COMPOSITIONS AND METHODS FOR TREATING LYNX2 DISORDERS
20200061155 ยท 2020-02-27
Inventors
- Julie M. Miwa (Hellertown, PA, US)
- Huaixing Wang (Horsham, PA, US)
- Kristin R. Anderson (Middlesex, NJ, US)
Cpc classification
A61K31/198
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/198
HUMAN NECESSITIES
A61K31/55
HUMAN NECESSITIES
International classification
A61K31/55
HUMAN NECESSITIES
Abstract
A method of treating anxiety in a subject having a mutation in the Iynx2 gene and suffering from anxiety, includes administering to the subject an effective amount of a nicotinic blocker and/or an effective amount of a calcineurin activator or a metabotropic glutamate receptor (mGluR) agonist.
Claims
1. A method of treating anxiety in a subject having a lynx2 mutation, the method comprising: administering to the subject: an effective amount of calcineurin activator or a metabotropic glutamate receptor (mGluR) agonist.
2. The method of claim 1, wherein the lynx2 mutation is a single nucleotide polymorphism (SNP).
3. The method of claim 1, wherein the lynx2 mutation is selected frameshift mutation, a nonsense mutation, a stop-gain mutation, and a point mutation in the lynx2 gene.
4. The method of claim 2, wherein the SNP comprises glutamine (Q) at position 39 of a mature lynx2 protein sequence.
5. The method of claim 4, wherein histidine (H) is substituted for glutamine at position 39 in the lynx2 gene.
6. The method of claim 1, wherein the calcineurin activator is selected from imipramine, calmodulin, and/or extract of Fructus cannabis.
7. The method of claim 1, wherein the calcineurin activator is imipramine.
8. The method of claim 1, wherein the metabotropic glutamate receptor (mGluR) agonist is an agonist of mGluR1 or mGluR5.
9. The method of claim 1, wherein the metabotropic glutamate receptor (mGluR) agonist is dihydroxyphenylglycine (DHPG).
10. The method of claim 1, wherein the subject is suffering from anxiety or has at least one anxiety disorder selected from the group consisting of post-traumatic stress disorder (PTSD), generalized anxiety disorder (GAD), panic-social phobia, phobia, social anxiety, depression, obsessive compulsive disorder (OCD), and agoraphobia.
11. A method of restoring synaptic plasticity in a subject having a lynx2 mutation, the method comprising: administering to the subject: an effective amount of calcineurin activator or a metabotropic glutamate receptor (mGluR) agonist.
12. The method of claim 11, wherein the lynx2 mutation is a single nucleotide polymorphism (SNP).
13. The method of claim 11, wherein the lynx2 mutation is selected frameshift mutation, a nonsense mutation, a stop-gain mutation, and a point mutation in the lynx2 gene.
14. The method of claim 12, wherein the SNP comprises glutamine (Q) at position 39 of a mature lynx2 protein sequence.
15. The method of claim 14, wherein histidine (H) is substituted for glutamine at position 39 in the lynx2 gene.
16. The method of claim 11, wherein the calcineurin activator is selected from imipramine, calmodulin, and/or extract of Fructus cannabis.
17. The method of claim 11, wherein the calcineurin activator is imipramine.
18. The method of claim 11, wherein the metabotropic glutamate receptor (mGluR) agonist is an agonist of mGluR1 or mGluR5.
19. The method of claim 11, wherein the metabotropic glutamate receptor (mGluR) agonist is dihydroxyphenylglycine (DHPG).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0010] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION
[0037] A gene, lynx2, is expressed and highly enriched in the amygdala. When lynx2 is removed from a mouse model, these mice show heightened anxiety and are aberrant in social interactions. While not bound by any particular theory, the present disclosure contemplates that lynx2 alters the cellular behavior in the basolateral amygdala (BLA), a subset of the amygdala, and that this alteration can lead to the behavioral output of lessened anxiety. Additionally, the present disclosure contemplates that when lynx2 is expressed, its protein binds to nicotinic acetylcholine receptors (nAChR) and dampens the response to acetylcholine.
[0038] Embodiments of the present invention are based on the contemplation that mice lacking the lynx2 gene (lynx2 knock out (KO)mice have increased anxiety caused by a lack of synaptic weakening. Because of this increase in the strength of the synapse in lynx2KO mice, these mice retain anxious behavior. Indeed, as shown in
[0039] Rescue of the lynx2KO phenotype was also observed physiologically in electrode traces of spontaneous inhibitory post-synaptic currents (sIPSCs) in pyramidal neurons of wild type (WT) and lynx2KO mice as shown in
[0040] Based on the observations that lynx2KO mice have increased anxiety and this anxiety is alleviated or decreased with the nicotinic receptor blocker, mecamylamine (mec), and the 7 nAChR antagonist, methyllycaconitine (MLA), human's suffering from anxiety were observed. As shown in
[0041] Based on these observations in mice and human subjects, embodiments of the present invention contemplate treating anxiety in a patient having a lynx2 mutation by administering a selective nicotinic receptor blocker and/or an 7 AChR antagonist.
[0042] With reference to
[0043] With reference to
[0044] Furthermore, as DHPG is a specific agonist of Group I mGluRs, the method for restoring abnormal synaptic plasticity in neurons of a subject having a lynx2 mutation or treating anxiety in a subject having a lynx2 mutation includes administering a calcineurin activator and/or a Group I mGluR agonist to the subject having a lynx2 mutation. Agonists of Group I mGluRs include agonists for mGluR1 and mGluR5, encoded by the GRM1 and GRM5 genes, respectively.
[0045] With reference to
[0046] With reference to
[0047] In some embodiments of the present invention, the lynx2 mutation conferring an anxiety phenotype includes any deletion or mutation that abolishes or decreases the wild type function of the lynx2 protein as shown in the protein modeling of
[0048] In some embodiments, the lynx2 mutation may be a single nucleotide polymorphism (SNP). In some embodiments, the lynx2 mutation includes an SNP mutation (e.g., the loss or substitution) of glutamine (Q) at position 39 of the mature lynx2 protein (amino acid) sequence as underlined: IQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAAC LIASAGYQSFCSPGKLNSVCISCCNTPLCN (SEQ ID NO: 1). In some embodiments, the lynx2 mutation in a subject suffering from anxiety includes any amino acid substitution of the glutamine at position 39. In some embodiments, the lynx2 mutation in a subject suffering from anxiety includes an amino acid substitution of histidine (H) at position 39.
[0049] In some embodiments of the present invention, a method of treating anxiety or decreasing anxiety in a subject having a lynx2 mutation includes administering an effective amount of a nicotinic receptor blocker or an 7 AChR antagonist to the subject suffering from a lynx2-dependent anxiety.
In some embodiments of the present invention, the nicotinic receptor blocker may include mecamylamine, quirestine, hexamethonium bromide, tempoxime hydrochloride, buproprion, amantidine, memantine, enantiomers thereof, or a combination thereof. The similar structure and function of these nicotinic receptor blockers is described in the art, for example, for mecamulamine: Young et al., Clin. Ther., 2001 23:532-565; for quirestine: G A Buznikov et al., General Pharmacology: The Vascular System, 29(1), 49-53 (1997); for hexamethonium bromide: HexamethoniumCompound Summary, http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=3604. 2016-10-06; and for tempoxime hydrochloride: Tempoxime HydrochlorideCompound Summary https://pubchem.ncbi.nlm.nih.gov/compound/113266. 2016-10-06, for buproprion: Slemmer J E et al., J Pharmacol Exp Ther 2000; 295: 321-327; for amantidine: Matsubayashi et al., J Pharmacol Exp Ther, 1997 May; 281(2):834-44; and for memantine: Aracava Y et al., J Pharmacol Exp Ther. 312 (3): 1195-205. doi:10.1124/jpet.104.077172. PMID 15522999 the entire contents of all of which are herein incorporated by reference. the entire contents of all of which are herein incorporated by reference.
[0050] In some embodiments of the present invention, the selective 7 AChR antagonist may include methyllycaconitine (MLA), and analogs of MLA, including condelphine, aconitane, talatisamine, bullatineB, delphamine, bikhaconitine, pyrodelphonine, winklerlin, delelatine, and analogs, enantiomers, and isomers thereof. The selective 7 AChR antagonist may also include full length lynx1 protein (SEQ ID NO: 7) (MTPLLTLILWLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTP-TRMKVSKSCVPRCFETVYDGYSKHASTTSCCQYDLCNGTGLATPATLALAPILLATL WGLL), mature lynx1 protein (SEQ ID NO: 8)(LDCHVCAYNGDNCFNPMRCPAMVAYCMT-TRTYYTPTRMKVSKSCVPRCFETVYDGYSKHASTTSCCQYDLCN), any isoform of full length lynx2 protein including (SEQ ID NO: 9) (MQAPRAAPAA PLSYDRRLRGSIAATFCGLF LLPGFALQIQ CYQCEEFQLN NDCSSPEFIVNCTVNVQDMC QKEVMEQSAG IMYRKSCASS AACLIASAGY QSFCSPGKLN SVCISCCNTPLCNGPRPKKR GSSASALRPG LRTTILFLKLALFSAHC), and (SEQ ID NO: 10) (MCGGGRRGRQ-EGGGDVERRS QPSPPATPTPTRRPSRGAWS GRWGEKARLLWVLRIASSSF-SLSRQLRRRG ARPGSASGRS GDPQPGARARAMQAPRAAPA APLSYDRRPR DSGRMWVLGIAATFCGLFLL PGFALQIQCYQCEEFQLNND CSSPEFIVNC TVNVQDMCQKEVMEQSAGIMYRKSCASSAA CLIASAGYQSFCSPGKLNSV CISCCNTPLCNGPRPKKRGSSASALRPGLPTTILLLKLALFSAHC), mature lynx1 protein (SEQ ID NO: 1), clozapine, COG133 peptide, elapid snake venom toxins, and/or marine snail toxins. The function of these selective 7AChR antagonists is described in the art, for example, for MLA: S. Wonnacott et al., (1993), Methods in Neurosciences, Vol. 12, (P. M. Conn, Ed.), pp. 263-275, San Diego: Academic Press; for lynx1 protein: Miwa et al. 1999, Neuron 23, 105-114. PMCID:10402197, Ibanez-Tallon, I, Miwa, et al, (2002) Neuron 33, 893-903. PMID:11906696, Lyukmanova et al., (2011) JBC, 286, 10618-10627; for lynx2 protein: Tekinay, et al., (2009) A role for LYNX2 in anxiety-related behavior. Proc. Natl. Acad. Sci. 106, 4477-4482. PMID:19246390; for condelphine: S. W. Pelletier, et al., Acta Cryst. (1977) B33, 716-722; for clozapine: Neuropharmacology, 2007 February; 52(2):387-94; Singhal et al., Int J Mol Sci. 2012; 13(2):2219-38. doi: 10.3390/ijms13022219; and for COG133 peptide: Gay et al., (2006) J. Pharmacol. Exp. Ther. 316 835. PMID: 16249370, the entire contents of all of which are herein incorporated by reference.
[0051] In some embodiments of the present invention, the 7AChR antagonist may include the elapid snake venom toxins (also referred to as alpha-neurotoxins) which include any of the elapid snake venom protein toxins having a three-finger fold or toxin-fold polypeptide having 4 or 5 disulfide bonds. Non-limiting examples of elapid snake venom toxins include alpha-bungarotoxin and alpha-cobratoxin. Alpha-neurotoxins are described in the art, for example, Moise, L.; et al. (2002), Journal of Biological Chemistry, 277 (14): 12406-12417. doi:10.1074/jbc.M110320200. PMID 11790782; Young et al., Biophysical Journal, 85 (2): 943-953, and Betzel et al., Journal of Biological Chemistry, 266 (32): 21530-6, the entire contents of all of which are herein incorporated by reference.
[0052] In some embodiments of the present invention, the 7AChR antagonist may include a marine snail toxin, for example, alpha-conotoxin, as described in Balaji et al., J. Biol. Chem. 275 (50): 39516-39522, the entire content of which is herein incorporated by reference.
[0053] An effective amount of the calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist may be administered to the subject by any suitable method. As used herein, an effective amount is any amount that, during the course of therapy, will have a preventive or ameliorative effect on anxiety in a subject compared to the same subject having not taken any calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist. For example, an effective amount may be an amount that prevents the occurrence or recurrence, or reduces the frequency or degree of anxiety in a subject. In some embodiments, an effective amount of the calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist reduces anxiety in a subject having a lynx2 mutation compared to the same subject having not been administered an effective amount of a calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist. Quantitatively, the effective amount may vary, e.g., depending upon the subject, the severity of the disorder or symptom being treated, and the route of administration. Such and effective amount (or dose) can be determined by routine studies.
[0054] For therapeutic or prophylactic use, at least one calcineurin activator, mGluR agonist, nicotinic receptor blocker or the 7 AChR antagonist may be administered as a pharmaceutical composition comprising the calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist as the (or an) essential active ingredient as well as a solid or liquid pharmaceutically acceptable carrier and, optionally, one or more pharmaceutically acceptable adjuvants and excipients, employing standard and conventional techniques.
[0055] Pharmaceutical compositions useful in the practice of embodiments of this invention include suitable dosage forms for oral, parenteral (including subcutaneous, intramuscular, intradermal and intravenous), transdermal, bronchial or nasal administration. Thus, if a solid carrier is used, the preparation may be tableted, placed in a hard gelatin capsule in powder or pellet form, or in the form of a troche or lozenge. The solid carrier may contain conventional excipients such as binding agents, fillers, tableting lubricants, disintegrants, wetting agents and the like. The tablet may, if desired, be film coated by conventional techniques. If a liquid carrier is employed, the preparation may be in the form of a syrup, emulsion, soft gelatin capsule, sterile vehicle for injection, an aqueous or non-aqueous liquid suspension, or may be a dry product for reconstitution with water or other suitable vehicle before use. Liquid preparations may contain conventional additives such as suspending agents, emulsifying agents, wetting agents, non-aqueous vehicles (including edible oils), preservatives, as well as flavoring and/or coloring agents. For parenteral administration, a vehicle normally will comprise sterile water, at least in large part, although saline solutions, glucose solutions and the like may be utilized. Injectable suspensions also may be used, in which case, conventional suspending agents may be employed. Conventional preservatives, buffering agents and the like also may be added to the parenteral dosage forms. The pharmaceutical compositions may be prepared by conventional techniques appropriate to the desired preparation containing appropriate amounts of the nicotinic receptor blocker and/or 7 AChR antagonist. See, for example, Remington's Pharmaceutical. Sciences, Mack Publishing Company, Easton, Pa., 18th edition, 1990.
[0056] In some embodiments of the present invention, the subject being treated may have a lynx2 mutation and has anxiety and/or at least one anxiety disorder selected from the group consisting of post-traumatic stress disorder (PTSD), generalized anxiety disorder (GAD), panic-social phobia, phobia, social anxiety, depression, obsessive compulsive disorder (OCD), and agoraphobia.
[0057] In some embodiments of the present invention, a kit for identifying a subject having a lynx2 mutation or for determining the presence of a lynx2 mutation in a subject suffering from anxiety, includes at least one of two oligonucleotide primers for amplifying the lynx2 gene. In some embodiments the kit includes at least one of a forward primer (L2F): GTGGGATGGTCGTGATTTCCG (SEQ ID NO: 11) and a reverse primer L2R:GTGAGGGGGCCATTAAATAGC (SEQ ID NO: 12). In some embodiments, the kit includes both the forward and the reverse primer.
[0058] The kit, according to embodiments of the present invention, may include at least the L2F primer of SEQ ID NO: 11 to be used with an allele-specific probe for amplifying single nucleotide polymorphisms (SNPs). For example, an allele-specific probe may be readily made to amplify the Q39H SNP using the TaqMan 5-nuclease assay from ThermoFisher together with the L2F primer.
[0059] In some embodiments of the present invention, the kit also includes a therapeutically effective amount of the calcineurin activator, mGluR agonist, nicotinic receptor blocker and/or the 7 AChR antagonist for treating a subject suffering from anxiety. In some embodiments, the calcineurin activator may be In some embodiments, the nicotinic receptor blocker may be selected from mecamylamine, quirestine, hexamethonium bromide, tempoxime hydrochloride, buproprion, amantidine, memantine, enantiomers thereof, and combinations thereof. In some embodiments, the 7 AChR antagonist may be selected from condelphine and enantiomers thereof, methyllycaconitine (MLA) and enantiomers thereof, lynx1 protein, lynx2 protein, an elapid snake venom toxin protein, a marine snail toxin protein, COG133 peptide, and combinations thereof.
[0060] The following examples are provided for illustrative purposes only, and do not limit the scope of the embodiments of the present invention.
Examples
Materials and Methods
[0061] C57BL/6 and lynx2 KO mice fourteen to twenty-two days old of both sexes were used. Animals were housed in the Central Animal Facility at Lehigh University, under 12 hour light/12 hour dark conditions. They were housed under IACUC guidelines. It is assumed that there is no sex difference in the results.
[0062] The animals were anesthetized by isoflurane in an anesthetic chamber to a tolerant state (ml/kg) and euthanized through decapitation. The brain was removed into ice-cold (<40 C) sucrose solution containing (in mM) NaCl 87; KCl 2.5; NaH2PO4 1.25; NaHCO.sub.325; CaCl2 0.5; MgSO4 7.0; sucrose 75; and glucose 25. Brain tissue block was glued to stage of vibratome (Leica VT1000S). Frontal brain slices of 300 M were cut and transferred into sucrose solution for 45 min (35.50 C). Whole cell recordings for principal neurons in BLA were conducted at ambient temperature. The extracellular solution contained (in mM) NaCl 128; KCl 2.5; NaH2PO4 1.25; CaCl2 2; MgSO4 1.0; NaHCO.sub.326; and dextrose 10 (pH 7.4 when bubbled with 95% 025% CO2; 300-310 milliosmolar). The resistance of the recording pipette was 4-6 M. K+ based intracellular solution was used for the basic properties of principal K+-gluconate 120; KCl 6; ATP-Mg 4; Na2GTP 0.3; EGTA 0.1; Hepes 10 (pH 7.3); Cs+ solution for sIPSCs (and synchronization) containing 140 mM CsCl, 10 mM Hepes, 10 mM EGTA, 2 mM MgATP, 1 mM CaCl2, 5 mM lidocaine derivative QX-314 (pH 7.3 with CsOH, 295-305 milliosmolar) and Cs+ solution for sEPSCs recording containing (in mM) Cs-gluconate 120; lidocaine 5 (QX-314); CsCl2 6; ATP-Mg 1; Na2GTP 0.2; and Hepes 10 (pH 7.3, adjusted with CsOH).
[0063] Spontaneous inhibitory postsynaptic currents (sIPSCs) were recorded for 10 minutes at a holding potential of 70 mV in the bath with ACSF in the presence of 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline-2,3-dione (NBQX; 20 M, Tocris) and D-2-amino-5-phosphonovalerate (DAP-5; 50 M, Tocris) to block glutamatergic transmissions. Spontaneous excitatory postsynaptic currents (sEPSCs) were recorded in same way, but in the presence of picrotoxin (PTX; 50 M, Sigma-Aldrich, St. Louis, Mo.) to block GABAergic transmissions. Nicotine was dissolved in ACSF for the bath of recording neuron. To examine the synchronization of IPSC, double electrodes recording was carried out.
[0064] Field excitatory postsynaptic potentials (fEPSPs) were evoked by 0.05 Hz test stimulus though a bipolar stimulating electrode placed on external Capsule (EC), and a glass pipette as recording electrode was filled with ACSF and placed in BLA. For LTP induction, high-frequency stimulation (HFS) of 100 Hz with the 1-s duration was applied four times with a 10-s interval, whereas LTD induction utilized natural theta pulse stimulations (TPS 5 Hz for 180 s); test stimulation was continued for the indicated periods. The signals were acquired with pCLAMP 10.3 (Molecular Devices). Access resistances were continuously monitored and neurons with more than 20% change of series resistance were excluded from data analysis.
[0065] Graded series of hyperpolarizing and depolarizing current pulses in 50 pA increments (1.5-s duration) from 100 pA to +100 pA were injected to measure the electroresponsive properties of principal cells in BLA. The input resistance (Rin) of the cells was estimated in the linear portion of current-voltage plots. The amplitude of the slow afterhyperpolarizations (AHPs) was measured at its peak after the offset of the current pulse. sIPSCs and sEPSCs recorded in the voltage-clamp mode were analyzed with Clampfit 10.3. The typical events in separate relevant experiments were selected to create sample templates for event detection within a data period, and sIPSCs and sEPSCs were detected with a threshold set at three times the value of the root mean square of the baseline noise. The event distribution was sorted and histogrammed at a bin size of 1 pA. The histogram could be fitted with a Gaussian function. The coefficient of variation (CV) of synaptic currents can be used to identify the changes of quantal release and pre- or postsynaptic effects. The ratio of mean amplitude (M) of treatment in each cell was first normalized to that of control and then plotted against the ratio of CV2 in each condition, respectively.
[0066] The plasticity ratio was calculated from the average EPSP amplitude of the last 10 mins of baseline recording and the last 15 mins after high frequency or low stimulus, for LTP and LTD studies, respectively. Data is represented as an absolute change from the baseline plasticity. For all experiments, treatment effects were analyzed with one-way ANOVA, followed by the appropriate post hoc tests. Paired Student's t test was used when comparisons were restricted to two means in the neuronal samples (e.g., baseline and nicotine application). The Kolmogorov-Smimov (K-S) analysis was applied to analyze the amplitude and inter-event interval of sIPSCs and sEPSCs. Error probability of p<0.05 was considered to be statistically significant and the data were presented as meanstandard error.
[0067] For the activation of calcineurin (
[0068] For activation of mGluR receptor with DHPG (
[0069] For the LTD and LTP assays in wild type and lynx2KO neurons of
[0070] While the present invention has been illustrated and described with reference to certain exemplary embodiments, those of ordinary skill in the art will understand that various modifications and changes may be made to the described embodiments without departing from the spirit and scope of the present invention, as defined in the following claims.