitochondrial density in axons of E18 cortical neurons co-transfected with either shScramble or shArmcx1. n=12-14 axons from 3 independent experiments. Two tailed Student's Unpaired t-test (FIG. 12G) Representative images of E18 cortical neurons transfected with shRNA Scramble or shRNA Armcx1 using anti GFP and RFP antibody, respectively. Scale bar=100 m. (FIG. 12H) Box plots showing the distribution of the measurements of the longest neurites in E18 cortical neurons transfected either with shRNA Scramble or shRNA Armcx1. n=57 neurons per conditions from 3 independent experiments. Mann-Whitney U test. (FIG. 12I) Representative images and quantification of immunohistochemistry on whole mount retinas from Wt mice injected with either shRNA Scramble (upper) or shRNA Armcx1 (lower). Tissues were stained with antibody against Tuj1, GFP (shRNA Scramble) or RFP (shRNA Armcx1). Scale bar=80 m. (FIG. 12J) Optic nerve sections of dKO mice injected with the indicated AAVs, 15 days post optic nerve crush. Axons were labeled with CTB injection. Images with tissues were stitched and black tiles were added to complete the rectangular shape. Scale bar 500 m. (FIG. 12K) Experimental time line and (left) CTB-traced optic nerve sections (first column) and Tuj1 immunostaining of whole mount retina (second column) of Wt mice intra-vitreally injected with either AAV-shScramble or AAV-shArmcx1. Mice were euthanized 5 weeks post injection. Scale bar=100 m and 40 m, respectively. (Right) Quantification of RGC survival of mice with the indicated treatment. n=4-5 mice per condition. Mann-Whitney Utest.

DETAILED DESCRIPTION

[0123] The present disclosure is based in part on the discovery that expression of Armcx1 correlates with high axonal regeneration, modulates the transport of the axonal mitochondria and promotes neuronal survival and axonal regeneration. Described herein are compositions and methods to promote survival of neurons and/or axons regeneration of neurons. Provided herein are methods and compositions useful for neuronal injury or a disease or disorder causing neuronal injury or resulting from neuronal injury.

[0124] The methods and compositions provided herein encompasses contacting neurons with an agent for promoting their survival or axon regeneration. In some embodiments, the agent is a one that is capable of increasing mitochondrial motility in the neurons. In some embodiments, the agent is an Armcx1 polypeptide. In some embodiments, the agent is a vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide.

Armadillo Repeat Containing, X-Linked Protein 1 (Armcx1)

[0125] Armcx1 is a protein that is inserted in the mitochondria. As used herein the term Armcx1 or Armcx1 protein or Armcx1 polypeptide generally refers to an Armcx1 polypeptide that is similar or identical in sequence to a wild-type Armcx1. In some embodiments, the term Armcx1 polypeptide refers to a polypeptide having an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 99%, or 100%, identical to that of a wild-type Armcx1 and that retains the ability, at a minimum, to increase mitochondrial motility in injured neurons and/or promote survival of injured neurons and/or promote axon regeneration of injured neurons in vivo. Accordingly in some embodiments, Armcx1 polypeptide can be full length Armcx1. In some embodiments, Armcx1 can be a functional fragment of a full length Armcx1, a species homologue and/or functional fragments thereof, an ortholog of Armcx1 and/or functional fragments thereof. The Armcx1 polypeptide can be a mammalian Armcx1 protein. The Armcx1 polypeptide can also be a functional isoform of the full length Armcx1 or functional fragment thereof

[0126] In some embodiments, Armcx1 is a wild-type Armcx1 of human origin, having the following amino acid sequence, or a functional fragment thereof:

TABLE-US-00001 (SEQIDNO:1) 1 mgrtreagcvaagvvigagacycvyrlawgrdenekiwdedeestdtseigvetvkgakt 61 nagagsgaklqgdsevkpevslgledcpgvkekahsgshsgggleakakalfntlkeqas 121 akagkgarvgtisgnrtlapslpcpggrgggchptrsgsraggrasgkskgkarskstra 181 pattwpvrrgkfnfpykiddilsapdlqkvlnilertndpfiqevalvtlgnnaaysfnq 241 nairelggvpiiakliktkdpiirektynalnnlsvnaenqgkiktyisqvcddtmvcrl 301 dsavqmaglrlltnmtvtnhyqhllsysfpdffallflgnhftkiqimkliinftenpam 361 trelvsckvpselislfnkewdreillniltlfenindnikneglassrkefsrsslffl 421 fkesgvcvkkikalanhndlvvkvkvlkvltkl
(See GenBank Accession No. NP_057692.1, which is incorporated herein by reference in its entirety).

[0127] A functional fragment refers to fragment of the full length Armcx1 (e.g., corresponding to SEQ ID NO:1) of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140 consecutive amino acids of full length wild-type Armcx1, that has at least about 70%, 80%, 90%, 100% or more than 100% of the function of wild-type Armcx1 (e.g., of SEQ ID NO:1) at neuronal survival and/or axon regeneration of injured axons in vivo or in vitro. The functional activity can be tested by one of ordinary skill in the art by the assays described in the examples.

[0128] The polypeptide and coding nucleic acid sequences of Armcx1 and of other members of the family of human origin and those of a number of animals are publically available, e.g., from the NCBI website and are contemplated for use in the methods and compositions herein. Examples include, but are not limited to, Mouse (GenBank Accession No. AAH21410.1), Rat (GenBank Accession No. AAH85780.1), Bovine (GenBank Accession No. XP_015317042.1).

[0129] The nucleic acid sequence of Armcx1 of human origin is known in the art and is available publically for e.g., from genebank Gene ID: 51309, which is incorporated herein by reference in its entirety).

[0130] In some embodiments, the Armcx1 polypeptide can be a mammalian homolog of human Armcx1 or a functional fragment thereof. In some embodiments, Armcx1 polypeptide has an amino acid sequence at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identical to the amino acid sequence of SEQ ID NO:1 and increases at least one of i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons. In some embodiments, Armcx1 polypeptide has an amino acid sequence that has at least 85%, at least 90%, at least 95%, at least 97% or at least 99% amino acid sequence homology to amino acid sequence of SEQ ID NO: 1 and increases at least one of i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons. In some embodiments, Armcx1 is a functional fragment of SEQ ID NO:1 of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140 consecutive amino acids of SEQ ID NO:1, that has at least about 50%,60%, 70%, 80%, 90%, 100% or more than 100% of the function of wild type Armcx1 (e.g., human Armcx1 of SEQ ID NO:1) of increasing at least one of i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons, in vivo or in vitro. The functional activity can be tested by one of ordinary skill in the art by the assays described in the examples.

[0131] Percent (%) amino acid sequence identity for a given polypeptide sequence relative to a reference sequence is defined as the percentage of identical amino acid residues identified after aligning the two sequences and introducing gaps if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Percent (%) amino acid sequence homology for a given polypeptide sequence relative to a reference sequence is defined as the percentage of identical or strongly similar amino acid residues identified after aligning the two sequences and introducing gaps if necessary, to achieve the maximum percent homology. Non identities of amino acid sequences include conservative substitutions, deletions or additions that do not affect the biological activity of Armcx1. Strongly similar amino acids can include, for example, conservative substitutions known in the art. Percent identity and/or homology can be calculated using alignment methods known in the art, for instance alignment of the sequences can be conducted using publicly available software software such as BLAST, Align, ClustalW2. Those skilled in the art can determine the appropriate parameters for alignment, but the default parameters for BLAST are specifically contemplated.

[0132] In one embodiment, Armcx1 polypeptide useful in the methods and compositions described herein consists of, consists essentially of, or comprises an amino acid sequence, or is a fragment thereof derived from SEQ ID NO:1, provided that the polypeptide retains at least one biological activity of full length Armcx1 of SEQ ID NO: 1, the biological activity being selected from at a minimum, increasing i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons, in vivo or in vitro.

[0133] The polypeptides described herein can comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non-essential amino acid residues but will retain a therapeutically or physiologically relevant activity of an inhibitory peptide as that term is described herein. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, in a conservative substitution variant, a nonessential amino acid residue in the polypeptide is preferably replaced with another amino acid residue from the same side chain family.

[0134] In some embodiments, Armcx1 can be a variant of wild type Armcx1. The term variant as used herein refers to a polypeptide or nucleic acid that is substantially similar to a wild-type Armcx1. A molecule is said to be substantially similar to another molecule if both molecules have substantially similar structures (i.e., they are at least 50% similar in amino acid sequence as determined by BLASTp alignment set at default parameters) and are substantially similar in at least one therapeutically or physiologically relevant biological activity. A variant differs from the naturally occurring polypeptide or nucleic acid by one or more amino acid or nucleic acid deletions, additions, substitutions or side-chain modifications, yet retains one or more therapeutically relevant, specific functions or desired biological activities of the naturally occurring molecule. (e.g., at least one of i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons, in vivo or in vitro.).

[0135] Amino acid substitutions include alterations in which an amino acid is replaced with a different naturally-occurring or a non-conventional amino acid residue. Some substitutions can be classified as conservative, in which case an amino acid residue contained in a polypeptide is replaced with another naturally occurring amino acid of similar character either in relation to polarity, side chain functionality or size. Substitutions encompassed by variants as described herein can also be non-conservative, in which an amino acid residue which is present in a peptide is substituted with an amino acid having different properties (e.g., substituting a charged or hydrophobic amino acid with an uncharged or hydrophilic amino acid), or alternatively, in which a naturally-occurring amino acid is substituted with a non-conventional amino acid. Also encompassed within the term variant, when used with reference to a polynucleotide or polypeptide, are variations in primary, secondary, or tertiary structure, as compared to a reference polynucleotide or polypeptide, respectively (e.g., as compared to a wild- type polynucleotide or polypeptide). Polynucleotide changes can result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence. Variants can also include insertions, deletions or substitutions of amino acids in the peptide sequence. To be therapeutically useful, such variants will retain a therapeutically or physiologically relevant activity as that term is used herein.

[0136] The Armcx1 polypeptide can be recombinant, purified, isolated, naturally occurring or synthetically produced. The term recombinant when used in reference to a nucleic acid, protein, cell or a vector indicates that the nucleic acid, protein, vector or cell containing them have been modified by introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or a protein, or that the cell is derived from a cell so modified. The term heterologous (meaning derived from a different organism) refers to the fact that often the transferred protein was initially derived from a different cell type or a different species from the recipient. Typically the protein itself is not transferred, but instead the genetic material coding for the protein (often the complementary DNA or cDNA) is added to the recipient cell. Methods of generating and isolating recombinant polypeptides are known to those skilled in the art and can be performed using routine techniques in the field of recombinant genetics and protein expression. For standard recombinant methods, see Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY (1989); Deutscher, Methods in Enzymology 182:83-9(1990); Scopes, Protein Purification: Principles and Practice, Springer-Verlag, NY (1982).

[0137] In some embodiments, Armcx1 can be an agonist of wild-type Armcx1, an analog or a derivative thereof. The term Armcx1 agonist as defined herein can be a compound that enhances or stimulates the normal biological activity of Armcx1 by increasing transcription or translation of Armcx1-encoding nucleic acid, and/or by inhibiting or blocking activity of a molecule that inhibits Armcx1 expression or Armcx1 activity, and/or by enhancing normal Armcx1 biological activity (including, but not limited to enhancing the stability of Armcx1 or enhancing binding of Armcx1 to a receptor and/or directly binding to and activating a potential Armcx1 receptor. The biological activity can be defined herein as including at least one of the activity selected from e.g., increasing i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons, in vivo or in vitro. The activity of the agonist can be for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% of the biological activity of human Armcx1 of SEQ ID NO:1.

[0138] It is contemplated herein that in the methods and compositions can comprise Armcx1 analogs or Armcx1 derivatives. By Armcx1 analog it is meant a peptide whose sequence is derived from that of Armcx1 including insertions, substitutions, extensions, and/or deletions, having at least some amino acid identity to Armcx1 or region of an Armcx1 polypeptide. Analogs may have at least 50 or 55% amino acid sequence identity with a native Armcx1 (e.g., human Armcx1, SEQ ID NO: 1) or at least 70%, 80%, 90%, or 95% amino acid sequence identity with a native Armcx1. In one embodiment, such analogs may comprise conservative or non-conservative amino acid substitutions (including non-natural amino acids and L and D forms). Armcx1 agonist analogs are analogs as herein described and function as an Armcx1 agonist.

[0139] An Armcx1 derivative is defined as a molecule having the amino acid sequence of a wild-type Armcx1 (e.g., human Armcx1, SEQ ID NO: 1) or analog thereof, but additionally having a chemical modification of one or more of its amino acid side groups, alpha.-carbon atoms, terminal amino group, or terminal carboxylic acid group for example by ubiquitination, labeling, pegylation (derivatization with polyethylene glycol) or addition of other molecules. A chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties. Such modifications can improve the molecule's solubility, absorption, biological half-life, etc. The modifications can alternatively decrease the toxicity of the molecule, or eliminate or attenuate an undesirable side effect of the molecule, etc. Moieties capable of mediating such effects are disclosed in Remington's Pharmaceutical Sciences, 18th edition, A. R. Gennaro, Ed., MackPubl., Easton, Pa. (1990). Furthermore, one or more side groups, or terminal groups, may be protected by protective groups known to the ordinarily-skilled synthetic chemist. The term functional when used in conjunction with derivative or variant refers to a polypeptide which possesses a therapeutically or physiologically relevant biological activity that is substantially similar to a biological activity of the entity or molecule of which it is a derivative or variant. By substantially similar in this context is meant that at least 50% of the relevant or desired biological activity of a corresponding wild-type peptide is retained. In some embodiments, the derivative retains at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or more, including 100% or even more (i.e., the derivative or variant has improved activity relative to wild-type) of the Armcx1.

[0140] In some embodiments, the agonist of wild-type Armcx1, an analog or a derivative thereof, retains at least one biological activity of full length ANG of SEQ ID NO: 1, the biological activity being selected from at a minimum, at least one of i. mitochondrial motility in neurons, ii. survival of injured neurons and iii. axon regeneration of injured neurons, in vivo or in vitro. In some embodiments, the agonist of wild-type Armcx1, an analog or a derivative thereof, retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100% or more than 100% of the biological activity of full length Armcx1 of SEQ ID NO:1.

[0141] In some embodiments, an agent of the methods and compositions herein, is a vector comprising a nucleic acid sequence encoding for an Armcx1 polypeptide. In some embodiments, the vector is a viral vector. In some embodiments, the vector is non-viral vector. In some embodiments, the vector is an expression vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide. Viral and non-viral-based gene transfer methods can be used to introduce nucleic acids encoding Armcx1 polypeptides to cells or target tissues of the subject. Such methods can be used to administer nucleic acids encoding Armcx1 polypeptides to cells in vitro. Alternatively, or in addition, such polynucleotides can be administered for in vivo or ex vivo gene therapy uses. Non-viral vector delivery systems include DNA plasmids, naked nucleic acid, and nucleic acid complexed with, for example, a liposome or other delivery vehicle. Viral vector delivery systems include both DNA and RNA viruses, and can have either episomal or integrated genomes after delivery to the cell. Gene therapy procedures are described, for example, in Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bohm (eds) (1995); and Yu et al., Gene Therapy 1:13-26 (1994).

[0142] Methods of non-viral delivery of nucleic acids encoding engineered polypeptides of the invention include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described, e.g., in U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355, and lipofection reagents are sold commercially (e.g., Transfectam and Lipofectin). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424, WO 91/16024. Delivery can be to cells (ex vivo administration) or target tissues (in vivo administration). The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res.52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).

[0143] RNA or DNA viral based systems can be used to target the delivery of polynucleotides carried by the virus to specific cells in the body and deliver the polynucleotides to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to transfect cells in vitro. In some cases, the transfected cells are administered to patients (ex vivo). Conventional viral based systems for the delivery of polypeptides of the invention could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Viral vectors are currently the most efficient and versatile method of gene transfer in target cells and tissues. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene, and high transduction efficiencies.

Biological Activity of Agent

[0144] The technology herein is partly based on the discovery that protein Armcx1 increases mitochondrial motility, survival of injured neurons and regeneration of axon post injury. Accordingly the minimum set of biological activity of an agent (e.g., Armcx1) is at least one or combination of; i. increasing mitochondrial motility, ii. promoting survival of neurons (e.g. injured neurons) or iii. promoting regeneration of axons in the neurons (e.g., injured neurons).

[0145] Increased mitochondrial motility can be e.g., increase in the total pool of motile mitochondria or increase in the fraction of time mitochondria is in motion in neurons contacted by the agents, compared to that in absence of contact with the agent. The increase can be e.g., at least 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75% or more relative to in neurons not contacted with the agent.

[0146] Increased survival of neurons is indicated by the number of neurons surviving from a specific injury or condition upon contact with an agent disclosed herein (e.g., Armcx1 polypeptide), as compared to the number of neurons surviving in absence of said contact, and also by the length of time the survival persists upon contact with an agent disclosed herein (e.g., Armcx1 polypeptide), as compared to that in absence of contact. Survival is considered to be sustained if it persists for an extended period of time post-injury (e.g., greater than 2 weeks post -injury, greater than 3 weeks, and greater than 4 weeks postinjury). In one embodiment, greater than 10% of neurons (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%), survive upon contact with one or more agents disclosed herein. In one embodiment, greater than 20% of neurons (e.g., 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%), survive for an extended period of time post-injury.

[0147] Increased regeneration or outgrowth is indicated by the number of neurons (injured and also uninjured) and by extended length of the axonal outgrowth of the neurons upon contact with the agent disclosed herein (e.g., Armcx1), as compared to that in absence of the said contact, and by the time frame post-injury that the outgrowth occurs upon contact with an agent disclosed herein (e.g. Armcx1), as compared to the time frame postinjury that outgrowth occurs in absence of said contact. Increased regeneration and axonal outgrowth occurs if greater than 10% or greater than 20% (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%) of the neurons regenerate injured axons or generate new axons. In some embodiments, the regenerated axons extend at least 0.5 mm distal to the lesion epicenter. In one embodiment, greater than 10% or greater than 20%(e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75% of neurons regenerate injured axons or generate axons over 1 mm distal to the lesion site. In one embodiment, greater than 10% (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%) or greater than 20% of neurons regenerate or generate new axons that extend at least 2 mm distal from the lesion site.

Other Agents

[0148] An activator of protein translation (e.g., a mTOR pathway activator; a PTEN inhibitor; a TSC1/2 inhibitor; an Akt activator; a Ras/MEK pathway activator; or a PRAS40 inhibitor can promote the survival of, or axon regeneration in the neuron. See for e,g, US 20090305333 A1, the contents of which are incorporated herein in its entirety. PTEN inhibitors e.g., in US 20090305333 A1, U.S. Pat. No. 8,367,352 B2, US 20140213609 A1 (the contents of which are incorporated herein by reference in their entireties) can be useful in the methods and compositions herein, in combination with the agents disclosed herein (e.g., agents increasing mitochondrial motility, Armcx1 polypeptide). Inhibition of SOCS3 was reported to promote neuron regeneration (US20110124706 A1, the contents of which are incorporated by reference herein in its entirety).

[0149] The inventors discovered that when combined with PTEN deletion and/or inhibition of SOCS3, overexpression of Armcx1, significantly increased the survival of or, axon regeneration in neurons compared to inhibition of PTEN or SOCS3 alone. It has been reported that a combination of PTEN inhibitor and inhibitor of SOCS3, promoted sustained survival of, and/or axon regeneration in injured neurons in comparison to PTEN inhibitor or SOCS3 inhibitor alone (See for example reference US 20140256795 A1, the contents of which are incorporated herein in its entireties.) Accordingly, in one aspect, the methods described herein further comprises contacting injured neurons with other agents that can promote at least one of; i. mitochondrial motility, ii. survival of injured axons, or iii. axon regeneration in injured neurons in combination with the agents disclosed herein (e.g., agents that increase mitochondrial motility, Armcx1).

[0150] The agents of the present disclosure (e.g., agents that increase mitochondrial motility, Armcx1 polypeptide, or vector comprising a nucleic acid sequence encoding Armcx1 polypeptide).

[0151] In some embodiments, the methods and compositions of the present disclosure can comprise contacting the injured neurons or administering to the subject, an effective amount of one or more other agents selected from activator of protein translation, PTEN inhibitor, inhibitor of suppressor of cytokine signaling 3 (SOCS3) in combination with the agents disclosed herein (e.g., e.g., agents increasing mitochondrial motility, Armcx1 polypeptide, vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide). In some embodiments, the methods and compositions herein comprises of contacting neurons with effective amounts of combination of Armcx1 polypeptide, inhibitor of PTEN and inhibitor of SOCS3. In some embodiments, the neurons can also be contacted with nerve growth factor, trophic factor, or hormone that promotes neural cell survival, growth, and/or differentiation, such as brain-derived neurotrophic factor (BDNF), ciliary neurotrophic factor (CNTF), nerve growth factor (NGF), inosine, oncomodulin, NT-3, etc, in addition to the agents disclosed herein (e.g., Armcx1 polypeptide), and/or one of the other agents disclosed above (e.g., activator of protein translation, PTEN inhibitor, inhibitor of SOCS3).

[0152] In one embodiment, the injury results from acute spinal cord injury and the method additionally comprises contacting the neuron with methylprednisolone sufficient to reduce inflammation of the spinal cord. In one embodiment, the agents are administered in combination with trophic and/or growth factors (e.g., denervation-induced cytokines) known in the art to promote or enhance neuronal survival/regeneration, growth and/or differentiation. Examples include, without limitation, brain-derived neurotrophic factor (BDNF), ciliary neurotrophic factor (CNTF) (WO2011/066182), fibroblast growth factor (FGF), chondroitiniase, nerve growth factor (NGF), NT-3 (Piantino et al, Exp Neurol. 2006 October;201(2):359-67), inosine (Chen et al, Proc Natl Acad Sci USA. (2002) 99:9031-6; U.S. Pat. No. 6,551,612 to Benowitz; U.S. Pat. No. 6,440,455 to Benowitz; and US Pat Publ 20050277614 to Benowitz), oncomodulin (Yin et al, Nat Neurosci. (2006) 9:843-52; US Pat Publ 20050054558 to Benowitz; US Pat Publ 20050059594 to Benowitz; and U.S. Pat. No. 6,855,690 to Benowitz). Another such agent is an agent to remove extracellular matrix molecules (e.g., chondroitin sulphate proteoglycans) that are inhibitory to neuronal outgrowth, such as chondroitenase ABC (ChABC), which breaks up chondroitin sulphate proteoglycans.

[0153] In one embodiment, the agents are administered in combination with one or more factors that facilitate neuronal synapse formation. Examples of such factors include, without limitation, activators of Rab3A, NMDA-I, synapsin-1, tetanus toxin receptor, BDNF-receptor and a GABA receptor. Such factors are described in U.S. Patent Application Publication 2008/0214458. Neuronal synapse formation can be modulated, for example, by modulating the activity of the transcriptional factor myocyte enhancer factor 2 (MEF2) (e.g., MEF2A), MEF2C, MEF2D, dMEF2, CeMEF2, Activating transcription factor 6 beta

[0154] (ATF6), Estrogen related receptor alpha (ERR1), Estrogen related receptor beta (ERR2), Estrogen related receptor gamma (ERR3), Erythroblastosis virus E26 oncogene homolog 1 (ETS1), Forkhead box protein C2 (FOXC2), Gata binding factor 1 (GATA-1), Heat shock factor 1 (HSF1), HSF4, MLL3, Myeloblastosis oncogene homolog (MYB), Nuclear receptor coactivator 2 (NCOA2), Nuclear receptor corepressor 1 (NCOR1), Peroxisome proliferative activated receptor gamma (PPARg), SMAD nuclear interacting protein 1 (SNIP1), SRY-box containing protein 3 (SOX3), SOX8, SOX9, Sterol regulatory element-binding transcription factor 2 (SREBP2), or Thyroid hormone receptor beta-1 (THRB1) (described in U.S. Patent Application Publication 20100112600).

[0155] The other agent(s) can be administered to the same site or to a different site as the agents of the present disclosure (e.g., agents that increase mitochondrial motility, Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide). The other agent may be contacted to the same site of the neuron or to a different site of the neuron. In one embodiment, the agents of the present disclosure (e.g., agents that increase mitochondrial motility, Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide) is contacted to the neuron(s) at the neuron's region of origin in the brain (e.g., by administration to cortical neurons at the cerebral ventricle) and the other agent is contacted to the neuron at the site of injury (e.g., the lesioned axon such as a cortical spinal tract axon). Other combinations of site of contact and routes of administration discussed herein are also envisioned.

[0156] The contacting with one or more of the other agents (e.g., activator of protein translation, PTEN inhibitor, inhibitor or SOCS3, BDNF, CNTF, inosine, oncomodulin, NT-3) can occur prior to, with or after the contacting with the agents disclosed herein (e.g., Armcx1 polypeptide). An effective amount of the inhibitors are contacted with the neuron using a suitable method sufficient to promote sustained survival of the neuron and/or regeneration and/or sustained compensatory outgrowth of the neuronal axon. An effective amount is the amount required to produce statistically significant and reproducible sustained survival, sustained regeneration, or a combination of both, as compared to an appropriate control. For in vitro methods, the inhibitors are, for example, added to the culture medium, usually at nanomolar or micromolar concentrations. The respective inhibitors can be added in the same formulation, or in different formulations.

[0157] For in vivo applications, one or more other agents can be administered to the subject by any method that results in contacting both a therapeutically effective amount of each to the neuron at relatively the same time, or in some embodiments, separately at different times. The respective other agents can be administered at the same time or at different times, depending upon various factors associated with each inhibitor (e.g., half-life, administration route, etc.). The respective other agents can be administered by the same route of administration or through different routes of administration e.g., orally, by intravenous (i.v.) bolus, by i.v. infusion, subcutaneously, intramuscularly, ocularly (intraocularly, periocularly, retrobulbarly, intravitreally, subconjunctivally, topically, by subtenon administration, etc., intracranially, intraperitoneally, intraventricularly, intrathecally, by epidural, etc. The administration of the respective other agents can be for differing prolonged periods, or for the same length of period such that their activities on the contacted neurons completely or substantially overlap. The respective other agents can be administered in a formulation which contains one or more of other agents (a pharmaceutical composition, as described herein), or they can be in separate formulations (separate pharmaceutical compositions) for separate administration.

[0158] It is contemplated herein, that contacting the neurons with a combination of agents disclosed herein and those known in the art results in increased survival of, and/or axon regeneration of injured neurons compared to when the neurons are contacted with individual agents alone.

[0159] Increased survival of neurons is indicated by the number of neurons surviving from a specific injury or condition, as compared to the number of neurons surviving as a result of the effects of the individual agent (either Armcx1, PTEN or SOCS3), and also by the length of time the survival persists, as compared to the length of time survival persists as a result of the effects of the individual agent (either Armcx1, PTEN or SOCS3). Survival is considered to be sustained if it persists for an extended period of time post-injury (e.g., greater than 2 weeks post -injury, greater than 3 weeks, and greater than 4 weeks postinjury). In one embodiment, greater than 10% of neurons (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%), survive upon contact with one or more agents disclosed herein. In one embodiment, greater than 20% of neurons (e.g., 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%), survive for an extended period of time post-injury.

[0160] Increased regeneration or outgrowth is indicated by the number of neurons (injured and also uninjured) and by extended length of the axonal outgrowth of the neurons, as compared to the number of neurons and extended length of the axonal outgrowth of the neurons that results from the effects of the individual agent (e.g., either Armcx1, PTEN or SOCS3), and by the time frame post-injury that the outgrowth occurs, as compared to the time frame postinjury that outgrowth occurs resulting from the effects of the individual agent (e.g., either PTEN or SOCS3). Increased regeneration and axonal outgrowth occurs if greater than 10% or greater than 20% (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%) of the neurons regenerate injured axons or generate new axons. In some embodiments, the regenerated axons extend at least 0.5 mm distal to the lesion epicenter. In one embodiment, greater than 10% or greater than 20% (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%) of neurons regenerate injured axons or generate axons over 1 mm distal to the lesion site. In one embodiment, greater than 10% (e.g., 15%, 20%, 25%, 30%, 35%, 0%, 45%, 50%, 55%, 60%, 65%, 70% and 75%) or greater than 20% of neurons regenerate or generate new axons that extend at least 2 mm distal from the lesion site.

[0161] Sustained regeneration and axonal outgrowth can be indicated by a significant amount of outgrowth occurs on or after 2 weeks post-injury. For example significant outgrowth occurs for up to 3 weeks or 4 weeks post-injury.

Neurons

[0162] The methods and compositions described herein are suited for the promotion of survival of, and/or axon regeneration in and sustained axonal outgrowth of CNS (central nervous system) neurons. It is contemplated herein that the methods and compositions of the present disclosure are not limited to neurons of the CNS, but can also be adapted for PNS (peripheral nervous system) neurons. CNS neurons include, without limitation, a cerebellar granule neuron, or an ocular neuron. In one embodiment, the neuron is the optic nerve. In one embodiment, the neuron is a sensory neuron (e.g., dorsal root ganglion (DRG) sensory neuron). As used herein, the term PNS neurons is intended to include the neurons commonly understood as categorized in the peripheral nervous system, including sensory neurons and motor neurons. The present invention provides methods and compositions for preventing and/or treating peripheral nerve damage (peripheral neuropathy) in a subject. Peripheral nerves such as dorsal root ganglia, otherwise known as spinal ganglia, are known to extend down the spinal column. These nerves can be injured as a result of spinal injury. Such peripheral nerve damage associated with spinal cord injury can also benefit from neuron axonal outgrowth produced by the methods described herein. In some embodiments, the neurons are in the spinal cord. In some embodiments, the neurons are in the optic nerve. In some embodiments, the neurons are axotomized neurons (for example during surgery). In some embodiments, the neuron is human. In one embodiment, the neuron is a terminally differentiated neuron. In one embodiment, the neuron is an adult neuron (e.g., in a subject that has reached maturity, such as in humans older than 18 years). In one embodiment, the neuron is non-embryonic. In one embodiment, the neuron is in an immature organism (e.g., embryo, infant, child). All mammals are suitable subjects for performance of the methods described herein. In one embodiment, the mammal is a human, non-human primate, companion animal (e.g., dog, cat), livestock animal (e.g., horse, cow, pig, sheep), or rodent (mouse, rat, rabbit). In one embodiment, the subject is a non-human primate animal in a model for neurodegeneration or nervous system (CNS or PNS) injury. Neurons derived from said subjects are also suitable for performance of the methods described herein. In some embodiments, the neurons are injured neurons.

Neuronal Injury

[0163] As used in the art, the term injury refers to damage (e.g., to a system or a cell). Damage to a system is evidenced by aberrant function, reduction of function, loss of function of the system, or loss of essential components (e.g., specialized cells such as neurons). Damage or injury to a specific neuron is also evidenced by aberrant function, loss of function, reduced function, and/or cell death. Some forms of injury to a neuron can be directly detected (e.g., by visualization as with a severed or crushed neuronal axon). Accordingly, in some embodiments, the methods disclosed herein comprises an antecedent step of determining that the neuron is injured and/or has axotomy-induced stress. Neuronal injury can result from a variety of insults, including, but not limited to physical injury (e.g., severing, crushing), toxic effects, atrophy (e.g., due to lack of trophic factors).

[0164] The term neuronal injury as used herein refers to any damage or dysfunction exhibited by neurons, including but not limited to loss of myelin, dendrite retraction, dendritic spine density reduction, axonal damage, loss of axon regeneration and neuronal death. Neuronal injury may be complete loss of a neuron, or loss of a part of the neuron (e.g., an axon). Such damage may results from acute or traumatic injury to the neuron (e.g., crush, severing) such as the result of external physical trauma to the subject (e.g., contusion, laceration, acute spinal cord injury, traumatic brain injury, cortical impact, etc.). Acute or traumatic injury to a neuron can also result from an acute condition, such as stroke, that results in acute ischemia to the neuron resulting in acute injury. The specific location of neuronal injury will vary with the specific cause of the injury, and the specific individual. In one embodiment, the injured CNS neuron is located in CNS white matter, particularly white matter that has been subjected to traumatic injury. The specific location of a lesion to a specific neuron will vary with respect to the injury. In one embodiment, the injury is in the axon or dendrite of a neuron. In on embodiment, the injured neuron is in the spinal cord. In one embodiment, the injured neuron is in the optic nerve.

[0165] Injury to a neuron may also be incurred from a chronic injury (e.g., repetitive stress injury) or condition (e.g., chronic inflammation or disease). Chronic injury leads to neurodegeneration such as caused by neurotoxicity or a neurological disease or disorder (e.g. Huntington's disease, Parkinson's disease, Alzheimer's disease, multiple system atrophy (MSA), etc.).

[0166] In one embodiment of the methods disclosed herein, injured neurons results from an ocular injury or disorder (e.g. toxic amblyopia, optic atrophy, higher visual pathway lesions, disorders of ocular motility, third cranial nerve palsies, fourth cranial nerve palsies, sixth cranial nerve palsies, internuclear ophthalmoplegia, gaze palsies, eye damage from free radicals, etc.), or an optic neuropathy (e.g. ischemic optic neuropathies, toxic optic neuropathies, ocular ischemic syndrome, optic nerve inflammation, infection of the optic nerve, optic neuritis, optic neuropathy, papilledema, papillitis, retrobulbar neuritis, commotio retinae, glaucoma, macular degeneration, retinitis pigmentosa, retinal detachment, retinal tears or holes, diabetic retinopathy, iatrogenic retinopathy, optic nerve drusen, etc.). Injury to a neuron can be detected by the skilled practitioner through a variety of assays known in the art. Loss of function assays can be used to determine neuronal injury. Physical damage to the neuron (e.g., axonal crushing or severing) can sometimes be observed diagnostically through routine methods. One way to detect a lesion is through detection of axotomy-induced stress.

Diseases and Disorders

[0167] The methods and compositions disclosed herein are useful for the treatment of neuronal injury. The methods and compositions of the invention are useful for treatment of diseases or disorders resulting from or leading to the neuronal injury described herein. In some embodiments, the disorder is selected from the group consisting of glaucoma, stroke, head trauma, spinal injury, optic injury, ischemia, hypoxia, neurodegenerative disease, multiple sclerosis, infectious disease, cancer, and autoimmune disease.

[0168] In some embodiments, the methods and compositions described herein can be used specifically to treat damage associated with peripheral neuropathies including, but not limited to, the following: diabetic neuropathies, virus-associated neuropathies, including acquired immunodeficiency syndrome (AIDS) related neuropathy, infectious mononucleosis with polyneuritis, viral hepatitis with polyneuritis; Guillian-Barre syndrome; botulism-related neuropathy; toxic polyneuropathies including lead and alcohol-related neuropathies; nutritional neuropathies including subacute combined degeneration; angiopathic neuropathies including neuropathies associated with systemic lupus erythematosis; sarcoid-associated neuropathy; carcinomatous neuropathy; compression neuropathy (e.g. carpal tunnel syndrome) and hereditary neuropathies, such as Charcot-Marie-Tooth disease, peripheral nerve damage associated with spinal cord injury can also be treated with the present method. The subject is treated in accordance with the present method for CNS or peripheral nerve damage as the result injury, including those listed above. Subjects at risk for developing such CNS or damage are also so treated.

Administration

[0169] Agent of the present disclosure is contacted with the neuron using a suitable drug delivery method and treatment protocol sufficient to promote regeneration of the axon. For in vitro methods, the agent is added to the culture medium, usually at nanomolar or micromolar concentrations. For in vivo applications, the agent can be administered orally, by intravenous (i.v.) bolus, by i.v. infusion, subcutaneously, intramuscularly, ocularly (intraocularly, periocularly, retrobulbarly, intravitreally, subconjunctivally, topically, by subtenon administration, etc.), intracranially, intraperitoneally, intraventricularly, intrathecally, by epidural, etc. Depending on the intended route of delivery, the agent or compositions comprising the agent may be administered in one or more dosage form(s) (e.g. liquid, ointment, solution, suspension, emulsion, tablet, capsule, caplet, lozenge, powder, granules, cachets, douche, suppository, cream, mist, eye drops, gel, inhalant, patch, implant, injectable, infusion, etc.). The dosage forms may include a variety of other ingredients, including binders, solvents, bulking agents, plasticizers etc. In a specific embodiment, the agent is contacted with the neuron using an implantable device that contains the activator and that is specifically adapted for delivery to a CNS axon of neuron. Examples of devices include solid or semi-solid devices such as controlled release biodegradable matrices, fibers, pumps, stents, adsorbable gelatin (e.g. Gelfoam), etc. The device may be loaded with premeasured, discrete and contained amounts of the activator sufficient to promote regeneration of the axon. In a particular embodiment, the device provides continuous contact of the neuron with the activator at nanomolar or micromolar concentrations, preferably for at least 2, 5, or 10 days.

[0170] Administration is to a subject by a route that results in contacting an effective amount of the agents disclosed herein (e.g., agent that increases mitochondrial mobility, Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide) to the target neuron(s). As the term is used herein, the target neuron is the neuron which is intentionally contacted by the administered agent. A target neuron can be an injured neuron or a non-injured neuron (e.g., for compensatory axonal outgrowth to a region of denervation, or used as a control in the methods herein). The target neuron may be contacted at one or more specific target sites of the neuron. As the term is used herein, the target site of the neuron is the region of the neuron to which the agent is intentionally contacted. Regions of the neuron include the dendrites, cell body, and the axon. In some embodiments, the target site of the neuron is the mitochondria of the neuron. Methods for targeting the agents to mitochondria of a cell are known in the art. See for e.g., AAPS J. 2006 June; 8(2): E277-E283., Antioxid Redox Signal. 2011 Dec. 15; 15(12):3021-38, Biochim Biophys Acta. 2008 Jul-Aug;1777(7-8):1028-31, the contents of which are incorporated herein by reference in their entireties. Non-limiting exemplary methods for targeting the agents and compositions disclosed herein to the mitochondria of a neuron can include for e.g., conjugation of an agent with a lipohilic molecular group, encapsulation of agents in a liposome or nanoparticle.

[0171] Since regeneration and axonal generation in the treatment of a neuronal injury includes compensatory promotion of axonal outgrowth of uninjured neurons, benefit is expected from mere delivery of the inhibitors and/or other agents to an injury site. As such, suitable target neurons are actual damaged neurons, and also neurons that are in the immediate area of an injury site or an area of dennervation. The specific location and extent of an injury site can be determined by the skilled practioner. Examples of injury sites are the site of physical damage or disruption of neuronal activity. The immediate area of an injury site will vary with respect to the specific injury, the nature of the injury, and the nature of the injured neurons (e.g., axonal length, specific function, etc.) and can be determined by the skilled practitioner. Typically a lesion is in the axon of the injured neuron. In one embodiment, the immediate area of the injury site is within about 1-10 mm of identified damaged neurons (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mm). In one embodiment, the administration is localized so as to be highly targeted to a specific site. In one embodiment, the administration is systemic, and results in delivery of the appropriate concentration to the specific site.

[0172] Depending on the intended route of delivery, the compositions may be administered in one or more dosage form(s) (e.g. liquid, ointment, solution, suspension, emulsion, tablet, capsule, caplet, lozenge, powder, granules, cachets, douche, suppository, cream, mist, eye drops, gel, inhalant, patch, implant, injectable, infusion, etc.). The dosage forms may include a variety of other ingredients, including binders, solvents, bulking agents, plasticizers etc.

[0173] In a specific embodiment, the inhibitors are contacted with the neuron using an implantable device that contains the inhibitors and that is specifically adapted for delivery to a neuron. Examples of devices include solid or semi-solid devices such as controlled release biodegradable matrices, fibers, pumps, stents, adsorbable gelatin (e.g. Gelfoam), etc. The device may be loaded with premeasured, discrete and contained amounts of the inhibitors sufficient to promote sustained regeneration or sustained survival of the neuron. In one embodiment, the device provides continuous contact of the neuron with the inhibitors at nanomolar or micromolar concentrations, (e.g., for at least 2, 5, or 10 days, or for at least 2, 3, or 4 weeks, or for greater than 4 weeks, e.g., 5, 6, 7, or 8 weeks).

[0174] In one embodiment, administration of an agent disclosed herein to a subject (e.g., in a single or in different pharmaceutical compositions, with or without other agents described herein) results in the inhibitors directly contacting an injured neuron in need of regeneration. In one embodiment, administration results in contacting neurons proximal to a site of neuronal injury. Neurons can be contacted at any point along their length (e.g., at the axon, dendrite and/or the cell body).

[0175] Administration to the subject can be by any one or combination of a variety of methods (e.g., intravenously, intracortically, intracerebrally, intrathecally, intranasally, ocularly, parenterally, enterally and/or topically or locally at the injured neuron.). The appropriate method(s) will depend upon the circumstances of the individual (e.g. the location of the target neuron(s), the condition of the individual, the desired duration of the contact, whether local or systemic treatment is desired). The administration can be by any methods described herein that will result in contact of sufficient agent(s) to the target neuron to promote survival of neuron, axon regeneration, or a combination of both. For instance, parenteral, enteral and topical administration can be used. The phrases parenteral administration and administered parenterally as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, intracortical, intracerebral, intranasal, ocular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrastemal injection and infusion. Enteral administration involves the esophagus, stomach, and small and large intestines (i.e., the gastrointestinal tract). The phrases systemic administration, administered systemically, peripheral administration and administered peripherally as used herein mean the administration of a compound other than directly into the central nervous system, such that it enters the animal's system and, thus, is subject to metabolism and other like processes, for example, subcutaneous administration. Administration may be topical (including ophthalmic, vaginal, rectal, intranasal, epidermal, and transdermal), oral or pulmonary administration, e.g. , by inhalation or insufflation, or intracranial, e.g., intrathecal or intraventricular, administration, topically to the eye, or by intraocular injection.

[0176] Specific routes of administration and the dosage regimen will be determined by skilled clinicians based on factors such as the exact nature of the condition being treated, the severity of the condition, and the age and general physical condition of the patient. Provided herein are methods for promoting survival of neuron, axon regeneration, or a combination of both in an injured neuron of central nervous system neurons following an injury. The method involves administering to a subject an agent that increases mitochondrial motility (e.g., Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding Armcx1 polypeptide to thereby contact the site of injury.

[0177] The term administering to a subject includes dispensing, delivering or applying an active compound in a pharmaceutical formulation to a subject by any suitable route for delivery of the active compound to the desired location in the subject to thereby contact the desired portion(s) of the neuron(s), (e.g., the injury, the injured neuron, or the site of desired outgrowth of the neuron). This includes, without limitation, delivery by either the parenteral or oral route, intramuscular injection, subcutaneous/intradermal injection, intravenous injection, buccal administration, transdermal delivery and administration by the rectal, colonic, vaginal, intranasal or respiratory tract route, intraocular, ocular. Another form of administration suitable for treatment of spinal cord injury is injection into the spinal column or spinal canal. In one embodiment, the agent(s) is contacted in vivo by introduction into the central nervous system of a subject, e.g., into the cerebrospinal fluid of the subject. In certain aspects of the invention, the agent(s) is introduced intrathecally, e.g., into a cerebral ventricle, the lumbar area, or the cisterna magna. In another aspect, the agent(s) is introduced intraocullarly, to thereby contact retinal ganglion cells or the optic nerve. Modes of administration are described in U.S. Pat. No. 7,238,529.

[0178] In one embodiment, administration occurs following neuronal injury in the subject, not prior to or at the time of neuronal injury. In another embodiment of the invention, the agent(s) formulation is administered into a subject intrathecally. As used herein, the term intrathecal administration is intended to include delivering an inhibitor(s) formulation directly into the cerebrospinal fluid of a subject, by techniques including lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like (described in Lazorthes et al. Advances in Drug Delivery Systems and Applications in Neurosurgery, 143-192 and Omaya et al., Cancer Drug Delivery, 1: 169-179, the contents of which are incorporated herein by reference). The term lumbar region is intended to include the area between the third and fourth lumbar (lower back) vertebrae. The term cisterna magna is intended to include the area where the skull ends and the spinal cord begins at the back of the head. The term cerebral ventricle is intended to include the cavities in the brain that are continuous with the central canal of the spinal cord. Administration of an agent(s) to any of the above mentioned sites can be achieved by direct injection of the agent(s) formulation or by the use of infusion pumps. For injection, the agent(s) formulation of the invention can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution or Ringer's solution. In addition, the inhibitor(s) formulation may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included. The injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the agent(s) formulation.

[0179] In one embodiment of the methods and compositions disclosed herein, said agent(s) formulation is administered by lateral cerebroventricular injection into the brain of a subject in the inclusive period from the time of the injury to a time determined by the skilled practitioner (e.g., 100 hours). The injection can be made, for example, through a burr hole made in the subject's skull. In another embodiment, said encapsulated therapeutic agent is administered through a surgically inserted shunt into the cerebral ventricle of a subject in the inclusive period from the time of the injury to a time determined by the skilled practitioner (e.g., 100 hours thereafter). For example, the injection can be made into the lateral ventricles, which are larger, even though injection into the third and fourth smaller ventricles can also be made.

[0180] In yet another embodiment, said agent(s) formulation is administered by injection into the cisterna magna, or lumbar area of a subject in the inclusive period from the time of the injury to a time determined by the skilled practitioner (e.g.,100 hours thereafter). Administration can be continuous, or can be by repeated doses. In one embodiment, the repeated doses are formulated so that an effective amount of the inhibitors is continually present at the injury site.

[0181] Viral and non-viral-based gene transfer methods can be used to introduce nucleic acids encoding Armcx1 polypeptides to cells or target tissues of the subject. Such methods can be used to administer nucleic acids encoding Armcx1 polypeptides to cells in vitro. Alternatively, or in addition, such polynucleotides can be administered for in vivo or ex vivo gene therapy uses. Non-viral vector delivery systems include DNA plasmids, naked nucleic acid, and nucleic acid complexed with, for example, a liposome or other delivery vehicle. Viral vector delivery systems include both DNA and RNA viruses, and can have either episomal or integrated genomes after delivery to the cell. Gene therapy procedures are described, for example, in Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bhm (eds) (1995); and Yu et al., Gene Therapy 1:13-26 (1994).

[0182] Methods of non-viral delivery of nucleic acids encoding engineered polypeptides of the invention include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described, e.g., in U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355, and lipofection reagents are sold commercially (e.g., Transfectam and Lipofectin). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424, WO 91/16024. Delivery can be to cells (ex vivo administration) or target tissues (in vivo administration). The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res.52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).

[0183] RNA or DNA viral based systems can be used to target the delivery of polynucleotides carried by the virus to specific cells in the body and deliver the polynucleotides to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to transfect cells in vitro. In some cases, the transfected cells are administered to patients (ex vivo). Conventional viral based systems for the delivery of polypeptides of the invention could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Viral vectors are currently the most efficient and versatile method of gene transfer in target cells and tissues. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene, and high transduction efficiencies.

[0184] In one respect, the present invention relates to the herein described compositions, methods, and respective component(s) thereof, as essential to the invention, yet open to the inclusion of unspecified elements, essential or not (comprising). In some embodiments, other elements to be included in the description of the composition, method or respective component thereof are limited to those that do not materially affect the basic and novel characteristic(s) of the invention (consisting essentially of). This applies equally to steps within a described method as well as compositions and components therein. In other embodiments, the inventions, compositions, methods, and respective components thereof, described herein are intended to be exclusive of any element not deemed an essential element to the component, composition or method (consisting of).

[0185] All patents, patent applications, and publications identified are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the present invention. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.

[0186] The present invention may be as defined in any of the following numbered paragraphs: [0187] 1. A method for promoting survival of, or axon regeneration in an injured mature central nervous system (CNS) neuron comprising contacting the neuron with an effective amount of an agent capable of increasing mitochondrial motility in the injured neuron, thereby promoting survival of, or axon regeneration in the injured neuron. [0188] 2. The method of paragraph 1, further comprising detecting the resultant promotion of the survival of, or axon regeneration in the injured neuron in the subject. [0189] 3. The method of any one of paragraphs 1-2, wherein the injured neuron results from traumatic injury, traumatic brain injury, optic nerve injury, acute spinal cord injury, stroke, restorative CNS surgery or CNS degeneration. [0190] 4. The method of any one of paragraphs 1-3, wherein the injured neuron is a sensory neuron. [0191] 5. The method of any one of paragraphs 1-4, wherein the injured neuron is in the spinal cord. [0192] 6. The method of any one of paragraphs 1-4, wherein the injured neuron is in the optic nerve. [0193] 7. The method of any one of paragraphs 1-6, wherein the agent is administered intravenously, intracortically, intracerebrally, intrathecally, intranasally, ocularly or locally at the injured neuron. [0194] 8. The method of any one of paragraphs 1-7, wherein the agent is Armcx1 polypeptide. [0195] 9. The method of paragraph 8, wherein the Armcx1 polypeptide is recombinant. [0196] 10. The method of any one of paragraphs 8-9, wherein the Armxc1 polypeptide comprises a carrier peptide or lipophilic molecular group and/or is encapsulated in a liposome or a nanoparticle. [0197] 11. The method of any one of paragraphs 1-7, wherein the agent is a vector comprising a nucleic acid sequence that encodes a Armcx1 polypeptide. [0198] 12. The method of paragraph 11, wherein the vector is a viral vector or non-viral vector. [0199] 13. The method of paragraph 12, wherein the viral vector is selected from the group consisting of retrovirus, lentivirus, adenovirus, herpesvirus, poxvirus, alpha virus, vaccinia virus, and adeno-associated viruses. [0200] 14. The method of paragraph 12, wherein the non-viral vector is selected from the group consisting of a nanoparticle, a cationic lipid, a cationic polymer, a metallic nanoparticle, a nanorod, a liposome, microbubbles, a cell penetrating peptide and a liposphere. [0201] 15. The method of any one of paragraphs 8-14, wherein the Armcx1 polypeptide is of human origin. [0202] 16. The method of any one of paragraphs 8-15, wherein the Armcx1 polypeptide comprises the sequence of SEQ ID NO:1. [0203] 17. The method of any one of paragraphs 8-16, wherein the Armcx1 polypeptide has at least 95% amino acid sequence identity to SEQ ID NO:1 and retains at least 80% of the biological activity of human Armcx1 of SEQ ID NO:1. [0204] 18. The method of any one of paragraphs 2-17, wherein the detecting step is effected by an indirect assay of axon regeneration. [0205] 19. The method of any one of paragraphs 2-17, wherein the detecting step is effected by a direct assay of axon regeneration. [0206] 20. The method of any one of paragraphs 1-19, further comprising an antecedent step of determining that the neuron is injured, and has axotomy-induced stress. [0207] 21. The method of any one of paragraphs 1-20, further comprising contacting the injured neuron with a PTEN inhibitor, inhibitor of suppressor of cytokine signaling 3 (SOC S3), inosine, oncomodulin, BNDF, NGF, CNTF, or combinations thereof. [0208] 22. The method of paragraph 21, wherein the inhibitor of SOCS3 comprises a SOCS3 specific hpRNA or siRNA. [0209] 23. The method of paragraph 21, wherein the PTEN inhibitor is, [0210] (a) potassium bisperoxo(bipyridine)oxovanadate (V) (bpV(bipy)); [0211] (b) dipotassium bisperoxo(5-hydroxypyridine-2-carboxyl)oxovanadate (V) (bpV(HOpic)); [0212] (c) potassium bisperoxo(1,10-phenanthroline)oxovanadate (V), (bpV(phen)); or [0213] (d) dipotassium bisperoxo(picolinato)oxovanadate (V), (bpV(pic)). [0214] 24. The method of any one of paragraphs 1-23, wherein the neuron is human. [0215] 25. A method of treating a subject for neuronal injury, comprising:

[0216] administering to the subject an agent that increases mitochondrial motility in injured neurons, wherein the administering results in contacting the injured neurons of the subject with the agent in an amount sufficient to promote survival of, or axon regeneration in the injured neurons, such that the subject is treated. [0217] 26. The method of paragraph 25, wherein the agent is administered intravenously, intracortically, intracerebrally, intrathecally, intranasally, ocularly or locally at the site of neuronal injury. [0218] 27. The method of any one of paragraphs 1-26, wherein the neuronal injury results from a traumatic injury, traumatic brain injury, optic nerve injury, acute spinal cord injury, stroke, restorative CNS surgery or CNS degeneration. [0219] 28. The method of paragraph 27, wherein the neuronal injury results from restorative CNS injury and wherein the agent is administered prior to, during or following restorative CNS surgery. [0220] 29. The method of any one of paragraphs 25-28, wherein the agent is Armcx1 polypeptide. [0221] 30. The method of paragraph 29, wherein the Armcx1 polypeptide is recombinant. [0222] 31. The method of any one of paragraphs 28-30, wherein the Armxc1 polypeptide comprises a carrier peptide or lipophilic molecular group and/or is encapsulated in a liposome or a nanoparticle. [0223] 32. The method of any one of paragraphs 25-28, wherein the agent is a vector comprising a nucleic acid sequence that encodes a Armcx1 polypeptide. [0224] 33. The method of paragraph 32, wherein the vector is a viral vector or non-viral vector. [0225] 34. The method of paragraph 33, wherein the viral vector is selected from the group consisting of retrovirus, lentivirus, adenovirus, herpesvirus, poxvirus, alpha virus, vaccinia virus, and adeno-associated viruses. [0226] 35. The method of paragraph 33, wherein the non-viral vector is selected from the group consisting of a nanoparticle, a cationic lipid, a cationic polymer, a metallic nanoparticle, a nanorod, a liposome, microbubbles, a cell penetrating peptide and a liposphere. [0227] 36. The method of any one of paragraphs 29-35, wherein the Armcx1 polypeptide is of human origin. [0228] 37. The method of any one of paragraphs 29-36, wherein the Armcx1 polypeptide comprises the sequence of SEQ ID NO:1. [0229] 38. The method of any one of paragraphs 29-37, wherein the Armcx1 polypeptide has at least 95% amino acid sequence identity to SEQ ID NO:1 and retains at least 80% of the biological activity of human Armcx1 of SEQ ID NO:1. [0230] 39. A method of treating a subject for a disease or disorder characterized by neuronal death or diminished potential for axonal growth, comprising administering to the subject an agent that increases mitochondrial motility, in an amount sufficient to promote survival of, or axonal growth in neurons, such that the subject is treated. [0231] 40. The method of paragraph 39, wherein the disorder is selected from group comprising of glaucoma, stroke, head trauma, spinal injury, optic injury, ischemia, hypoxia, neurodegenerative disease, multiple sclerosis, infectious disease, cancer, and autoimmune disease.

[0232] 41. The method of paragraph 39-40, wherein the agent is Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding an Armcx1 polypeptide.

[0233] 42. A method for promoting survival of, or axon regeneration in an injured mature central nervous system neuron in a subject determined to have a neuronal injury, the method comprising, administering to the subject Armcx1 polypeptide or an analog thereof in an amount sufficient to promote survival of, or axon regeneration of the injured neuron.

[0234] 43. A device for promoting survival of, or axon regeneration in an injured mature central nervous system (CNS) neuron comprising a therapeutically effective amount of an agent that increases mitochondrial motility in the neuron, and wherein the device locally releases the agent into the CNS for promoting survival of, or axon regeneration in an injured mature central system (CNS) neuron.

[0235] 44. The device of paragraph 43, comprising a CNS-implantable solid or semi-solid device selected from a biodegradable matrix, fiber, pump, stent, adsorbable gelatin osmotic pump or indwelling catheter.

[0236] 45. A pharmaceutical composition comprising an effective amount of Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding the Armcx1 polypeptide and a pharmaceutically acceptable carrier, for use in promoting survival of, or regeneration of axon in injured neurons.

[0237] 46. The pharmaceutical composition of paragraph 45, wherein the Armcx1 polypeptide is of human origin.

[0238] 47. The pharmaceutical composition of any one of paragraphs 45-46, wherein the Armcx1 polypeptide comprises the sequence of SEQ ID NO:1. [0239] 48. The pharmaceutical composition of any one of paragraphs 45-47, wherein the Armcx1 polypeptide has at least 95% amino acid sequence identity to SEQ ID NO:1 and retains at least 80% of the biological activity of human Armcx1 of SEQ ID NO:1. [0240] 49. The pharmaceutical composition of any one of paragraphs 45-48, wherein the Armcx1 polypeptide is fused to a carrier polypeptide. [0241] 50. The pharmaceutical composition of any one of paragraphs 45-49, wherein the vector is a viral or non-viral vector. [0242] 51. The pharmaceutical composition of paragraph 50, wherein the viral vector is selected from the group consisting of retrovirus, lentivirus, adenovirus, herpesvirus, poxvirus, alpha virus, vaccinia virus, and adeno-associated viruses. [0243] 52. The pharmaceutical composition of paragraph 50, wherein the non-viral vector is selected from the group consisting of a nanoparticle, a cationic lipid, a cationic polymer, a metallic nanoparticle, a nanorod, a liposome, microbubbles, a cell penetrating peptide and a liposphere. [0244] 53. The pharmaceutical composition of any one of paragraphs 45-52, wherein the Armcx1 polypeptide or the vector comprising a nucleic acid sequence encoding the Armcx1 polypeptide is formulated with a lipophilic molecular group and/or encapsulated in a liposome or a nanoparticle. [0245] 54. The pharmaceutical composition of any one of paragraphs 45-53, formulated for administration to the brain, spinal cord, or optical nerve. [0246] 55. The pharmaceutical composition of any one of paragraphs 45-54, wherein the composition is formulated for administration via intracerebroventricular, intranasal, intracranial, intracelial, intracerebellar, or intrathecal administration route. [0247] 56. The pharmaceutical composition of any one of paragraphs 45-55, wherein the composition is contained in a delivery device selected from the group consisting of a syringe, a blunt tip syringe, a catheter, an inhaler, a nebulizer, a nasal spray pump, a nasal irrigation pump or nasal lavage pump, and an implantable pump. [0248] 57. A pharmaceutical composition comprising an agent that increases mitochondrial motility in injured neuron and a pharmaceutically acceptable carrier, for use in promoting survival of, or regeneration of axon in injured neurons. [0249] 58. The pharmaceutical composition of paragraph 57, wherein the agent is Armcx1 polypeptide or a vector comprising a nucleic acid sequence encoding the Armcx1 polypeptide. [0250] 59. A pharmaceutical composition formulated for ocular administration to a subject in need thereof, comprising an effective amount of Armcx1 polypeptide or a vector comprising nucleic acid sequence encoding the Armcx1 polypeptide, wherein the effective amount is the amount required for promoting survival of, or axon regeneration of axon in an injured mature CNS neuron in the subject. [0251] 60. A method for identifying an agent effective in promoting survival of, or axon regeneration in neurons after injury, the method comprising: [0252] (a) contacting a neuron with a candidate agent; [0253] (b) determining expression level of Armcx1 in the neurons from step (a); and [0254] (c) identifying the candidate agent as effective if the expression level of Armcx1 is increased relative to a reference level upon the contact of the neuron with the candidate agent; or identifying the candidate agent as ineffective if the expression level of Armcx1 is not changed relative to a reference level upon the contact of the neuron with the candidate agent. [0255] 61. The method of paragraph 59, wherein the reference level is expression level of Armcx1 in neurons prior to contact with the candidate agent. [0256] 62. The method of any one of paragraphs 59-60, wherein the contacting is in vitro or in vivo.

[0257] It is understood that the foregoing detailed description and the following examples are illustrative only and are not to be taken as limitations upon the scope of the invention. Various changes and modifications to the disclosed embodiments, which will be apparent to those of skill in the art, may be made without departing from the spirit and scope of the invention. Further, all patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.

EXAMPLES

[0258] The following examples illustrate some embodiments and aspects of the invention. It will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be performed without altering the spirit or scope of the invention, and such modifications and variations are encompassed within the scope of the invention as defined in the claims which follow. The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.

Experimental Procedure

[0259] Mouse Strains. PTEN.sup.f/f; SOCS3.sup.f/f mice were obtained by breeding PTEN.sup.f/f (Park et al., 2008) and SOCS3.sup.f/f (Smith et al., 2009). Kcng4-cre; Thy1-stop-YFP line was a kind gift from Josh Sanes laboratory (Duan et al., 2015). For Bc1-2 experiments, because of mouse strain availability we used the Bc1-2/PTEN.sup.f/f/SOCS3.sup.f/f line (Bei et al. 2016). Without expressing the Cre recombinase this line show no axon regeneration ((Bei et al. 2016) and FIG. S4D) and is considered as base line controls. Throughout all paper dKO conditions used as a model of high regeneration refers to PTEN.sup.f/f; SOCS3.sup.f/f mice+AAV Cre+AAV CNTF (Sun et al., 2012). CNTF is used to potentiate the effect of SOCS3 deletion alone (Smith et al., 2009).

[0260] Constructs. The Armcx1-HA, Armcx1ATM-HA, PLAP and Armcx1F2AGFP vectors were generated from the pAAV-MCS constructs (Stratagene). For shRNA Armcx1 constructs, two targeting sequences against Armcx1 (shRNA2; targeting sequence GAGAGGCAAACCTCAAGATGACTC and shRNA5; TCAGTCAAGTGTGTGACGATACC were cloned into pAAV-Armcx1-2in-shRNA-mCherry vector from ViGene Biosciences. The construct was generated by ViGene Sciences, Inc. Control shRNA Scramble construct was generated from the pAAV-U6-GFP (Cellbiolabs).

[0261] Retina Explant culture. P21 PTEN.sup.f/f mice were injected with AAV2-Cre and AAV2-PLAP (placental phosphatase alkaline) as control, AAV2-Armcx1HA or AAV2-Armcx1HATM. 2 weeks after, retinas were dissected out in Hibernate-A (Brain Bits). Retina explants were then plated onto Poly-L-Lysin (Sigma) and Laminin (Sigma) coated glass bottom dishes (MatTek) in Neurobasal-A (Life Technology) supplemented with B-27 (Life Technology), L-Glutamine (Life Technology) and Penicillin/Streptomycin (Life Technology). To evaluate axonal outgrowth, explants were fixed in PFA 4%/Sucrose 1,5% in PBS after 2 weeks and labeled with primary antibody anti-Tuj1 (Covance Research Products Inc Cat # MMS-435P, RRID:AB_2313773 or Covance Research Products Inc Cat # MRB-435P-100, RRID:AB_10175616), secondary antibody Alexa-488 (1/400-Life Technology). For live imaging experiments, explant were incubated with tetramethylrhodamine methyl ester (TMRM) (Life Technologies) as described in (Verburg and Hollenbeck, 2008).

[0262] In situ hybridization and Immunohistochemistry. Animals were perfused intracardially with PBS followed by paraformaldehyde (PFA-Sigma) 4% in PBS (w/v). After dissection, tissues were post fixed in PFA 4% in PBS overnight at 4 C. and then incubated in Sucrose (Sigma) 15% in PBS for 48 h at 4 C. Samples were embedded in Tissu-Tek and frozen at 80 C. Eyes were sectioned by cryostat at 20 um. In situ hybridization was performed following classical protocol as described in (Nawabi et al., 2010). For Immunohistochemistry of whole mount retina, retinas from perfused animals were washed in PBS and blocked in 96 wells plates with PBS-Triton 0.3%-BSA 2% during one hour. Antibodies against HA (Roche Cat #11867431001, RRID:AB_390919) and Tuj1 (Covance Research Products Inc Cat # MRB-435P-100, RRID:AB_10175616) were apply on retina in blocking buffer and apply on retina overnight at 4 C. After PBS wash, retinas were incubated for a minimum of 2 hours at room temperature with Alexa secondary antibodies, washed with PBS and mount with fluoromount (SouthernBiotech). Retinas cross sections for immunohistochemistry study of Armcx1 was prepared as described above. Immunohistochemistry using Armcx1 antibody (Abeam Cat # ab65144, RRID: AB_1141088) was performed using Tyramide Signal Amplification system (TSA, Perkin Elmer) following manufacturer protocol. Tuj1 positive RGCs (Covance Research Products Inc Cat # MMS-435P, RRID:AB 2313773) were determined positive for Armcx1 when signal intensity was minimum 60% above background.

[0263] Cortical neurons culture and transfection. Cortical neurons were isolated from E18 mouse embryo (Charles River). Briefly, cortices were chemically dissociated in papain solution (Worthington Biochemicals) for 10mn at 37 C. followed by two wash in trypsin inhibition solution (Sigma T9253) and mechanical dissociation using P1000 plastic tip in plain Neurobasal medium (Life Technology). Dissection, dissociation and wash were done in HBSS (Gibco 1470-112) with 45% glucose and kynurenic acid (Sigma K3375) solution (HBSS, kyuneric acid 10 mM, 100 mM Hepes, 100 mM MgCl2). Cells were plated on poly-1-lysine hydrobromide (Sigma) coated 35 mm glass bottom dish (MatTek, (90000 cells/wells). Neurons were cultured in Neurobasal medium (Life Technology) supplemented with B-27 (Life Technology), L-Glutamine (Life Technology) and Penicillin/Streptomycin (Life Technology). Half of the medium was replaced every other day. Plasmid DNA transfections were performed using Lipofectamin 2000 (Invitrogen) following manufacturer procedure. We used 0.3 g of vector GFP, AAV-Armcx1F2AGFP, MitoDsred2 (Promega) and 0.5 g of shRNA plasmids. To study mitochondrial and BDNF positive vesicles transport neurons were transfected at DIV 5. At DIV7 the culture medium was replaced by Hibernate E low fluorescence (BrainBites) to maintain cell viability in CO2- free conditions during live imaging. For neurites outgrowth experiments, neurons were transfected at DIV1.

[0264] Cortical Neurons Immunohistochemistry. For immunohistochemistry of cortical neurons, DIV 5-7 neurons were fixed with 4% PFA/1.5% Sucrose in PBS and immunostained using standard procedure (Glater et al., 2006). Briefly, fixed neurons in glass bottom dish were incubated for 5mn in PBS-Triton 0.3% followed by 1 hour in blocking solution (NGS 10%, Triton 0.1% in PBS). Primary antibodies against HA (Roche Cat # 11867431001, RRID:AB_390919), GFP (Abcam Cat # ab13970, RRID:AB_300798) or RFP (Abcam Cat # ab62341, RRID:AB_945213) were incubated overnight. After PBS wash, secondary anti-rat antibody (1/400, Life Technologies) was added for 1 hour. Cover slips were mounted using Fuoromount-G (SouthernBiotech).

[0265] Protein analyses and Co-immunoprecipitation. For Western blot analyzing of Armcx1 constructs, proteins were extracted from Lipofectamin transfected HEK cells (0.5 g of DNA) and immunoblot was performed as described in (Cartoni et al., 2005) with minor modifications. Co-immunoprecipation was performed as described in (Lpez-Domnech et al., 2012). Briefly, HEK cells were transfected with 2.5 g of each plasmid. 3 days later, cells were lysed in lysis buffer (Tris-HCl pH: 7.5, NaCl 150 mM, MgCl2 1.5 mM, EDTA 5 mM Triton 1%, Glycerol 10% and protease inhibitor cocktail). Immunoprecipitation was performed using Dynabeads Protein G (Novex 10003D) and following manufacturer protocol including mixing beads with 20 g of antibody (Roche Cat # 11867431001, RRID:AB_390919) for 10 mn on wheels at room temperature and a 1 hour incubation at room temperature with the cell homogenate. For elution a wash buffer was used (TrisHCl pH: 8, NaCl 500 mM, EDTA 1 mM, EGTA 1 mM, Triton 1%, NP-40 0.5%).

[0266] Live imaging. Adult retina explants. Time-lapse movies were acquired on a PerkinElmer Spinning Disc confocal microscope equipped with a temperature-controlled chamber at 37 C. and with a 20oil objective. Each frame was captured every 2 s. and 60 frames were acquired in total for each recording with laser power set to 30% for each channel to minimize damage. A portion of 80-120 m of axon located 150 m from the tip was selected for analysis. Volocity software (PerkinElmer) was used for live recording. For both the retina explant and the cortical neuron images, a custom-made Image J macro was used for kymograph based motility analysis as described in (Pekkurnaz et al., 2014). Image J raw data were extracted as excel spreadsheets (Microsoft Excel) and statistical analysis was performed with GraphPad Prism version 6.0 for Mac OS X (GraphPad Software, Inc., La Jolla, Calif., USA). E18 cortical neurons. Neurons were transferred into pre-warmed Hibernate medium without phenol red, which buffers CO2 (Brain Bits). Transfected axons were detected using the GFP channel. Single axons were imaged on an inverted Nikon Eclipse Ti-U microscope and 1 frame was captured every 2 s. 60 frames were acquired in total for each recording.

[0267] Mitochondrial transport analysis. From the kymograph generated by the live imaging files, mitochondrial transport was analyzed as in (Pekkurnaz et al., 2014). Briefly, mitochondria were defined as motile when the average of the instantaneous velocity was higher than 0.05 m/s (Wang and Schwarz, 2009). Mitochondria whose velocity was equal or lower than this threshold were considered as stationary. The moving frequency was defined as the percentage of time each mitochondrion spent in motion during the time of the recording and was calculated by dividing the time spent in motion by the total recording time. Hence, the motile pool of mitochondria were the mitochondria with a moving frequency higher than 0. The moving frequency of the motile mitochondria was calculated by excluding the stationary mitochondria. The moving frequency of individual mitochondria was used for statistical analysis. For the percentage of mitochondria in motion per axons, statistics were done on the number of axons. The density of mitochondria in axons was calculated by counting the number of mitochondria on the first frame of the recording used for mitochondrial transport analysis normalized by the length of the axons.

[0268] Surgical procedures. All experiments procedures were performed in compliance with animal protocols approved by the IACUC at Boston Children's Hospital. For all procedures, mice were anaesthetized with ketamine and pyrazine. Eye ointment containing atropine sulfate was applied to protect the cornea during surgery. Animals received Buprenorphine (0.05 mg/kg, Bedford lab) for 24 hours as post-operative analgesic. Surgical procedures were achieved as described in (Park et al., 2008). AAV virus injection: 1 uL of AAV2 viruses were injected into the right eye of the different mice lines. A glass micropipette was inserted to peripheral retina, behind or a serrate in a way to avoid damage to the lens. When two viruses were injected, viruses were mixed and injected at the same time. The following viruses were used: AAV2-Cre, AAV2-PLAP, AAV2-Armcx1HA, AAV2-Armcx1HATM, AAV2-CNTF, AAV2-shRNA Scramble and AAV2-shRNA Armcx1. The titers of the viruses were comprised between 10.sup.12-10.sup.13gc/mL. Viruses were produced at the Boston Children's Hospital viral core. Optic nerve injury: Four weeks following AAV2 injection (5 weeks for AAV-shRNAs), the right optic nerve was exposed intraorbitally and crushed with forceps (Dumont #5 FST) for 5 seconds approximately 1 mm behind the eye ball. RGC anterograde labeling: 2-3 days before animals were euthanized, 1.5 ul of cholera toxin subunit (CTB-2 ug/ul, in sterile PBS-Life Technologies) coupled with Alexa-555 (CTB-Alexa-555) was injected into the vitreous with Hamilton syringe (Hamilton) to label axons in optic nerve.

[0269] Axon regeneration imaging and quantification. Optic nerves cryo-sections of 14 m thick were imaged with a 20objective using a PerkinElmer Spinning Disc confocal microscope equipped with a motorized stage and Volocity software (Perkin Elmer). For each nerve section, Z-projected to maximum intensity stacked images were stitched together with a 20% of overlap between each image to generate a single picture of the whole optic nerve. Regenerating axons were quantified as described in (Park et al., 2008). For whole mount optic nerve imaging, the protocol described in (Pernet et al., 2013) was followed with minor modifications. Briefly, optic nerves from perfused mice were post-fixed overnight washed three times 10 mn in PBS and incubated at room temperature for 20 min in increasing concentration of ethanol (50%, 80%, 95%, 100%). Nerves were kept at 4 C. overnight in ethanol 100% with constant agitation. Nerves were then put in Hexan (Sigma) for 3 hours at room temperature on a shaker. The clearing was completed by replacing Hexan by a solution of Benzyl alcohol/Benzyl Benzoate (1:2). Nerves were stored in the dark at room temperature in this final solution. For imaging, we used PerkinElmer Spinning Disc confocal microscope equipped with 20objective and a motorized stage and Volocity software (Perkin Elmer). The whole nerve was acquired using optical sections of 2 m and stitched images of the Z stacks projections to maximum intensity.

[0270] RGC survival imaging and quantification. Whole mount retinas were immunostained with anti-Tuj1 antibody (Covance Research Products Inc Cat # MMS-435P, RRID:AB_2313773 or Covance Research Products Inc Cat # MRB-435P-100, RRID:AB_10175616). Because of the layering pattern of the retina with the RGCs layer sitting on the top of a whole mount preparation, Tuj1 staining efficiently labeled RGCs (Belin et al., 2015; Nawabi et al., 2015; Park et al., 2008; Smith et al., 2009). Pictures from 10 regions per retina were taken under an epifluorescence microscope (Nikon 80i- 20objective). Tuj1 positive RGCs were counted in intact and injured eye for each animal. The number of Tuj1 positive RGCs in intact eye of each animal was considered as 100% for this particular animal and was compared to its injured eye to quantify the survival.

[0271] Statistical Analysis. Statistical analysis was performed with GraphPad Prism v6.0. Normality tests were run to assess the distribution of the data to be statistically analyzed. Non normal distributions were analyzed using non-parametric test: Mann-Whitney U test was used to determine the significance of differences between two conditions and the Kruskal-Wallis nonparametric ANOVA test when multiple conditions were compared. Normal distributions were analyzed using parametric test: Student's t-test was used to determine the significance of differences between two conditions and the one-way ANOVA test with Tuckey's multiple comparison test unless otherwise specified. p<0.05 was considered significant. For box plot graph, whiskers represent the maximum and minimum of the distribution and the horizontal bar in the box the median. For bar plots, all data are shown as mean +/SEM.

Results

Armcx1 Expression is Up-Regulated in RGCs with High Regenerative Capacity

[0272] Because of the essential role of mitochondria in axonal physiology, using a loss of function approach to determine how regulators of mitochondrial dynamics influence axon regeneration might be difficult to interpret. Instead, that neurons characterized by a high regenerative capacity after axonal injury were thought to constitute an ideal starting point to identify mitochondrial transport regulators involved in axon regeneration. In previous studies (Sun et al., 2012), gene expression profiles were compared in injured RGCs with poor regenerative ability (wild type mice) and with induced high regenerative ability, referred to in this paper as the dKO model (PTENf/f; SOCS3f/f mice with vitreous injection of AAVs expressing Cre (AAV-Cre) and CNTF (AAV-CNTF), CNTF being used to further elevate the Jak/STAT signaling after SOCS3 deletion, Smith et al., 2009; Sun et al., 2012). From these datasets, no genes that have previously been implicated in mitochondrial transport, such as Milton or Miro, were found to be differentially expressed in these neurons with different regenerative ability. However, Armcx1, a member of a cluster of genes in which a family member, Armcx3, had been implicated in regulating mitochondrial transport (Lopez-Domnech et al., 2012), appeared to be highly expressed in injured RGCs with induced regenerative ability (Sun et al., 2012).

[0273] The expression of Armcx1 and its paralogs in RGCs was first verified by in situ hybridization. As shown in FIG. 1A, low levels of Armcx1 signal were detected in some RGCs of wild type mice, which were not affected by injury. In stark contrast, 3 days after injury, Armcx1 signal was significantly increased in the RGCs of the PTENf/f; SOCS3f/fmice with vitreous injection of AAV-Cre and CNTF (dKO), but not of PTENf/fmice with vitreous injection of AAV-Cre (PTEN-/-), consistent with the gene profiling results (Sun et al., 2012). In comparison, other Armcx members, including 3, 5, and 6, were expressed at low levels in all conditions (FIG. 7). The up-regulation of Armcx1 in dKO injured RGCs was further supported by immunohistochemistry (FIGS. 1B and 1C), which showed that RGCs positively stained with anti-Armcx1 increased approximately two-fold in the dKO after injury compared to other conditions (FIG. 1C; 40% in injured dKO compared to 20% in other conditions). Based on these results, Armcx1 was selected for further studies.

Armcx1 Localizes to Mitochondria and Interacts with Mitochondrial Transport Machinery

[0274] Similar to other members of the Armcx cluster, Armcx1 has a putative mitochondrial outer membrane-targeting sequence flanking the trans-membrane (TM) domain (FIG. 1D) (Mou et al., 2009). A mutant of Armcx1 was designed that lacks its transmembrane domain, Armcx1TM (FIGS. 1D and 1E) and assessed the localization of Armcx1 and Armcx1TM by co-transfecting HA-tagged Armcx1 or Armcx1TM with the mitochondrial marker MitoDsRed in mouse cortical neurons. The vast majority of Armcx1 protein was shown to be was targeted to mitochondria (FIG. 1F and FIG. 7B), while the absence of the TM domain of Armcx1 prevented its mitochondrial localization (FIG. 1G and FIG. 7B).

[0275] Armcx3 was recently shown to regulate mitochondrial transport by interacting with the mitochondria trafficking regulatory complex that connects mitochondria to the motor proteins (Lopez-Domnech et al., 2012), but the role of Armcx1 is unknown. Co-immunoprecipitation using Armcx1-HA and Mirol-Myc showed that Armcx1 interacted with Mirol (FIG. 1H), the protein linking mitochondria to the Trak1-Kinesin motor complex. Together, these results indicate that the mitochondria-localized Armcx1 protein is up-regulated in RGCs with induced regenerative ability and suggest that Armcx1 might be a candidate in regulating mitochondrial trafficking.

Armcx1 Overexpression Enhances Mitochondrial Transport in Adult RGC Axons

[0276] Axona1 mitochondria are distributed in two pools: the motile pool, which can move bi-directionally and may pause before resuming movement, and the stationary pool, which is fixed in position typically for the observable duration of an experiment. The proportion of these two pools has been suggested as an important indicator of mitochondrial trafficking in axons (Schwarz, 2013). As a first step to assess the role of Armcx1 in the injury responses of adult RGCs, we examined whether enhancing the expression of Armcx1 would increase mitochondrial transport in adult RGC axons using retina explant cultures coupled with live imaging microscopy. Because of the poor neuronal survival and neurite growth of adult wild type retinal explants, we took advantage of the PTEN-/-mice whose RGCs showed better survival and axonal outgrowth in explant cultures (Nawabi et al., 2015). Since PTEN deletion alone did not significantly increase Armcx1 levels (FIG. 1A), this mutant is suitable for assessing the effects of overexpressed Armcx1. PTENf/f adult mice were intravitreally injected with AAV-Cre and AAVs expressing either full length Armcx1 or the Armcx1TM mutant. As a control, AAV expressing placental alkaline phosphatase (PLAP), a well-established non-fluorescent and inert control for viral injection (Bei et al.; Belin et al., 2015; Nawabi et al., 2015), was used . Immunohistochemistry on whole mount retina confirmed the efficient infection of RGCs by AAVs encoding Armcx1 full length and mutant (FIG. 8A and 8B). To confirm that multiple viral co-injections allowed efficient targeting of RGCs in explant culture, AAV expressing a mitochondrial protein (Cre-dependent MitoDsRed; AAV2-FLEX-MitoDsRed) was co-injected with AAV-Cre to the vitreous body of PTENf/fmice. This showed that the vast majority of the neurites growing out of the resultant explants were MitoDsRed positive (FIG. 8C).

[0277] The proportion of motile versus stationary mitochondria in axons overexpressing Armcx1 was assessed using live recording of mitochondrial transport. Unlike dissociated neuronal culture in which the morphology of mitochondria in the soma is used to confirm neuronal health prior to imaging, explant culture does not allow access to RGC cell bodies. To circumvent this issue, mitochondrial membrane potential was used as a marker of axonal health by labeling mitochondria with tetramethylrhodamine methyl ester (TMRM), a membrane potential dependent fluorescent dye (Trushina et al., 2012; Verburg and Hollenbeck, 2008; Zhang et al., 2016). Armcx1 overexpression induced a significant increase of the motile mitochondria pool compared to the PLAP control (FIGS. 2A and 2B). In contrast, the mutant Armcx1TM failed to do so (FIGS. 2A, 2B), suggesting that the effect of Armcx1 on mitochondrial motility is dependent on its mitochondrial localization. Consistent with the increase of the motile mitochondrial pool, Armcx1 overexpression increased the moving frequency of the total pool of mitochondria, i.e. the fraction of time mitochondria in motion rather than paused (FIG. 2C). To further determine whether the overexpression of Armcx1 increased the transport of mitochondria from the motile pool, we specifically analyzed the moving frequency of this pool and did not observe any difference between control and Armcx1 overexpression (FIG. 8D). Since Armcx1 overexpression increased the proportion of motile mitochondria with no accompanying changes of mitochondrial density (FIG. 2D), Armcx1 was concluded to likely increase mitochondrial transport by recruiting stationary mitochondria into the motile pool.

Armcx1 Promotes Retinal Neurite Outgrowth

[0278] In addition to mitochondrial movement, the effects of Armcx1 on neurite outgrowth was also assessed from these retinal explants. Immunohistochemistry against the neuronal marker Tuj1 revealed that Armcx1 overexpression triggered a substantial increase in axons growing out of the explants (FIGS. 2E-2G) independent of their size (FIG. 2F). Detailed analysis showed that the Armcx1-induced axonal outgrowth was more evident at short distances (FIG. 2E lower panel and FIG. 2G). Consistent with the mitochondrial transport data, the overexpression of the non-mitochondrial Armcx1 mutant (Armcx1TM) failed to reproduce the outgrowth phenotype observed with full length Armcx1 (FIGS. 2E-2G), suggesting a direct link between Armcx1 localization on mitochondria and enhanced axonal outgrowth.

Armcx1 Regulates Mitochondrial Transport and Neurite Outgrowth in Embryonic Neurons

[0279] In order to test whether Armcx1 overexpression has a general effect on mitochondrial transport and neurite outgrowth, similar analyses were performed as described above in cultured E18 cortical neurons, a well-established system for investigating mitochondrial trafficking (Pekkurnaz et al., 2014; Wang and Schwarz, 2009; Wang et al., 2011). Whether Armcx1 overexpression could alter the proportion of motile versus stationary mitochondria in these neurons was first addressed. The mitochondrial marker MitoDsRed was co-transfected with either Armcx1 or GFP as a control. Armcx1 expression was coupled with a GFP reporter linked by an F2A sequence allowing the identification of transfected neurons. Whereas in wild type axons around 50% of mitochondria were motile, Armcx1 overexpression significantly increased the percentage of motile mitochondria up to 80% (FIGS. 3A and 3B). Consistently, Armcx1 overexpression also significantly increased the moving frequency of mitochondria (FIGS. 3C) with no effect on mitochondrial density (FIG. 9A). In contrast to its effect on mitochondria trafficking, overexpressing Armcx1 did not affect the transport of BDNF positive vesicles (FIGS. 9B and 9C), consistent with a specific localization of Armcx1 to mitochondria. In addition, Armcx1 overexpression significantly increased the average length of the longest neurites of embryonic cortical neurons (FIGS. 3D and 3E). These results together suggest that Armcx1 overexpression leads to similar effects on enhancing mitochondria movement and neurite growth in both adult RGC axons and embryonic cortical neurons.

Armcx1 Promotes Neuronal Survival and Axon Regeneration after Optic Nerve Injury

[0280] The above results suggest that Armcx1 might have a role in promoting neurite outgrowth. We hypothesized that this role could be important to promote axonal regeneration after an injury. To directly test this hypothesis, the effects of Armcx1 overexpression on axon regeneration and neuronal survival in adult RGCs was examined after an optic nerve crush injury. AAVs encoding Armcx1, Armcx1TM or PLAP were injected into the vitreous body of adult wild type mice and optic nerve crush was performed one month after viral injection. 15 days after injury, the regenerating axons were labeled with the anterograde tracer CTB. Armcx1 overexpression induced a significantly higher number of regenerating axons in comparison to PLAP control (FIGS. 4A-4C). Consistent with in vitro data, this effect was dependent on Armcx1 mitochondrial localization since the overexpression of Armcx1TM failed to recapitulate the enhanced regeneration (FIGS. 4A-4C). The effect of Armcx1 overexpression on the survival of RGCs (FIGS. 4D and 4E) was also analyzed. Consistent with previous studies (Belin et al., 2015; Nawabi et al., 2015; Park et al., 2008; Smith et al., 2009), about 25% of RGCs survived in the control group (FIGS. 4D and 4E). Strikingly, overexpressing Armcx1, but not the non-mitochondrial mutant Armcx1TM, led to an increase of approximatively 45% of neuronal survival compared to the control group (FIGS. 4D and 4E), suggesting that Armcx1 may not only promote axon regeneration but also protect injured neurons from cell death.

[0281] In principle, the observed regenerative effects of Armcx1 overexpression might reflect a direct effect of Armcx1 on axon regeneration or be merely secondary to increased neuronal survival. Several strategies such as p53 deletion (Park et al., 2008), manipulating ER stress pathways (Hu et al., 2012), and Apaf1-deleted mice are able to increase neuronal survival but not axon regeneration in the same optic nerve injury model, suggesting that axon regeneration requires an independent mechanism. To directly test this in the context of Armcx1, a transgenic mouse line was used in which Bc1-2 is overexpressed under a pan neuronal promoter (Martinou et al., 1994). Consistent with previous results using Bc1-2 transgenic mice (Bei et al.; Bonfanti et al., 1996; Goldberg et al., 2002), about 80% of RGCs survived but no significant increase in axon regeneration occurred 2 weeks after injury (FIG. 10). With Armcx1 overexpression, high neuronal survival remained at 15 days after injury in these mice (FIGS. 10A and 10B). Importantly, even with this high survival rate, Armcx1 overexpression improved axon regeneration of Bc1-2 mice (FIGS. 10C and 10D) but did not further enhance the extent of axon regeneration beyond what was observed by Armcx1 overexpression in the absence of Bc1-2 (FIGS. 10C and 10D compare to the results in FIGS. 4A-4C). Therefore, these findings substantiate the notion that, in addition to promoting neuronal survival, Armcx1 is also directly involved in regulating the process of axon regeneration after injury.

Armcx1 Potentiates the Regeneration of PTEN Deleted RGCs

[0282] Although Armcx1 has a positive effect on axon regeneration in wild type mice, the limited numbers of regenerating axons might reflect compromised regenerative ability associated with injured RGCs. As our previous studies showed that PTEN deletion in adult RGCs is able to increase neuronal survival and axon regeneration by elevating mTOR activity in injured RGCs (Park et al., 2008), we tested the effect of Armcx1 in this regeneration-permissive background. AAVs expressing Cre together with AAVs expressing Armcx1, Armcx1ATM or PLAP as a control, were co-injected to the vitreous body of adult PTENf/f mice and optic nerve crush was performed 4 weeks after viral injection. After an additional 15 days, the regenerating fibers were labeled with the anterograde tracer CTB and examined in optic nerve cross-sections. In this PTEN-deleted background, Armcx1 overexpression induced a significant increase in the number of regenerating axons in comparison with PTEN deletion alone (FIGS. 5A and 5B and 11A). This increase is most striking for the short-regenerating axons, consistent with the results of neurite outgrowth in retinal explants (FIGS. 2E-2G). In a side-by-side study the high regeneration capacity of PTEN deleted RGCs overexpressing Armcx1 fell within the same range as the dKO phenotype (FIG. 11B and 11C). In addition, Armcx1 overexpression also further increased RGC survival induced by PTEN deletion (FIGS. 5C and 5D). As expected, the mutant Armcx1TM failed to alter either neuronal survival or axon regeneration (FIGS. 5A-5D).

[0283] Previous studies demonstrated that among different RGC subtypes analyzed, PTEN inhibition selectively promotes regeneration from RGCs (Duan et al., 2015). The high number of injured axons growing beyond the injury site when Armcx1 was overexpressed in PTEN deleted mice (FIGS. 5A and 5B) prompted us to test the effects of Armcx1 on promoting the regeneration of different RGC subtypes. To this end, the mouse line Kcng4-Cre; Thy1-stop-YFP line 1 (Kcng4-YFP) that labels RGCs and their axons (Duan et al., 2015; 2014) was used. To inhibit PTEN expression, AAVs expressing shRNA against PTEN (Duan et al., 2015; Zukor et al., 2013) were injected with or without AAV-Armcx1 to the Kcng4-YFP mice. At 15 days post injury, CTB injection was performed in order to label all regenerating axons from both RGCs and non-RGCs. Therefore, YFP+/CTB+ axons should be derived from RGCs, while the YFP-/CTB+ axons are likely to be from non-RGCs. As shown in FIGS. 5E and 5F, Armcx1 overexpression induced a significant increase in regenerating axons from non-RGCs as quantified at 0.5 mm distal from the lesion sites. RGC-derived regenerating axons also showed a trend of increase, but did not reach statistical significance (FIGS. 5F). These results suggest that in contrast to the selective effects of PTEN inhibition on RGCs, Armcx1 is likely to promote axons regeneration from non-RGCs and possibly from RGCs to some extent.

Armcx1 Knockdown Reduces Axon Regeneration and Neuronal Survival in dKO Mice

[0284] The positive effect of Armcx1 overexpression on axonal regeneration and neuronal survival led us to assess the functional outcomes of silencing Armcx1 expression in both in vitro and in vivo models. We tested five shRNAs targeting different regions of Armcx1 and found two with knockdown efficiency close to 80% (FIGS. 12A and 12B). In order to maximize the knockdown efficiency a vector harboring these two different shRNAs was generated for the subsequent experiments (Song et al., 2008). The effects of Armcx1 knockdown on mitochondrial movement and other functional readouts in cultured E18 cortical neurons was assessed by co-transfecting MitoDsRed with either shRNAs against Armcx1 or shRNA Scramble as a control. To facilitate the identification of transfected neurons these shRNA constructs were designed to carry a fluorescent protein reporter. Knockdown of Armcx1 had a significant effect on mitochondrial transport in axons, decreasing the motile pool from 60% to 20% (FIGS. 12C and 12D). Armcx1 silencing also significantly decreased the moving frequency of mitochondria (FIG. 12E), without affecting mitochondrial density (FIG. 12F). Importantly, knockdown of Armcx1 also significantly reduced neurite growth from transfected neurons (FIGS. 12G and 12H). Thus, these results are consistent with our overexpression data and support a role of Armcx1 in regulating mitochondria movement and neurite growth in cultured cortical neurons.

[0285] Finally, whether the up-regulation of Armcx1 in RGCs of dKO mice is necessary for their high-regeneration phenotype was tested. To directly test this hypothesis, Armcx1 was knocked down in dKO mice in which Armcx1 is up-regulated (Sun et al., 2012, FIGS. 1A-1C). AAV carrying shRNAs against Armcx1 and the control shRNA Scramble were generated. These two viruses were both able to efficiently infect RGCs (FIG. 121). To assess the effects of shRNA Armcx1 virus on Armcx1 expression in injured dKO RGCs we injected AAV-Armcx1 shRNAs or Scramble in the retina of dKO mice. 5 weeks post injection of the shRNA AAVs, optic nerve crush was performed the animals terminated 3 days post injury. Approximately 50% of RGCs were Armcx1 positive in dKO retinas with injection of AAV expressing shRNA-Scramble (FIG. 6A), consistent with our immunohistochemistry results from FIGS. 1B and 1C. In contrast, AAV expressing Armcx1-shRNAs significantly reduced this number, bringing the percentage of Armcx1 positive RGCs to a level comparable to wild type condition, i.e. around 20% (FIG. 6A).

[0286] To study the effect of Armcx1 down-regulation on axon regeneration in dKO mice, mice from the same cohort described above were used but terminated 15 days post injury. As shown in FIG. 6B and FIG. 12J, knocking down Armcx1 significantly inhibited the axon regeneration phenotype. Whole mount retina analysis revealed that shRNAs of Armcx1 also significantly reduced RGC survival in dKO mice, compared to the control Scramble shRNA (FIGS. 6C). In a separate control, the same AAV vectors were injected to the vitreous bodies of wild type mice and analyzed these mice at 5 weeks post injection. CTB traced optic nerve axons did not show any sign of degeneration comparing to control injected with AAV-shRNA Scramble and RGC survival was not significantly different between conditions (FIG. 12K). Together, these results suggest that injury-induced Armcx1 expression is required for the increased neuronal survival and axon regeneration phenotypes of the dKO model.

Discussion

[0287] In this study, the mitochondrial protein Armcx1 is shown sufficient to (1) increase mitochondrial transport by recruiting stationary mitochondria, (2) protect axotomized neurons from cell death, and (3) promote axon regeneration. Armcx1 is further shown necessary for the axon regeneration and neuronal survival phenotypes observed in high regenerative conditions induced by the co-deletion of PTEN and SOCS3 and an accompanying treatment of CNTF (dKO). Together with the fact that Armcx1 expression is injury-induced and correlates with high regenerative ability, our results suggest Armcx1 as a key regulator of mitochondrial transport in injured axons, which could impact neuronal survival and axon regeneration. Modulated mitochondrial transport might constitute a new strategy to promote neuronal repair of the injured CNS.

[0288] The precise mechanisms of Armcx1 in injured axons remain to be determined. Similar to Armcx3, Armcx1 is able to interact with the Miro/Trak mitochondrial transport complex. However, it remains to be determined whether Armcx1 mobilizes stationary mitochondria in a calcium dependent manner as has been proposed for Armcx3 (Lpez Domnech et al., 2012). Like other members of the Armcx cluster, Armcx1 has a nuclear localization signal (FIG. 1D and (Lpez-Domnech et al., 2012)). In these studies, some overexpressed Armcx1 was also found to be localized to the nuclei of transfected neurons. Thus, although other functions of Armcx1 cannot be ruled out, the results from the Armcx1TM mutant suggest that the mitochondria-targeted Armcx1 protein is responsible for its function in promoting axon regeneration and RGC survival. In the same line, a recent study showed that enhancing mitochondrial transport by genetic deletion of the gene encoding the mitochondria-anchoring protein syntaphilin also facilitated axon regeneration by rescuing energy deficits in injured axons (Zhou et al., 2016). However, whether Armcx1 acts by regulating energy supply or other mechanisms, such as regulation of calcium homeostasis, signaling via reactive oxygen species, or changes in the production of metabolites, requires further studies. In addition, sustained axon regeneration likely involves the enhanced axonal transport of not only mitochondria but also other axonal building blocks. Thus, it would be interesting to identify other regulators of axonal transport in neurons with increased regenerative ability.

[0289] In the PTEN deletion background, Armcx1 overexpression further increased the number of regenerating axons (FIGS. 5A, 5B and 11). Interestingly, this is in contrast with other treatments, such as overexpression of DCLK2, a cytoskeleton regulator, which increases the length of regenerating axons without substantially affecting the number of regenerating axons induced by PTEN deletion (Nawabi et al., 2015). These results, together with our loss of function experiment where Armcx1 down-regulation inhibited dKO-induced axon regeneration (FIG. 6A-6C), suggest that Armcx1 is more important for the initiation phase of axon regeneration. The increased regeneration observed with Armcx1 overexpression is unlikely to be merely secondary to improved neuronal survival because RGC loss is efficiently prevented by Bcl-2 expression, although Bcl-2 does not increase regeneration. Moreover, in the Bcl-2 expressing background Armcx1 enhances regeneration without an additive effect on RGC survival (FIG. 10). Finally, even though expression of Armcx1 shRNA reduced RGC regeneration in dKO mice back to a level comparable to wild type mice (FIG. 6B and FIG. 4A), RGCs survival was less drastically affected (FIG. 6C and FIG. 4E).

[0290] In a PTEN deletion background, Armcx1 overexpression was also shown to facilitate additional axon regeneration from non-RGCs, a cell type that otherwise exhibits little regeneration. It is possible that different RGC sub-types have different needs in terms of mitochondrial function; non-RGCs may have a greater dependency on mobilization of mitochondria by Armcx1 in order to cope with injury-induced stresses such as calcium influx and energy imbalance. However, it is unknown whether Armcx1 effects somatic mitochondria the same as axonal mitochondria; these differentially localized mitochondria may be responsible for distinct effects on neuronal survival and axon regeneration. Nevertheless, as visual functions appear to be executed by different classes of RGCs (Sanes and Masland, 2015; Wernet et al., 2014), these results might be insightful for designing more efficient neural repair strategies to target different populations of RGCs.

[0291] The Armcx-cluster specificity to Eutherian mammals might imply that it has evolved as an additional layer of mitochondrial transport regulation to match the increasing complexity of the mammalian CNS. Our results suggest that this extra layer of regulation might be especially important when stress, such as an injury, is applied to the axon. Because mitochondrial transport failure has been reported in many neurodegenerative diseases (De Vos et al., 2008), increasing mitochondrial transport has been proposed as an exciting option to counteract axonal degeneration and subsequent neuronal death (Hinckelmann et al., 2013). With this perspective, the present study suggests that Armcx1 and its homologues could be a set of important targets of therapeutic interventions for neuronal protection and repair.

REFERENCES

[0292] Abe, N., and Cavalli, V. (2008). Nerve injury signaling. Current Opinion in Neurobiology 18, 276-283. [0293] Bei, F., Lee, H. H. C., Liu, X., Gunner, G., Jin, H., Ma, L., Wang, C., Hou, L., Hensch, T. K., Frank, E., et al. Restoration of Visual Function by Enhancing Conduction in Regenerated Axons. Cell 164,219-232. [0294] Belin, S., Nawabi, H., Wang, C., Tang, S., Latremoliere, A., Warren, P., Schorle, H., Uncu, C., Woolf, C. J., He, Z., et al. (2015). Injury-Induced Decline of Intrinsic Regenerative Ability Revealed by Quantitative Proteomics. Neuron 86,1000-1014. [0295] Bonfanti, L., Strettoi, E., Chierzi, S., Cenni, M. C., Liu, X. H., Martinou, J. C., Maffei, L., and Rabacchi, S. A. (1996). Protection of retinal ganglion cells from natural and axotomyinduced cell death in neonatal transgenic mice overexpressing bcl-2. J Neurosci 16,4186-4194. [0296] Bradke, F., Fawcett, J. W., and Spira, M. E. (2012). Assembly of a new growth cone after axotomy: the precursor to axon regeneration. Nature Reviews Neuroscience 13,183-193. [0297] Cartoni, R., Lger, B., Hock, M. B., Praz, M., Crettenand, A., Pich, S., Ziltener, J.-L., Luthi, F., Driaz, 0., Zorzano, A., et al. (2005). Mitofusins and ERRalpha expression are increased in human skeletal muscle after physical exercise. The Journal of Physiology 567, 349-358. [0298] Courchet, J., Lewis, T. L., Jr., Lee, S., Courchet, V., Liou, D.-Y., Aizawa, S., and Polleux, F. (2013). Terminal Axon Branching Is Regulated by the LKB1-NUAK1 Kinase Pathway via Presynaptic Mitochondrial Capture. Cell 153,1510-1525. [0299] Cregg, J. M., DePaul, M. A., Filous, A. R., Lang, B. T., Tran, A., and Silver, J. (2014). Functional regeneration beyond the glial scar. Experimental Neurology 253,197-207. [0300] De Vos, K. J., Grierson, A. J., Ackerley, S., and Miller, C. C. J. (2008). Role of Axonal Transport in Neurodegenerative Diseases*. Annu. Rev. Neurosci. 31,151-173. [0301] Duan, X., Krishnaswamy, A., la Huerta, De, I., and Sanes, J. R. (2014). Type II cadherins guide assembly of a direction-selective retinal circuit. Cell 158,793-807. [0302] Duan, X., Qiao, M., Bei, F., Kim, I.-J., He, Z., and Sanes, J. R. (2015). Subtype-Specific Regeneration of Retinal Ganglion Cells following Axotomy: Effects of Osteopontin and mTOR Signaling. Neuron 85,1244-1256. [0303] Glater, E. E., Megeath, L. J., Stowers, R. S., and Schwarz, T. L. (2006). Axonal transport of mitochondria requires milton to recruit kinesin heavy chain and is light chain independent. The Journal of Cell Biology 173, 545-557. [0304] Goldberg, J. L., and Barres, B. A. (2000). The relationship between neuronal survival and regeneration. Annu. Rev. Neurosci. 23, 579-612. [0305] Goldberg, J. L., Espinosa, J. S., Xu, Y., Davidson, N., Kovacs, G. T. A., and Barres, B. A. (2002). Retinal ganglion cells do not extend axons by default: promotion by neurotrophic signaling and electrical activity. Neuron 33, 689-702. [0306] Hammarlund, M., and Jin, Y. (2014). Axon regeneration in C. elegans. Current Opinion in Neurobiology 27, 199-207. [0307] He, Z ., and Jin, Y. (2016). Intrinsic control of axon regeneration. Neuron 90, 437-451. [0308] Hinckelmann, M.-V., Zala, D., and Saudou, F. (2013). Releasing the brake: restoring fast axonal transport in neurodegenerative disorders. Trends in Cell Biology. [0309] Hu, Y., Park, K. K., Yang, L., Wei, X., Yang, Q., Cho, K.-S., Thielen, P., Lee, A.-H., Cartoni, R., Glimcher, L. H., et al. (2012). Differential effects of unfolded protein response pathways on axon injury-induced death of retinal ganglion cells. Neuron 73, 445-452. [0310] Lpez-Domnech, G., Serrat, R., Mirra, S., D'Aniello, S., Somorjai, I., Abad, A., Vitureira, N., Garcia-Arumi, E., Alonso, M. T., Rodriguez-Prados, M., et al. (2012). The Eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2. Nature Communications 3, 814. [0311] Lu, Y., Belin, S., and He, Z. (2014). Signaling regulations of neuronal regenerative ability. Current Opinion in Neurobiology 27, 135-142. [0312] Mar, F. M., Simes, A. R., Leite, S., Morgado, M. M., Santos, T. E., Rodrigo, I. S., Teixeira, C. A., Misgeld, T., and Sousa, M. M. (2014). CNS Axons Globally Increase Axonal Transport after Peripheral Conditioning. Journal of Neuroscience 34, 5965-5970. [0313] Martinou, J.-C., Dubois-Dauphin, M., Staple, J. K., Rodriguez, I., Frankowski, H., Missotten, M., Albertini, P., Talabot, D., Catsicas, S., and Pietra, C. (1994). Overexpression of BCL-2 in transgenic mice protects neurons from naturally occurring cell death and experimental ischemia. Neuron 13, 1017-1030. [0314] Misgeld, T., Kerschensteiner, M., Bareyre, F. M., Burgess, R. W., and Lichtman, J. W. (2007). Imaging axonal transport of mitochondria in vivo. Nature Publishing Group 4, 559-561. [0315] Morris, R. L., and Hollenbeck, P. J. (1993). The regulation of bidirectional mitochondrial transport is coordinated with axonal outgrowth. J Cell Sci 104 (Pt 3), 917-927. [0316] Mou, Z., Tapper, A. R., and Gardner, P. D. (2009). The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10. Journal of Biological Chemistry 284, 13629-13640. [0317] Nawabi, H., Briancon-Marjollet, A., Clark, C., Sanyas, I., Takamatsu, H., Okuno, T., Kumanogoh, A., Bozon, M., Takeshima, K., Yoshida, Y., et al. (2010). A midline switch of receptor processing regulates commissural axon guidance in vertebrates. Genes & Development 24, 396-410. [0318] Nawabi, H., Belin, S., Cartoni, R., Williams, P. R., Wang, C., Latremoliere, A., Wang, X., Zhu, J., Taub, D. G., Fu, X., et al. (2015). Doublecortin-Like Kinases Promote Neuronal Survival and Induce Growth Cone Reformation via Distinct Mechanisms. Neuron. [0319] Park, K. K., Liu, K., Hu, Y., Smith, P. D., Wang, C., Cai, B., Xu, B., Connolly, L., Kramvis, I., Sahin, M., et al. (2008). Promoting axon regeneration in the adult CNS by modulation of the PTEN/mTOR pathway. Science 322, 963-966. [0320] Pekkurnaz, G., Trinidad, J. C., Wang, X., Kong, D., and Schwarz, T. L. (2014). Glucose Regulates Mitochondrial Motility via Milton Modification by O-GlcNAc Transferase. Cell 158, 54-68. [0321] Pernet, V., Joly, S., Jordi, N., Dalkara, D., Guzik-Kornacka, A., Flannery, J. G., and Schwab, M. E. (2013). Misguidance and modulation of axonal regeneration by Stat3 and Rho/ROCK signaling in the transparent optic nerve. Cell Death Dis 4, e734-. [0322] Sanes, J. R., and Masland, R. H. (2015). The types of retinal ganglion cells: current status and implications for neuronal classification. Annu. Rev. Neurosci. [0323] Schwarz, T. L. (2013). Mitochondrial trafficking in neurons. Cold Spring Harb Perspect Biol 5. [0324] Smith, P., Sun, F., Park, K. K., Cai, B., Wang, C., Kuwako, K., Martinez-Carrasco, I., Connolly, L., and He, Z. (2009). SOCS3 deletion promotes optic nerve regeneration in vivo. Neuron 64, 617-623. [0325] Song, J., Giang, A., Lu, Y., Pang, S., and Chiu, R. (2008). Multiple shRNA expressing vector enhances efficiency of gene silencing. BMB Rep 41, 358-362. [0326] Sun, F., Park, K. K., Belin, S., Wang, D., Lu, T., Chen, G., Zhang, K., Yeung, C., Feng, G., Yankner, B. A., et al. (2012). Sustained axon regeneration induced by co-deletion of PTEN and SOCS3. Nature 480, 372-375. [0327] Trushina, E., Nemutlu, E., Zhang, S., Christensen, T., Camp, J., Mesa, J., Siddiqui, A., Tamura, Y., Sesaki, H., Wengenack, T. M., et al. (2012). Defects in mitochondrial dynamics and metabolomic signatures of evolving energetic stress in mouse models of familial Alzheimer's disease. PLoS ONE 7, e32737. [0328] Verburg, J., and Hollenbeck, P. J. (2008). Mitochondrial Membrane Potential in Axons Increases with Local Nerve Growth Factor or Semaphorin Signaling. Journal of Neuroscience 28, 8306-8315. [0329] Wang, X., and Schwarz, T. L. (2009). The Mechanism of Ca. Cell 136, 163-174. [0330] Wang, X., Winter, D., Ashrafi, G., Schlehe, J., Wong, Y. L., Selkoe, D., Rice, S., Steen, J., LaVoie, M. J., and Schwarz, T. L. (2011). PINK1 and Parkin Target Mirofor Phosphorylation and Degradation to Arrest Mitochondrial Motility. Cell 147, 893-906. [0331] Wernet, M. F., Huberman, A. D., and Desplan, C. (2014). So many pieces, one puzzle: cell type specification and visual circuitry in flies and mice. Genes & Amp; Development 28, 2565-2584. [0332] Zhang, L., Trushin, S., Christensen, T. A., Bachmeier, B. V., Gateno, B., Schroeder, A., Yao, J., Itoh, K., Sesaki, H., Poon, W. W., et al. (2016). Altered brain energetics induces mitochondrial fission arrest in Alzheimer's Disease. Sci. Rep. 6, 18725. [0333] Zhou, B., Yu, P., Lin, M.-Y., Sun, T., Chen, Y., and Sheng, Z.-H. (2016). Facilitation of axon regeneration by enhancing mitochondrial transport and rescuing energy deficits. J Cell Biol 104, jcb.201605101. [0334] Zukor, K., Belin, S., Wang, C., Keelan, N., Wang, X., and He, Z. (2013). Short hairpin RNA against PTEN enhances regenerative growth of corticospinal tract axons after spinal cord injury.PubMedNCBI. J Neurosci 33, 15350-15361.