Inhibiting the Fungal Cell-Surface Phospate Transporter PHO84
20200061087 · 2020-02-27
Inventors
Cpc classification
C12Q1/18
CHEMISTRY; METALLURGY
A61K31/7048
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C40B30/06
CHEMISTRY; METALLURGY
A61K31/122
HUMAN NECESSITIES
A61K38/12
HUMAN NECESSITIES
G01N2500/04
PHYSICS
A61K31/122
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/662
HUMAN NECESSITIES
A61K38/12
HUMAN NECESSITIES
A61K31/662
HUMAN NECESSITIES
International classification
A61K31/662
HUMAN NECESSITIES
A61K31/7048
HUMAN NECESSITIES
A61K31/122
HUMAN NECESSITIES
A61K38/12
HUMAN NECESSITIES
Abstract
The invention includes a method of inhibiting Pho84 in a fungus comprising administering to the fungus an effective amount of a compound of formula 1.
Claims
1. A method of inhibiting Pho84 in a fungus comprising administering to the fungus an effective amount of a compound of formula 1: ##STR00007## wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2; or a salt or solvate thereof, thereby inhibiting Pho84 in the fungus.
2. A method of inhibiting fungal growth comprising administering to a fungus an effective amount of the compound of formula 1 of claim 1: ##STR00008## wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2; or a salt or solvate thereof, thereby inhibiting fungal growth.
3. A method of treating an infection caused by a fungus in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the compound of formula 1 of claim 1: ##STR00009## wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2; or a salt or solvate thereof, thereby treating the fungal infection in the subject.
4. The method of claim 1, wherein the compound is phosphonoformic acid or phosphonoacetic acid.
5. The method of claim 3, wherein the therapeutically effective amount of the compound of formula 1 is administered in a pharmaceutical composition comprising at least one pharmaceutically acceptable carrier.
6. The method of claim 1, wherein the fungus is from the phyla Zygomycete/Mucorales, Ascomycete, or Basidiomycete.
7. The method of claim 1, wherein the fungus is selected from the group consisting of: Candida parapsilosis, C. glabrata, C. lusitaniae, C. krusei, C. dublinensis, C. kefyr, C. auris, Pneumocystis jirovecii, Aspergillus fumigatus, A. flavus, A. niger, A. terreus, A. nidulans, Fusarium solani, F. oxysporum, Fusarium verticillioidis and Fusarium moniliforme, Fusarium dimerum, Fusarium proliferatum, Fusarium chlamidosporum, Fusarium sacchari, Fusarium nygamai, Fusarium napiforme, Fusarium antophilum, and Fusarium vasinfectum Pseudoallescheria boydii, Scedosporium apiospermum, S. prolificans, Alternaria alternata, Acremonium kiliense, Blastomyces dermatitidis, Histoplasma capsulatum, Coccidioides immitis, C. posadasii, Paracoccidioides brasiliensis, Trichophyton rubrum, T. tonsurans, T. schoenleinii, T. verrucosum, T. mentagrophytes, T. interdigitale, T. violaceum, Microsporum canis, M. audouinii, M. ferrugineum, M. cookie, Nannizzia fulva, N. gypsea, N. persicolor, N. nana Arthroderma insingulare, A. uncinatum, Epidermophyton floccosum, Cryptococcus Cryptococcus neoformans, Trichosporon asahii, Mucor mucedo, M. circinelloides Rhizopus oryzae, Cunninghamella bertholletiae, Lichtheimia ramose, Rhizomucor pusillus and Saksenaea vasiformis.
8. The method of claim 1, wherein the fungus is a yeast.
9. The method of claim 8, wherein the yeast is from the genera Candida or Cryptococcus.
10. The method of claim 8, wherein the yeast is Candida albicans or Saccharomyces cerevisiae.
11. The method of claim 1, further comprising administering at least one additional antifungal agent.
12. The method of claim 11, wherein the at least one additional antifungal agent is a polyene antifungal agent, an azole antifungal agent, an allylamine antifungal agent, or an echinocandin antifungal agent.
13. The method of claim 11, wherein the at least one additional antifungal agent is plumbagin, amphotericin B or micafungin.
14. A recombinant fungal cell comprising a polynucleotide encoding a reporter gene operably linked to a Pho84 promoter, wherein the fungal cell is hemizygous for Pho84.
15. An isolated polynucleotide encoding a reporter gene operably linked to a Pho84 promoter.
16. The isolated polynucleotide of claim 15, comprising the sequence of SEQ ID NO: 1.
17. An expression vector comprising the polynucleotide of claim 16 positioned for expression in a cell.
18. A cell comprising the expression vector of claim 17.
19. The cell of claim 18, wherein the cell is a fungal cell that is hemizygous for Pho84.
20. A recombinant fungal cell comprising polynucleotide of claim 16.
21. The recombinant fungal cell of claim 20, wherein the polynucleotide has at least 90% or 95% identity to SEQ ID NO: 1.
22. A method of identifying a compound that inhibits Pho84 comprising: exposing the recombinant fungal cell of claim 14 to a putative inhibitor compound; measuring the expression level of the reporter gene; and comparing the expression level of the reporter gene to a predetermined reference level; thereby identifying the compound as a Pho84 inhibitor.
23-24. (canceled)
25. A composition comprising at least one Pho84+/ fungus cell and cell culture medium.
26-28. (canceled)
29. A method of identifying a compound that inhibits Pho84 comprising: exposing at least one Pho84+/+ fungal cell and at least one Pho84+/ fungal cell of claim 25 to a putative inhibitor compound; and comparing a growth level of the at least one Pho84+/+ fungal cell to a growth level of the at least one Pho84+/ fungal cell, thereby identifying the compound as a Pho84 inhibitor.
30-33. (canceled)
34. A kit for identifying a compound that inhibits Pho84, comprising: one or more recombinant fungal cells comprising a polynucleotide encoding a reporter gene operably linked to a Pho84 promoter, wherein the fungal cell is hemizygous for Pho84; a reagent for measuring the expression level of the reported gene; and written instructions for identifying a compound that inhibits Pho84 accordance with the method of claim 22.
35. A kit for identifying a compound that inhibits Pho84, comprising: one or more Pho84+/+ fungal cells and one or more Pho84+/ fungal cells; a reagent for measuring the growth level of the fungal cells; and written instructions for identifying a compound that inhibits Pho84 in accordance with the method of claim 29.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0026] For a fuller understanding of the nature and desired objects of the present invention, reference is made to the following detailed description taken in conjunction with the accompanying figures.
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
DEFINITIONS
[0052] The instant invention is most clearly understood with reference to the following definitions.
[0053] As used herein, the singular form a, an, and the include plural references unless the context clearly dictates otherwise.
[0054] As used herein, the term alkyl, by itself or as part of another substituent means, unless otherwise stated, a straight or branched chain hydrocarbon having the number of carbon atoms designated (i.e., C.sub.1-C.sub.10 means one to ten carbon atoms) and includes straight, branched chain, or cyclic substituent groups. Examples include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, tert-butyl, pentyl, neopentyl, hexyl, and cyclopropylmethyl. Certain specific examples include (C.sub.1-C.sub.3)alkyl, such as, but not limited to, ethyl, methyl, propyl, and isopropyl, isobutyl.
[0055] As used herein, the term cycloalkyl, by itself or as part of another substituent means, unless otherwise stated, a cyclic chain hydrocarbon having the number of carbon atoms designated (i.e., C.sub.3-C.sub.6 means a cyclic group comprising a ring group consisting of three to six carbon atoms) and includes straight, branched chain or cyclic substituent groups. Examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. Certain specific examples include (C.sub.3-C.sub.6)cycloalkyl, such as, but not limited to, cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
[0056] The term alkoxy, as used herein, refers to an alkyl or a cycloalkyl group which is linked to another moiety though an oxygen atom.
[0057] The terms biomarker or marker, as used herein, refers to a molecule that can be detected. Therefore, a biomarker according to the present invention includes, but is not limited to, a nucleic acid, a polypeptide, a carbohydrate, a lipid, an inorganic molecule, an organic molecule, each of which may vary widely in size and properties. A biomarker can be a bodily substance relating to a bodily condition or disease or it may be the product of an exogenous gene, such as but not limited to a reporter gene, expressed in vitro or in vivo, in cells, tissue or a cell free expression system. A biomarker can be detected using any means known in the art or by a previously unknown means that only becomes apparent upon consideration of the marker by the skilled artisan.
[0058] A compound as used herein, may be a small molecule, a nucleic acid or a peptide.
[0059] An effective amount or therapeutically effective amount of a compound is that amount of compound which is sufficient to provide the intended effect when the compound is administered. An effective amount of a delivery vehicle is that amount sufficient to effectively bind or deliver a compound.
[0060] The term halogen or halo designates F, Cl, Br or I.
[0061] The term differ, as used herein and applied to the relative amount of a level of a biomarker with respect to a predetermined reference level, means that the levels are not the same, that the level of the biomarker is greater than or less than the predetermined reference level.
[0062] The term inhibitor, as used herein refers to a compound that specifically binds and reduces the biological activity of a target. The inhibitor may bind the target at the level of protein, by way of non-limiting example, by binding to the active site and excluding the natural substrate. The inhibitor may also bind the target at the level of nucleic acid, by way of non-limiting example, siRNA techniques.
[0063] Instructional material, as that term is used herein, includes a publication, a recording, a diagram, or any other medium of expression that can be used to communicate the usefulness of the composition and/or compound of the invention in a kit. The instructional material of the kit may, for example, be affixed to a container that contains the compound and/or composition of the invention or be shipped together with a container that contains the compound and/or composition. Alternatively, the instructional material may be shipped separately from the container with the intention that the recipient uses the instructional material and the compound cooperatively. Delivery of the instructional material may be, for example, by physical delivery of the publication or other medium of expression communicating the usefulness of the kit, or may alternatively be achieved by electronic transmission, for example by means of a computer, such as by electronic mail, or download from a website.
[0064] The level of one or more biomarkers means the absolute or relative amount or concentration of the biomarker in the sample as determined by measuring mRNA, cDNA, small organic molecules, nucleotides, ions or protein, or any portion thereof such as oligonucleotide or peptide. A level of a biomarker may refer, based on context, to a global level or a level within some subdivision of an organism, by way of non-limiting example a level may refer to the amount or concentration of a biomarker in a cell, in a particular type of cell, on the cell membrane, in an area delineated by another marker or any other configuration.
[0065] The terms patient, subject, individual, and the like are used interchangeably herein, and refer to any animal, mammalian or non-mammalian, human or non-human, or cells thereof whether in vitro or in situ, amenable to the methods described herein. In certain non-limiting embodiments, the patient, subject or individual is a human.
[0066] As used herein, the term pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or carrier, such as a liquid or solid filler, stabilizer, dispersing agent, suspending agent, diluent, excipient, thickening agent, solvent or encapsulating material, involved in carrying or transporting a compound useful within the invention within or to the patient such that it may perform its intended function. Typically, such constructs are carried or transported from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be acceptable in the sense of being compatible with the other ingredients of the formulation, including the compound useful within the invention, and not injurious to the patient. Some examples of materials that may serve as pharmaceutically acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; surface active agents; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations.
[0067] As used herein, pharmaceutically acceptable carrier also includes any and all coatings, antibacterial and antifungal agents, and absorption delaying agents, and the like that are compatible with the activity of the compound useful within the invention, and are physiologically acceptable to the patient. Supplementary active compounds may also be incorporated into the compositions. The pharmaceutically acceptable carrier may further include a pharmaceutically acceptable salt of the compound useful within the invention. Other additional ingredients that may be included in the pharmaceutical compositions used in the practice of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences (Genaro, Ed., Mack Publishing Co., 1985, Easton, Pa.), which is incorporated herein by reference.
[0068] As used herein, the language pharmaceutically acceptable salt refers to a salt of the administered compounds prepared from pharmaceutically acceptable non-toxic acids, including inorganic acids or bases, organic acids or bases, solvates, hydrates, or clathrates thereof.
[0069] A reference level of a biomarker means a level of a biomarker that is indicative of the presence or absence of a particular phenotype or characteristic, including but not limited to fluorescence by a reporter gene, cellular growth, etc. When the level of a biomarker in a subject is above the reference level of the biomarker it is indicative of the presence of, or relatively heightened level of, a particular phenotype or characteristic. When the level of a biomarker in a subject is below the reference level of the biomarker it is indicative of a lack of or relative lack of a particular phenotype or characteristic.
[0070] As used herein, a reporter gene construct refers to a nucleic acid that includes a reporter gene operatively linked to transcriptional regulatory sequences. Transcription of the reporter gene is controlled by these sequences. The activity of at least one or more of these control sequences is directly or indirectly regulated by a target protein. The transcriptional regulatory sequences include the promoter and other regulatory regions, such as enhancer sequences, that modulate the activity of the promoter, or regulatory sequences that modulate the activity or efficiency of the RNA polymerase that recognizes the promoter, or regulatory sequences which are recognized by effector molecules, including those that are specifically induced by interaction of an extracellular signal with the target receptor. For example, modulation of the activity of the promoter may be affected by altering the RNA polymerase binding to the promoter region, or, alternatively, by interfering with initiation of transcription or elongation of the mRNA. Such sequences are herein collectively referred to as transcriptional regulatory elements or sequences. In addition, the construct may include sequences of nucleotides that alter translation of the resulting mRNA, or stability of the resulting translated protein, thereby altering the amount of reporter gene product. The reporter gene constructs of the present invention provide a detectable readout, e.g., fluorescences, in response to signals transduced in response to modulation of a target by an inhibitor.
[0071] As used herein, the term treatment or treating is defined as the application or administration of a therapeutic agent, i.e., a compound of the invention (alone or in combination with another pharmaceutical agent), to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient (e.g., for diagnosis or ex vivo applications), who has a condition contemplated herein, a symptom of a condition contemplated herein or the potential to develop a condition contemplated herein, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect a condition contemplated herein, the symptoms of a condition contemplated herein or the potential to develop a condition contemplated herein. Such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics.
[0072] Unless specifically stated or obvious from context, as used herein, the term about is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
[0073] As used in the specification and claims, the terms comprises, comprising, containing, having, and the like can have the meaning ascribed to them in U.S. patent law and can mean includes, including, and the like.
[0074] Unless specifically stated or obvious from context, the term or, as used herein, is understood to be inclusive.
[0075] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 (as well as fractions thereof unless the context clearly dictates otherwise).
DETAILED DESCRIPTION OF THE INVENTION
[0076] The invention is based, at least in part, on the discovery that compounds of formula (1) inhibit Pho84 which is important for the growth, survival and virulence of various strains of fungus. Without wishing to be bound by theory, Pho84 is highly conserved across various classifications of fungus.
[0077] In specific embodiments, the compound of formula (1) can be phosphonoacetic or phosphonoformic acid. Data is presented in
Methods of Inhibiting Pho84 in a Fungal Cell
[0078] In one aspect the invention provides a method of inhibiting Pho84 in a fungus comprising administering to the fungus an effective amount of a compound of formula 1:
##STR00004##
[0079] wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2;
or a salt or solvate thereof, thereby inhibiting Pho84 in the fungus.
[0080] In another aspect, the invention provides a method of inhibiting fungal growth comprising administering to a fungus an effective amount of a compound of formula 1:
##STR00005##
[0081] wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2;
[0082] or a salt or solvate thereof, thereby inhibiting fungal growth.
[0083] In another aspect, the invention provides a method of treating an infection caused by a fungus comprising administering to a fungus an effective amount of a compound of formula 1:
##STR00006##
[0084] wherein n is 0 or 1 and R.sub.1 is halogen, C.sub.1-C.sub.3 alkoxy, OH, H, or NH.sub.2;
[0085] or a salt or solvate thereof, thereby treating the infection.
[0086] The following embodiments apply to one or more of the above described aspects.
[0087] In various embodiments, the compound of formula (1) may be provided in a pharmaceutical composition including a pharmaceutically acceptable carrier. Any route of administration may be employed as deemed appropriate by persons of skill in the art. Accordingly, any form of pharmaceutical composition may be employed and may include any appropriate pharmaceutical carrier or excipient. Specific examples that may be used are described below.
[0088] The methods of the invention may be applied to any fungus, including yeasts. In various embodiments the fungus may be from the phyla Zygomycete/Mucorales, Ascomycete, or Basidiomycete. In various embodiments the fungus is Candida parapsilosis, C. glabrata, C. lusitaniae, C. krusei, C. dublinensis, C. kefyr, C. auris, Pneumocystis jirovecii, Aspergillus fumigatus, A. flavus, A. niger, A. terreus, A. nidulans, Fusarium solani, F. oxysporum, Fusarium verticillioidis and Fusarium moniliforme, Fusarium dimerum, Fusarium proliferatum, Fusarium chlamidosporum, Fusarium sacchari, Fusarium nygamai, Fusarium napiforme, Fusarium antophilum, and Fusarium vasinfectum Pseudoallescheria boydii, Scedosporium apiospermum, S. prolificans, Alternaria alternata, Acremonium kiliense, Blastomyces dermatitidis, Histoplasma capsulatum, Coccidioides immitis, C. posadasii, Paracoccidioides brasiliensis, Trichophyton rubrum, T. tonsurans, T. schoenleinii, T. verrucosum, T. mentagrophytes, T. interdigitale, T. violaceum, Microsporum canis, M. audouinii, M. ferrugineum, M. cookie, Nannizzia fulva, N. gypsea, N. persicolor, N. nana Arthroderma insingulare, A. uncinatum, Epidermophyton floccosum, Cryptococcus gattii, Cryptococcus neoformans, Trichosporon asahii, Mucor mucedo, M circinelloides, Rhizopus oryzae, Cunninghamella bertholletiae, Lichtheimia ramose, Rhizomucor pusillus or Saksenaea vasiformis. In various embodiments, the fungus may be a yeast and the yeast may be selected from Candida or Cryptococcus. In various embodiments the yeast may be C. albicans or S. cerevisiae.
[0089] In various embodiments, the compound of formula (1) may be administered in combination with at least one additional antifungal agent. Without wishing to be limited by theory, inhibition of Pho84 sensitizes fungal cells against various other antifungal compounds. Data supporting this are presented in
Screening Assays for Identifying a Compound that can Inhibit Pho84
[0090] In another aspect the invention provides a recombinant fungal cell comprising a polynucleotide encoding a reporter gene operably linked to a Pho84 promoter, wherein the fungal cell is hemizygous for Pho84. Without wishing to be limited by theory, inhibition of Pho84 prevents the activation of polynucleotides under the control of an operably linked Pho84 promoter. The reporter gene is repressed in environments where Pho84 is inhibited. Hemizygous Pho84/+ strains are sensitized to Pho84 inhibitors. Therefore, recombinant fungal cells may be useful for identifying compounds that inhibit Pho84.
[0091] In another aspect, the invention provides a method of identifying a compound that inhibits Pho84 by exposing a recombinant fungal cell comprising a polynucleotide encoding a reporter gene operably linked to a PHO84 promoter to a putative inhibitor compound, wherein the fungal cell is hemizygous for Pho84; measuring the expression level of the reporter gene; and comparing the expression level of the reporter gene to a predetermined reference level; thereby identifying the compound as a Pho84 inhibitor. In various embodiments the reporter gene is green fluorescent protein, red fluorescent protein, -galactosidase or chloramphenicol acetyltransferase. In various embodiments, when the level of the reporter gene is more than the predetermined reference level, it indicates that the compound is a Pho84 inhibitor. In another aspect the invention comprises a composition containing at least one Pho84+/ fungus cell and cell culture medium. This composition is useful for screening for compounds that may inhibit Pho84 due to the hemizygous strain's heightened sensitivity to Pho84 inhibition. In various embodiments, the composition further includes a putative Pho84 inhibitor. In various embodiments, the cell culture media is synthetic complete low phosphate media.
[0092] In a further aspect the invention comprises a method of identifying a compound that inhibits Pho84 by exposing at least one Pho84+/+ fungal cell and at least one Pho84+/ fungal cell to a putative inhibitor compound; and comparing a growth level of the at least one Pho84+/+fungal cell to a growth level of the at least one Pho84+/ fungal cell, thereby identifying the compound as a Pho84 inhibitor. In various embodiments, the at least one Pho84+/+ fungal cell and the at least one Pho84+/ fungal cell are grown on the same media. In various embodiments the growth level is determined by measuring colony size, OD.sub.600, reduction of tetrazolium salts including but not limited to 2,3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazolium-5-carboxanilide (XTT) or the reduction of resazurin. Due to the heightened sensitivity of Pho84+/ cells to Pho84 inhibition the Pho84+/+ cells will exhibit higher growth levels than the Pho84+/ cells when exposed to a Pho84 inhibitor. This differential sensitivity may be most easily observed when the fungal cells are grown on the same media, especially low phosphate media.
Compositions of the Invention
[0093] The invention provides a recombinant fungal cell comprising a polynucleotide encoding a reporter gene operably linked to a Pho84 promoter, wherein the fungal cell is hemizygous for Pho84. An isolated polynucleotide encoding a reporter gene operably linked to a Pho84 promoter is also provided. In particular, the isolated polynucleotide comprises the sequence of SEQ ID NO: 1:
TABLE-US-00001 CAAAAAATCTAATAATTACAAAACTTGTAAAGCATAAAACTAAAAACTTT TTATTAATAAAAAGAAATATCTCGTTTGTATGTTAAATTGTTGTACACAT GGGCAATTACTTGGATTGGCTAAACGAAATAATAAAAATGTTGCCATTCT AGTTTTAAATACTTTATGATTTTAGATGCATTATTACATTTCGATTTAGT CATGTAAATGATTAGTGTACCATGTTTGGTTGGTAATTGCCTCCCCATTC AAGATAACTACACTCATGTCTTACCCAGACCTCCCTATATGCCACTCCAA ACTATCCAACCCTTATAGAGATCACCCTTTTAATCCTCCAATTCATAGAT TATTAACCTTGACATAGCTACCAGATATAAAATATTCAAATTTTTTTTGT TCTCAACTTCACTCTATTCTCCATTTTTTACAGTTTACAGGAACATTCCC AAAAGAAGCAAAAAAAAATAAAAATTGTAAGACTTGAATTACACAAAATA AATTATAGTTTTTTTTTTTGCACTAAAATTCAATTTACACAAAATTTAAT AATTTCTGAAAAGTATCAGTATCATCATCACCAAGAAAACGCAGCCTTCA AATAAAAACTCATTTTAATTAAAACTCTCTTATGAAATTAAATTCATCCC TAATAGAAAGGAAAGGAAAAAAAAAAAAAGAAATCTCTTGCATATCTCGT TATATATTTTGTATGAAATAATATAATAAATATATACTTCAAATTAGAAT ATATAAATATTTAAAACAATTCCCTTAAATTATTGAAATTTTTATTTTTT TATAATTCTTCTTCTTCTTTTCTTTAAGGACTATTTCAATATCTCAATTG TTATTTCACTTTATTTTCCTTCATATTTACTTATTCATTGGGTTTCCTGC GTATATACATACCCTCCCCCCTCTTTTTGCTATATCACATTTACAACTAA CACTATAGTTTTTACAAAAAGATGGTTGCTGAAATTCAARSCTCACACTA ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGT CGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGG GCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACC ACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTA CGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACT TCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTC TTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGG CGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGG ACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAAC GTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAA GATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACC AGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCAC TACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGA TCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCA TGGACGAGCTGTACAAG
where the C. albicans Pho84 promoter sequence is underlined and the reporter is GFP. In certain embodiments, the isolated polynucleotide has at least 90% or 95% sequence identity to SEQ ID NO: 1. In particular embodiments, the polynucleotide has at least 95% identity to SEQ ID NO: 1. In certain embodiments, the isolated polynucleotide encodes an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 2:
TABLE-US-00002 MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG KLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK.
[0094] The invention also provides an expression vector comprising the aforementioned polynucleotides positioned for expression in a cell. Cells comprising the expression are also provided. In certain embodiments, the cell is a fungal cell that is hemizygous for Pho84.
[0095] The invention also provides a composition comprising at least one Pho84+/ fungus cell and cell culture medium. One skilled in the art will appreciate that various types of suitable cell culture media can be used in accordance with the invention, including, but not limited to, those described in the foregoing figures and those described in the following examples. In certain embodiments, the composition further comprises a putative Pho84 inhibitor. In certain other embodiments, the compositions further comprises a Pho84+/+ fungus cell. In other embodiments, the cell culture medium comprise slow phosphate media.
Kits for Identifying a Compound that can Inhibit Pho84
[0096] In another aspect the invention provides a kit containing one or more recombinant fungal cells having a polynucleotide encoding a reporter gene operably linked to a Pho84 promoter, wherein the fungal cell is hemizygous for Pho84; a reagent for measuring the expression level of the reported gene; and written instructions describing the use of the kit including the steps of exposing the recombinant fungal cell to a putative inhibitor compound; measuring the expression level of the reporter gene; and comparing the expression level of the reporter gene to a predetermined reference level; thereby identifying the compound as a Pho84 inhibitor.
[0097] The kit instructs a user to practice the above described method for screening putative Pho84 inhibitors using a system including a reporter gene construct and contains the necessary components to facilitate doing so.
[0098] In another aspect the invention provides a kit comprising one or more Pho84+/+ fungal cells and one or more Pho84+/ fungal cells, a reagent for measuring the growth level of the fungal cells; and written instructions describing exposing at the Pho84+/+ fungal cell and the Pho84+/ fungal cell to a putative inhibitor compound; measuring a growth level for the at least one Pho84+/+ fungal cell and a growth level for the at least one Pho84+/ fungal cell; comparing a growth level of the at least one Pho84+/+ fungal cell to a growth level of the at least one Pho84+/ fungal cell, thereby identifying the compound as a Pho84 inhibitor.
[0099] The kit instructs a user to practice the above described method for screening putative Pho84 inhibitors by measuring different growth levels of Pho84+/+ and Pho84+/ fungal cells and contains the necessary components to facilitate doing so.
Administration/Dosage/Formulations
[0100] The regimen of administration may affect what constitutes an effective amount. The therapeutic formulations may be administered to the subject either prior to or after the onset of fungal infection contemplated in the invention. Further, several divided dosages, as well as staggered dosages may be administered daily or sequentially, or the dose may be continuously infused, or may be a bolus injection. Further, the dosages of the therapeutic formulations may be proportionally increased or decreased as indicated by the exigencies of the therapeutic or prophylactic situation.
[0101] Administration of the compositions of the present invention to a patient, preferably a mammal, more preferably a human, may be carried out using known procedures, at dosages and for periods of time effective to treat a disease or disorder contemplated in the invention. An effective amount of the therapeutic compound necessary to achieve a therapeutic effect may vary according to factors such as the state of the disease or disorder in the patient; the age, sex, and weight of the patient; and the ability of the therapeutic compound to treat a disease or disorder contemplated in the invention. Dosage regimens may be adjusted to provide the optimum therapeutic response. For example, several divided doses may be administered daily or the dose may be proportionally reduced as indicated by the exigencies of the therapeutic situation. A non-limiting example of an effective dose range for a therapeutic compound of the invention is from about 1 and 5,000 mg/kg of body weight/per day. The pharmaceutical compositions useful for practicing the invention may be administered to deliver a dose of from ng/kg/day and 100 mg/kg/day. In certain embodiments, the invention envisions administration of a dose which results in a concentration of the compound of the present invention from 1 M and 10 M in a mammal. One of ordinary skill in the art would be able to study the relevant factors and make the determination regarding the effective amount of the therapeutic compound without undue experimentation.
[0102] Actual dosage levels of the active ingredients in the pharmaceutical compositions of this invention may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
[0103] In particular, the selected dosage level depends upon a variety of factors including the activity of the particular compound employed, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds or materials used in combination with the compound, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well, known in the medical arts.
[0104] A medical doctor, e.g., physician or veterinarian, having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required.
[0105] In various embodiments, the compound may be administered topically, i.e. applied to the body surface as a liquid, ointment, gel etc., to treat superficial fungal infections like tinea capitis, tinea corporis, tinea cruris, tinea pedis.
[0106] In particular embodiments, it is especially advantageous to formulate the compound in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the patients to be treated; each unit containing a predetermined quantity of therapeutic compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical vehicle. The dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the therapeutic compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding/formulating such a therapeutic compound for the treatment of a disease or disorder contemplated in the invention.
[0107] In one embodiment, the compositions of the invention are formulated using one or more pharmaceutically acceptable excipients or carriers. In one embodiment, the pharmaceutical compositions of the invention comprise a therapeutically effective amount of a compound of the invention and a pharmaceutically acceptable carrier.
[0108] The carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms may be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it is preferable to include isotonic agents, for example, sugars, sodium chloride, or polyalcohols such as mannitol and sorbitol, in the composition. Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
[0109] In certain embodiments, the compositions of the invention are administered to the patient in dosages that range from one to five times per day or more. In another embodiment, the compositions of the invention are administered to the patient in range of dosages that include, but are not limited to, once every day, every two, days, every three days to once a week, and once every two weeks. It is readily apparent to one skilled in the art that the frequency of administration of the various combination compositions of the invention varies from individual to individual depending on many factors including, but not limited to, age, disease or disorder to be treated, gender, overall health, kidney function and other factors. Thus, the invention should not be construed to be limited to any particular dosage regime and the precise dosage and composition to be administered to any patient is determined by the attending physical taking all other factors about the patient into account.
[0110] Compounds of the invention for administration may be in the range of from about 1 g to about 10,000 mg, about 20 g to about 9,500 mg, about 40 g to about 9,000 mg, about 75 g to about 8,500 mg, about 150 g to about 7,500 mg, about 200 g to about 7,000 mg, about 3050 g to about 6,000 mg, about 500 g to about 5,000 mg, about 750 g to about 4,000 mg, about 1 mg to about 3,000 mg, about 10 mg to about 2,500 mg, about 20 mg to about 2,000 mg, about 25 mg to about 1,500 mg, about 30 mg to about 1,000 mg, about 40 mg to about 900 mg, about 50 mg to about 800 mg, about 60 mg to about 750 mg, about 70 mg to about 600 mg, about 80 mg to about 500 mg, and any and all whole or partial increments therebetween.
[0111] In some embodiments, the dose of a compound of the invention is from about 1 mg and about 2,500 mg. In some embodiments, a dose of a compound of the invention used in compositions described herein is less than about 10,000 mg, or less than about 8,000 mg, or less than about 6,000 mg, or less than about 5,000 mg, or less than about 3,000 mg, or less than about 2,000 mg, or less than about 1,000 mg, or less than about 500 mg, or less than about 200 mg, or less than about 50 mg. Similarly, in some embodiments, a dose of a second compound as described herein is less than about 1,000 mg, or less than about 800 mg, or less than about 600 mg, or less than about 500 mg, or less than about 400 mg, or less than about 300 mg, or less than about 200 mg, or less than about 100 mg, or less than about 50 mg, or less than about 40 mg, or less than about 30 mg, or less than about 25 mg, or less than about 20 mg, or less than about 15 mg, or less than about 10 mg, or less than about 5 mg, or less than about 2 mg, or less than about 1 mg, or less than about 0.5 mg, and any and all whole or partial increments thereof.
[0112] In one embodiment, the present invention is directed to a packaged pharmaceutical composition comprising a container holding a therapeutically effective amount of a compound of the invention, alone or in combination with a second pharmaceutical agent; and instructions for using the compound to treat, prevent, or reduce one or more symptoms of a disease or disorder contemplated in the invention.
[0113] Formulations may be employed in admixtures with conventional excipients, i.e., pharmaceutically acceptable organic or inorganic carrier substances suitable for oral, parenteral, nasal, intravenous, subcutaneous, enteral, topical or any other suitable mode of administration, known to the art. The pharmaceutical preparations may be sterilized and if desired mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure buffers, coloring, flavoring and/or aromatic substances and the like. They may also be combined where desired with other active agents, e.g., anti-fibrotic agents.
[0114] Routes of administration of any of the compositions of the invention include oral, nasal, rectal, intravaginal, parenteral, buccal, sublingual or topical. The compounds for use in the invention may be formulated for administration by any suitable route, such as for oral or parenteral, for example, transdermal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), (intra)nasal and (trans)rectal), intravesical, intrapulmonary, intraduodenal, intragastrical, intrathecal, subcutaneous, intramuscular, intradermal, intra-arterial, intravenous, intrabronchial, inhalation, and topical administration.
[0115] Suitable compositions and dosage forms include, for example, tablets, capsules, caplets, pills, gel caps, troches, dispersions, suspensions, solutions, syrups, granules, beads, transdermal patches, gels, powders, pellets, magmas, lozenges, creams, pastes, plasters, lotions, discs, suppositories, liquid sprays for nasal or oral administration, dry powder or aerosolized formulations for inhalation, compositions and formulations for intravesical administration and the like. It should be understood that the formulations and compositions that would be useful in the present invention are not limited to the particular formulations and compositions that are described herein.
[0116] Oral Administration
[0117] For oral application, particularly suitable are tablets, dragees, liquids, drops, suppositories, or capsules, caplets and gelcaps. The compositions intended for oral use may be prepared according to any method known in the art and such compositions may contain one or more agents selected from the group consisting of inert, non-toxic pharmaceutically excipients that are suitable for the manufacture of tablets. Such excipients include, for example an inert diluent such as lactose; granulating and disintegrating agents such as cornstarch; binding agents such as starch; and lubricating agents such as magnesium stearate. The tablets may be uncoated or they may be coated by known techniques for elegance or to delay the release of the active ingredients. Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert diluent.
[0118] In one embodiment, the tablets of the invention comprise saracatinib difumarate, mannitol, dibasic calcium phosphate anhydrous, crospovidone, hypromellose and magnesium stearate, with a film-coat containing hypromellose, macrogol 400, red iron oxide, black iron oxide and titanium dioxide.
[0119] For oral administration, the compounds of the invention may be in the form of tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., polyvinylpyrrolidone, hydroxypropylcellulose or hydroxypropylmethylcellulose); fillers (e.g., cornstarch, lactose, microcrystalline cellulose or calcium phosphate); lubricants (e.g., magnesium stearate, talc, or silica); disintegrates (e.g., sodium starch glycollate); or wetting agents (e.g., sodium lauryl sulfate). If desired, the tablets may be coated using suitable methods and coating materials such as OPADRY film coating systems available from Colorcon, West Point, Pa. (e.g., OPADRY OY Type, OYC Type, Organic Enteric OY-P Type, Aqueous Enteric OY-A Type, OY-PM Type and OPADRY White, 32K18400). Liquid preparation for oral administration may be in the form of solutions, syrups or suspensions. The liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, methyl cellulose or hydrogenated edible fats); emulsifying agent (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters or ethyl alcohol); and preservatives (e.g., methyl or propyl p-hydroxy benzoates or sorbic acid).
[0120] Granulating techniques are well known in the pharmaceutical art for modifying starting powders or other particulate materials of an active ingredient. The powders are typically mixed with a binder material into larger permanent free-flowing agglomerates or granules referred to as a granulation. For example, solvent-using wet granulation processes are generally characterized in that the powders are combined with a binder material and moistened with water or an organic solvent under conditions resulting in the formation of a wet granulated mass from which the solvent must then be evaporated.
[0121] Melt granulation generally consists in the use of materials that are solid or semi-solid at room temperature (i.e. having a relatively low softening or melting point range) to promote granulation of powdered or other materials, essentially in the absence of added water or other liquid solvents. The low melting solids, when heated to a temperature in the melting point range, liquefy to act as a binder or granulating medium. The liquefied solid spreads itself over the surface of powdered materials with which it is contacted, and on cooling, forms a solid granulated mass in which the initial materials are bound together. The resulting melt granulation may then be provided to a tablet press or be encapsulated for preparing the oral dosage form. Melt granulation improves the dissolution rate and bioavailability of an active (i.e. drug) by forming a solid dispersion or solid solution.
[0122] U.S. Pat. No. 5,169,645 discloses directly compressible wax-containing granules having improved flow properties. The granules are obtained when waxes are admixed in the melt with certain flow improving additives, followed by cooling and granulation of the admixture. In certain embodiments, only the wax itself melts in the melt combination of the wax(es) and additives(s), and in other cases both the wax(es) and the additives(s) melt.
[0123] The present invention also includes a multi-layer tablet comprising a layer providing for the delayed release of one or more compounds of the invention, and a further layer providing for the immediate release of a medication for treatment of a disease or disorder contemplated in the invention. Using a wax/pH-sensitive polymer mix, a gastric insoluble composition may be obtained in which the active ingredient is entrapped, ensuring its delayed release.
[0124] Parenteral Administration
[0125] As used herein, parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue. Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like. In particular, parenteral administration is contemplated to include, but is not limited to, subcutaneous, intravenous, intraperitoneal, intramuscular, intrasternal injection, and kidney dialytic infusion techniques.
[0126] Formulations of a pharmaceutical composition suitable for parenteral administration comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampules or in multidose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a formulation for parenteral administration, the active ingredient is provided in dry (i.e., powder or granular) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen free water) prior to parenteral administration of the reconstituted composition.
[0127] The pharmaceutical compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein. Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butanediol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides. Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer system. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
[0128] Additional Administration Forms
[0129] Additional dosage forms of this invention include dosage forms as described in U.S. Pat. Nos. 6,340,475; 6,488,962; 6,451,808; 5,972,389; 5,582,837; and 5,007,790. Additional dosage forms of this invention also include dosage forms as described in U.S. Patent Applications Nos. 20030147952; 20030104062; 20030104053; 20030044466; 20030039688; and 20020051820. Additional dosage forms of this invention also include dosage forms as described in PCT Applications Nos. WO 03/35041; WO 03/35040; WO 03/35029; WO 03/35177; WO 03/35039; WO 02/96404; WO 02/32416; WO 01/97783; WO 01/56544; WO 01/32217; WO 98/55107; WO 98/11879; WO 97/47285; WO 93/18755; and WO 90/11757.
[0130] Controlled Release Formulations and Drug Delivery Systems
[0131] In one embodiment, the formulations of the present invention may be, but are not limited to, short-term, rapid-offset, as well as controlled, for example, sustained release, delayed release and pulsatile release formulations.
[0132] The term sustained release is used in its conventional sense to refer to a drug formulation that provides for gradual release of a drug over an extended period of time, and that may, although not necessarily, result in substantially constant blood levels of a drug over an extended time period. The period of time may be as long as a month or more and should be a release which is longer that the same amount of agent administered in bolus form.
[0133] For sustained release, the compounds may be formulated with a suitable polymer or hydrophobic material that provides sustained release properties to the compounds. As such, the compounds for use the method of the invention may be administered in the form of microparticles, for example, by injection or in the form of wafers or discs by implantation.
[0134] In one embodiment of the invention, the compounds of the invention are administered to a patient, alone or in combination with another pharmaceutical agent, using a sustained release formulation.
[0135] The term delayed release is used herein in its conventional sense to refer to a drug formulation that provides for an initial release of the drug after some delay following drug administration and that may, although not necessarily, includes a delay of from about 10 minutes up to about 12 hours.
[0136] The term pulsatile release is used herein in its conventional sense to refer to a drug formulation that provides release of the drug in such a way as to produce pulsed plasma profiles of the drug after drug administration.
[0137] The term immediate release is used in its conventional sense to refer to a drug formulation that provides for release of the drug immediately after drug administration.
[0138] As used herein, short-term refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes and any or all whole or partial increments thereof after drug administration after drug administration.
[0139] As used herein, rapid-offset refers to any period of time up to and including about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 40 minutes, about 20 minutes, or about 10 minutes, and any and all whole or partial increments thereof after drug administration.
[0140] Dosing
[0141] The therapeutically effective amount or dose of a compound of the present invention depends on the age, sex and weight of the patient, the current medical condition of the patient and the progression of a disease or disorder contemplated in the invention. The skilled artisan is able to determine appropriate dosages depending on these and other factors.
[0142] A suitable dose of a compound of the present invention may be in the range of from about 0.01 mg to about 5,000 mg per day, such as from about 0.1 mg to about 1,000 mg, for example, from about 1 mg to about 500 mg, such as about 5 mg to about 250 mg per day. The dose may be administered in a single dosage or in multiple dosages, for example from 1 to 4 or more times per day. When multiple dosages are used, the amount of each dosage may be the same or different. For example, a dose of 1 mg per day may be administered as two 0.5 mg doses, with about a 12-hour interval between doses.
[0143] It is understood that the amount of compound dosed per day may be administered, in non-limiting examples, every day, every other day, every 2 days, every 3 days, every 4 days, or every 5 days. For example, with every other day administration, a 5 mg per day dose may be initiated on Monday with a first subsequent 5 mg per day dose administered on Wednesday, a second subsequent 5 mg per day dose administered on Friday, and so on.
[0144] In the case wherein the patient's status does improve, upon the doctor's discretion the administration of the inhibitor of the invention is optionally given continuously; alternatively, the dose of drug being administered is temporarily reduced or temporarily suspended for a certain length of time (i. e., a drug holiday). The length of the drug holiday optionally varies between 2 days and 1 year, including by way of example only, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 15 days, 20 days, 28 days, 35 days, 50 days, 70 days, 100 days, 120 days, 150 days, 180 days, 200 days, 250 days, 280 days, 300 days, 320 days, 350 days, or 365 days. The dose reduction during a drug holiday includes from 10%-100%, including, by way of example only, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
[0145] Once improvement of the patient's conditions has occurred, a maintenance dose is administered if necessary. Subsequently, the dosage or the frequency of administration, or both, is reduced, as a function of the disease or disorder, to a level at which the improved disease is retained. In one embodiment, patients require intermittent treatment on a long-term basis upon any recurrence of symptoms and/or infection.
[0146] The compounds for use in the method of the invention may be formulated in unit dosage form. The term unit dosage form refers to physically discrete units suitable as unitary dosage for patients undergoing treatment, with each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect, optionally in association with a suitable pharmaceutical carrier. The unit dosage form may be for a single daily dose or one of multiple daily doses (e.g., about 1 to 4 or more times per day). When multiple daily doses are used, the unit dosage form may be the same or different for each dose.
[0147] Toxicity and therapeutic efficacy of such therapeutic regimens are optionally determined in cell cultures or experimental animals, including, but not limited to, the determination of the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between the toxic and therapeutic effects is the therapeutic index, which is expressed as the ratio between LD50 and ED50. The data obtained from cell culture assays and animal studies are optionally used in formulating a range of dosage for use in human. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED.sub.50 with minimal toxicity. The dosage optionally varies within this range depending upon the dosage form employed and the route of administration utilized.
EXAMPLES
[0148] The invention is now described with reference to the following Examples. These Examples are provided for the purpose of illustration only and the invention should in no way be construed as being limited to these Examples, but rather should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.
Materials and Methods.
[0149] The materials and methods employed in the following examples are here described.
[0150] Strains and Culture Conditions.
[0151] C. albicans strains were generated in the SN genetic background using HIS1 and ARG4 markers, as well as the CaNAT1 selectable marker, as described in. Two independent heterozygotes were used to derive homozygous null and reintegrant mutants of PHO84, as well as tetO-TOR1 mutants. Auxotrophies were complemented so that only prototrophic strains were compared in an experiment. Introduced mutations were confirmed by PCR spanning the upstream and downstream homologous recombination junctions of transforming constructs, and sequencing. Experiments with defined ambient Pi concentrations were performed in YNB 0 Pi (ForMedium Ltd, Norfolk, UK) with added KH.sub.2PO.sub.4 to stated concentrations. Other media known in the art was also used in various instances.
[0152] Screening Transposon Mutants for Altered Rapamycin Susceptibility.
[0153] The heterozygous mutant collection containing a mariner transposon marked with CaNAT1 (20) was used. Mutants were pre-grown at room temperature in 96-well plates containing 2xYPD with 8% glucose to minimize hyphal growth. Cells were replicated to YPD agar with vehicle (90% ethanol) or 20 ng/ml rapamycin. Clones showing less growth than the wild type (SC5314) were isolated as rapamycin hypersensitive. The transposon insertion site was identified by vectorette PCR (20).
[0154] Growth Assays.
[0155] For cell dilutions spotted onto agar media as previously described (20), saturated overnight cultures were diluted in 5-fold steps from an OD600 of 0.5. For growth curves in liquid media, saturated overnight cultures in YPD were washed once in 0.9% NaCl and diluted to an OD600 of 0.15 in 150 l medium in flat bottom 96-well dishes. For growth assays including those during drug exposure, OD600 readings were obtained every 15 min in a plate reader and standard deviations of 3 technical replicates were calculated and graphed in Graphpad Prism. Growth during drug exposure was assayed in SC medium. Vehicle for Pho84 inhibitors PAA (Sigma, 284270) and Fos (Santa Cruz Biotechnology, # SC-253593A) was water and for amphotericin B (Sigma, A9528), DMSO. All panels shown represent at least 3 biological replicates.
[0156] Western Blots.
[0157] Cell harvesting, lysis, Western blotting and densitometry were performed as described in Chowdhury T & Khler JR (2015) Ribosomal protein S6 phosphorylation is controlled by TOR and modulated by PKA in Candida albicans. Molecular Microbiology 98(2):384-402. At least three biological replicates were obtained for each experiment shown.
[0158] Hyphal Morphogenesis Assay.
[0159] Cells were revived from frozen stocks on solid YPD overnight, washed and resuspended in 0.9% NaCl to OD600 0.1. Variations between single colonies and colony density effects were minimized by spotting 3 l cell suspension at 4 or 6 equidistant points, using a template, around the perimeter of an agar medium plate as in (20). For small molecule Pho84-inhibitor effects on hyphal formation, Spider and RPMI were used (TOKU-E, Cat # R8999-04), the latter with 0.22 mM KH2PO4 buffered to pH 7 with 50 mM MOPS. All panels shown represent at least 3 biological replicates.
[0160] Acid Phosphatase Assays.
[0161] Overnight cultures in SC were diluted to an OD600 0.05 into YNB medium buffered to pH 4 with 50 mM sodium citrate containing 0 or 11 mM KH2PO4 and grown overnight. P-Nitrophenyl Phosphate (Sigma, N4645) was added to washed cells to a concentration of 5.62 mg/ml. After 15 mins at room temperature the reaction was stopped with Na.sub.2CO.sub.3 (pH=11) to a concentration of 0.3 g/ml, and OD.sub.420 and OD.sub.600 were measured. At least 3 biological replicates, with 3 technical replicates each, were obtained.
[0162] Intracellular Pi Assays.
[0163] Free and total Pi was measured by colorimetric molybdate assay. Cultures were washed with distilled water twice, resuspended in 500 L 0.1% Triton X-100, and lysed by glass bead homogenization. Lysate protein content was determined using a BioRad Protein Assay kit. Free Pi was measured in unboiled lysate, then total phosphate was measured after boiling 3-30 g of whole cell lysate for 10 min in 1 N H2SO4. At least 3 biological replicates, with 3 technical replicates each, were obtained.
[0164] RT-PCR Expression Analysis.
[0165] Cells were grown overnight in YPD medium with 5 ng/ml doxycycline, diluted into YPD with 30 g/ml doxycycline, and harvested at time 0, 2 h and 4 h. RNA was extracted with the Direct-Zol RNA miniprep kit (Zymo Research # R2051).
Example 1: A Screen of Haploinsufficient Transposon Mutants for Altered Rapamycin Susceptibility Identified a PHO84 Ortholog
[0166] A heterozygous mutant collection of mariner-transposon insertions marked with the dominant selectable marker NAT1 was screened for altered rapamycin susceptibility. A transposon mutant hypersensitive to rapamycin was isolated in which the transposon disrupts the promoter of orf19.655, 67 bp upstream of the predicted translational start site (
Example 2: C. albicans Pho84 is Required for the Normal TORC1 Response to Pi Availability
[0167] The relationship between Pho84 and TORC1 was then examined. To test whether rapamycin hypersensitivity is due to decreased TORC1 kinase activity in the pho84/ mutant, the phosphorylation state of ribosomal protein S6 (P-S6) was monitored, which Applicant previously showed is controlled by TORC1 signaling. Null mutants in PHO84 had a weaker P-S6 signal than wild type during Pi refeeding at every Pi concentration of the media, though they responded to increasing Pi concentrations with an increasing P-S6 signal (
Example 3: Heterozygous and Homozygous Deletion Mutants in PHO84 are Defective in Hyphal Morphogenesis
[0168] TORC1 regulates hyphal morphogenesis in C. albicans, an important virulence determinant. Hyphal morphogenesis was defective in pho84 mutants on YPD agar medium with 10% serum, Spider medium and RPMI 1640 (
Example 4: Pi Content of Cells Lacking Pho84 is Diminished
[0169] It was questioned if C. albicans TORC1 activity may be downregulated in response to decreased intracellular Pi in pho84 mutants, analogously to the response of S. cerevisiae TORC1 to decreased intracellular amino acids. Using pho85 mutants as controls known to hyperaccumulate intracellular Pi, it was found that intracellular Pi concentrations were lower in pho84/ null than in wild type cells in low and high Pi-containing media, though the difference was substantially less than in the homologous S. cerevisiae mutant-wild type pair (
Example 5: Gtr1 Links Pho84 to TORC1 in C. albicans
[0170] Seeking a molecular link between Pho84 and TORC1 activity, the possibility that Gtr1 may connect Pho84 to TORC1 was considered. GTR1 was first described for its functional and physical proximity to S. cerevisiae PHO84, and its product later was characterized as a component of the TORC1-activating EGO complex. It was found that the P-S6 response of gtr1/ cells to phosphate refeeding was blunted. To determine whether this is an unspecific effect of decreased upstream TORC1 signaling, mutants in another small TORC1-activating GTPase, RHB1, were tested. rhb1 mutants responded to Pi refeeding like the wild type (
[0171] If Gtr1 acts downstream of Pho84 in activating TORC1, its overexpression may suppress pho84/ phenotypes. GTR1 was overexpressed from the ACT1 promoter in wild type and pho84/ C. albicans cells. Compared with rapamycin hypersensitive pho84/ cells transformed with the empty vector, the resulting pho84/ pACT1-GTR1 cells showed wild type tolerance to rapamycin, suggesting recovery of their TORC1 signaling activity (
[0172] To investigate this possibility TORC1 activity was tested directly by comparing the P-S6 signal of pho84/ cells transformed with the empty vector with that of pho84/ pACT1-GTR1 cells. Overexpression of GTR1 recovered Rps6 phosphorylation in pho84/ cells nearly to wild type levels (
[0173] The relationship of Pho84 to TORC1 activity in the model yeast S. cerevisiae was examined. A pho84 null mutant in the S288C genetic background was hypersensitive to rapamycin (
Example 6: TORC1 Modulates the PHO Regulon
[0174] As TORC1 not only responds to nutrient availability, but also directs nutrient uptake e.g. by regulating expression of amino acid and ammonium transporters, it was questioned whether it may play a similar role in phosphate acquisition. Given known discrepancies between rapamycin exposure and physiological TOR modulation, this potential connection was examined genetically. Repressible tetO was used to control expression of C. albicans TOR1 or of a hypomorphic TOR11-381 encoding a protein lacking the first 381 amino acids which form protein-protein interaction HEAT repeat domains. The effect of TOR1 depletion on expression of PHO84 was then examined.
[0175] When wild type cells were transferred from overnight cultures into fresh rich medium, PHO84 mRNA levels dropped, in accordance with the PHO regulon's response to availability of fresh Pi sources. In cells depleted of either the wild type or the N-terminally truncated TOR1 allele, PHO84 expression also decreased but to a significantly lesser extent (
Example 7: Small-Molecule Inhibitors of Pho84 Repress TORC1 and Potentiate Antifungal Activity
[0176] S. cerevisiae Pho84 has been characterized as a Pi transceptor signaling to PKA, through identification of point mutations and small molecules that preferentially perturb transport, signaling or both. Direct pharmacological inhibition of C. albicans TORC1 with rapamycin incurs too high a cost on host immune function to be clinically useful. In order to determine whether blocking Pho84 with its small-molecule inhibitors phosphonoformic acid (foscarnet, Fos) and phosphonoacetic acid (PAA), which inhibit C. albicans growth in dependence on the presence of their target Pho84 (
[0177] Potentiating existing antifungals is a promising strategy. Fos at concentrations reached in plasma during antiviral therapy, and PAA, potentiate activity of the antifungal amphotericin B, at concentrations of the latter far below those in serum or tissue during standard dosing (
Example 8: Pho84 is Required for Virulence of C. albicans in a Wild-Type Drosophila Model
[0178] Null mutants in PHO84 are defective in TORC1 signaling and in hyphal growth. As C. albicans hyphal growth is a virulence determinant, pho84/ null mutant cells' virulence in a Drosophila model was examined. In the wild type OregonR strain used, Drosophila immune responses are intact, so that the fungus must contend with the full complement of innate immunity. By 5 days after infection, 30% of flies injected with PHO84 wild type, and 8% of those injected with pho84/ null cells had died (p-value <0.001). Heterozygous /+ pho84/PHO84 and reintegrant //+ pho84/pho84/PHO84 mutants had intermediate phenotypes that were statistically indistinguishable from null mutants and wild type, respectively (
Example 9: Pho84 Contributes to Virulence in Murine Disseminated and Oropharyngeal Candidiasis
[0179] Given their virulence defect in an insect model, the virulence of pho84/ null cells in two murine models of infection was examined. One path of natural C. albicans infection is invasion of the mucosa, which is not modeled in the fruit fly. Pho84/ null and wild type cells were compared for the ability to proliferate in a murine oropharyngeal candidiasis model. Loss of Pho84 resulted in decreased fungal burden in tongue tissue (
[0180] In the oropharyngeal candidiasis model, loss of virulence of the pho84/ null cells and pho84//+ reintegrant cells were similar. Haploinsufficiency of PHO84 heterozygous and reintegrant cells was observed. In fact, in a single phenotype, hypersensitivity to oxidative stress, Applicants observed haploinsufficiency or tolerance recovery to nearly wild type levels in reintegrants, depending on the intensity of the stress (
[0181] Once C. albicans cells have crossed the mucosa and entered the bloodstream, they disseminate to distant organs and initiate metastatic foci of infection. Therefore, it should be determined whether Pho84 is required for C. albicans virulence during hematogenous infection. Survival of mice injected intravenously with wild type, pho84/ null and PHO84 reintegrant cells was compared. As shown in
Example 10: Pho84 is Required for Tolerance of Whole Blood Candidacidal Activity, Neutrophil Killing and Reactive Oxygen Species (ROS) Exposure
[0182] During bloodstream infection, invading C. albicans cells encounter host blood components. Heparinized whole blood from healthy human volunteers was incubated with C. albicans and survival of pho84/ null cells was found to be significantly decreased after 5 hours, compared with the wild type and reintegrant (
[0183] Neutrophils are the critical elements of cellular innate immunity with a major role in the first line of defense against invasive candidiasis. Therefore, the ability of pho84/ null cells to survive the attack of human neutrophils was tested. The HL-60 human promyelocytic leukemia cell line which can be induced to differentiate into neutrophil-like cells was used. Null mutants in PHO84 were significantly more sensitive to killing by these neutrophil-like cells than wild type or reintegrant cells (
[0184] To examine whether in fact ROS are responsible for pho84/ null cells' increased susceptibility to neutrophils' cidal activity, Candida-ingesting neutrophils were treated with the ROS-scavenging compound N-acetyl cysteine (NAC). In a dose-dependent manner, NAC rescued hypersensitivity of pho84/ null cells to neutrophil killing (
[0185] These findings raised the question whether pho84/ null mutants are simply hypersensitive to ROS. Exposing wild type, pho84/ null, and reintegrant cells to the inducers of superoxide anion, plumbagin and menadione, as well as hydrogen peroxide (H.sub.2O.sub.2), it was found that each of these compounds inhibited growth of the mutant more strongly than that of the wild type (
Example 11: Pho84 is Required for ROS Management
[0186] Defective HOG pathway signaling might be responsible for the inability of pho84/ null cells to manage oxidative stress. The HOG pathway is a major signaling system by which C. albicans induces survival responses to RO. The phosphorylation state of the central kinase of the pathway, Hog1, was examined as a readout of HOG activation in response to oxidative stress. It was found that contrary to expectations, pho84/ null cells showed prolonged and hyperintense Hog1 phosphorylation during a timecourse of peroxide-mediated induction (
[0187] The apparent paradox of Hog1 pathway hyperactivation of cells lacking Pho84, and their increased susceptibility to extrinsic ROS, might be reconciled if these cells are unable to manage intracellular ROS. ROS are intrinsically generated by normal mitochondrial respiration. The DCFDA detectable ROS of unstressed exponentially growing pho84/ null and wild type cells were compared, and of these cells exposed to oxidative stressors. Cells devoid of Pho84 had an increased ROS content, compared to the wild type, when unexposed or exposed to the superoxide anion-generating compound menadione, or to peroxide-generating H.sub.2O.sub.2 (
[0188] Furthermore, loss of Pho84 leads to accumulation of ROS (
Example 12: Superoxide Dismutase Expression is Perturbed in Pho84/ Null Cells
[0189] Superoxide dismutates (SODs) contribute to ROS management by disproportionating the superoxide anion into H.sub.2O.sub.2 and oxygen, using a redox-active metal. Among the 3 intracellular and 3 extracellular SODs of C. albicans, manganese-using Sod3 enables C. albicans to switch between SODs depending on ambient copper concentrations during infection. In C. albicans pho4 null mutants, lacking the DNA binding protein that controls the PHO regulon, mRNA expression of 3 copper-using superoxide dismutases (SOD1, SODS and SOD6) is upregulated, while that of manganese-using SOD3 is decreased. It was questioned whether increased ROS content in pho84/ null cells might be due to decreased SOD protein content or activity. pho84/ null cells showed a subtle decrease of Sod1 activity (
[0190] Expression of SODs varies with metal availability in C. albicans. Since in S. cerevisiae, Pho84 under certain conditions transports manganese in addition to Pi, it was questioned whether lack of PHO84 might result in a manganese-depleted state in C. albicans which could lead to Sod3 deprivation and consequent failure to adequately manage ROS. In fact, upon measuring the intracellular manganese and copper concentrations, it was found that the opposite is true: both metals' concentrations were increased in pho84/ null cells growing in standard synthetic complete medium, compared to wild type cells (
Example 13: Overexpression of a TORC1 Activator Downstream of Pho84 Suppresses ROS Management Defects of Pho84/ Null Cells
[0191] In S. cerevisiae, decreased TORC1 signaling increases mitochondrial ROS production. C. albicans cells lacking Pho84 exhibit decreased TORC1 signaling. This phenotype can be suppressed by overexpression of a component of the amino-acid signaling EGO complex, the small GTPase Gtr1, which may participate in transmitting a Pi signal to TORC1. It was questioned whether suppressing the TORC1 signaling defect of pho84/ null cells by overexpressing GTR1 might improve ROS management of these cells. In the absence of exogenous oxidative stressors, GTR1 overexpression decreased the DCFDA detectable ROS in cells with active TORC1, as well as in cells experiencing TORC1 inhibition by exposure to a low concentration of rapamycin (
Example 14: Pho84 is Required for Virulence Toward In Vitro & Ex Vivo Host Cell Models & for Resistance to Neutrophil Killing
[0192] The extent of damage caused by C. albicans strains to human umbilical vein endothelial cells and the FaDu epithelial cell line was measured using a .sup.51Cr release assay. Mammalian cells were grown in a 96-well tissue culture plate and incubated overnight with Na.sub.2.sup.51CrO.sub.4. The following day, endothelial were infected with 410.sup.4 C. albicans cells in RPMI, while FaDu cells were infected with 10.sup.5 organisms in the same medium. After a 3-h incubation, the upper 50% of medium was removed from each well and the amount of .sup.51Cr in the aspirates and the well was determined by gamma counting. The data are presented in
[0193] C. albicans strains were incubated with HL-60 derived neutrophil-like cultured cells for 90 minutes at 37 C. with 5% CO.sub.2. Percent killing was calculated by dividing the number of CFU after co-culturing with HL-60 derived neutrophils by the number of CFU from C. albicans incubated with media without HL-60 derived neutrophils. HL-60 derived neutrophils were tested at a 20:1 phagocyte:fungus ratio in RPMI plus 10% pooled human serum.
Example 15: Pho84 is Required for Resistance to Platelet-Dependent Human Whole Blood Inhibition of C. albicans
[0194] Human whole blood was depleted of platelets to a count of 50,000/ml and half of the blood aliquot was reconstituted to a platelet count of 200,000/ml. C. albicans PHO84/PHO84 wild type or pho84/pho84 null mutant cells from a washed overnight were inoculated to a density of 210.sup.3/ml and cfu counts were obtained by plating on YPD at the indicated time points. 2 biological replicates only to date. The data are presented in
Example 16: Neutrophil Extracellular Traps (NETs) Results in Rapid Damage to the Pho84/ Mutant
[0195] Cells from YPD overnight were washed with 0.9% NaCl and exposed to freshly isolated human neutrophils forming neutrophil extracellular traps (NETs), at a multiplicity of infection of 2. At 2 and 5 hours, neutrophils were lysed by exposure to 0.1% TritonX, cells were washed in water and plated for cfu counts. Data are presented in
Example 17: High Throughput Screen for Inhibitors of Pho84
[0196] For high-throughput screening, a reporter strain, hemizygous for PHO84 and hence sensitized to Pho84 inhibitors, was generated, in which GFP is expressed from the PHO84 promoter. In cells transferred from PHO84-repressing (Pi rich) to -inducing (Pi poor) media, GFP is induced by ca. an order of magnitude per flow cytometry assay (
[0197] This reagent can also be used, together with pho84/PHO84 strains without GFP expression, as a chemical-genetic screenable sensitized mutant, because it expresses a single allele of PHO84 and hence is more sensitive to inhibitors than the wild type. By simple growth assays, such as those relying on optical density or absorption at 600 nm, or those relying on reduction of resazurin by metabolically active cells, these strains will exhibit more profound growth failure in low-phosphate media at 0.2 to 0.5 mM KH.sub.2PO.sub.4 than wild-type comparators.
[0198] Pho84 is highly conserved among fungal species, and a more distant homolog is even conserved in the pathogenic amoeba Entamoeba histolytica (
[0199] Ascomycota
[0200] Candida parapsilosis, C. glabrata, C. lusitaniae, C. krusei, C. dublinensis, C. kefyr, C. auris
[0201] Pneumocystis jirovecii
[0202] Aspergillus fumigatus, A. flavus, A. niger, A. terreus, A. nidulans
[0203] Fusarium solani, F. oxysporum, Fusarium verticillioidis and Fusarium moniliforme, Fusarium dimerum, Fusarium proliferatum, Fusarium chlamidosporum, Fusarium sacchari, Fusarium nygamai, Fusarium napiforme, Fusarium antophilum, and Fusarium vasinfectum
[0204] Pseudoallescheria boydii, Scedosporium apiospermum, S. prolificans
[0205] Alternaria alternata, Acremonium kiliense
[0206] Blastomyces dermatitidis
[0207] Histoplasma capsulatum
[0208] Coccidioides immitis, C. posadasii
[0209] Paracoccidioides brasiliensis
[0210] Trichophyton rubrum, T. tonsurans, T. schoenleinii, T. verrucosum, T. mentagrophytes, T. interdigitale, T. violaceum
[0211] Microsporum canis, M. audouinii, M. ferrugineum, M. cookei
[0212] Nannizzia fulva, N. gypsea, N. persicolor, N. nana
[0213] Arthroderma insingulare, A. uncinatum
[0214] Epidermophyton floccosum
[0215] Basidiomycota
[0216] Cryptococcus gattii, Cryptococcus neoformans
[0217] Trichosporon asahii
[0218] Mucorales
[0219] Mucor mucedo, M. circinelloides
[0220] Rhizopus oryzae
[0221] Cunninghamella bertholletiae
[0222] Lichtheimia ramosa
[0223] Rhizomucor pusillus
[0224] Saksenaea vasiformis
EQUIVALENTS
[0225] Although preferred embodiments of the invention have been described using specific terms, such description is for illustrative purposes only, and it is to be understood that changes and variations may be made without departing from the spirit or scope of the following claims.
INCORPORATION BY REFERENCE
[0226] The entire contents of all patents, published patent applications, and other references cited herein are hereby expressly incorporated herein in their entireties by reference.