TREATMENT AND COMPOUND FOR EPITHELIAL WOUNDS
20200061125 · 2020-02-27
Inventors
Cpc classification
A61K9/19
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61K9/0053
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K9/06
HUMAN NECESSITIES
A61P17/02
HUMAN NECESSITIES
A61K9/0014
HUMAN NECESSITIES
International classification
Abstract
There are disclosed an effective dosage of major royal jelly protein 1 for treating various skin ailments. Instead of administering royal jelly, an effective amount of the active constituent of royal jelly, MRJP1 is administered either alone or in combination with other topical pharmaceuticals.
Claims
1. A method for enhancing the healing of a mechanical, surgical, ischemic, infectious, or neuropathic skin wound or ulcer, comprising administering to the wound or ulcer a therapeutically effective amount of major royal jelly protein 1 (MRJP1), wherein the method is effective for treating the wound or ulcer.
2. The method of claim 1, wherein the therapeutically effective amount of a major royal jelly protein 1 (MRJP1) is 1-10,000 mg/L of MRJP1.
3. The method of claim 2 further comprising; engineering an organism to express MRJP1; introducing the organism to a wound site; the organism colonizing the wound site; the organism expressing MRJP1 which enhances healing of the wound.
4. The method of claim 2, wherein the MRJP1 is administered as a topical MRJP1 in the form of creams, powders, gels, dressings, liquids, aerosols injectables, tablets, capsules, suspensions or aerosols.
5. The method of claim 2, wherein the MRJP1 is administered via injection.
6. The method of claim 2 wherein the MRJP1 is administered orally.
7. The method of claim 2, wherein the therapeutically effective amount is topically administered after cleaning, disinfection and/or debridation of the wound.
8. The method of claim 2, wherein the MRJP1 is topically administered at a frequency of once per day, once every other day, once every three days, two to three times per week or once per week.
9. A method for enhancing the healing of mechanical, surgical, ischemic, infectious, or neuropathic skin wounds or ulcers, comprising administering to the wound or ulcer a therapeutically effective amount of a major royal jelly protein 1 (MRJP1), along with at least one analgesic, anti-inflammatory and/or antiseptic compound wherein the method is effective for treating the wound or ulcer.
10. The method of claim 9, wherein the MRJP1 is obtained from a natural source such as royal jelly, by means of ultrafiltration, liquid-liquid extraction, ultracentrifugation, chromatography or a combination thereof.
11. The method of claim 9, wherein MRJP1 is obtained from a bacterium, yeast, fungus, animal cell culture, plant cell culture, algae and microalgae or a transgenic organism that has undergone adaptive laboratory evolution.
12. The method of claim 9, wherein the MRJP1, is obtained from a synthetic method such as chemical synthesis or in vitro translation of proteins or peptides.
13. The method of claim 9, wherein the MRJP1 is delivered to cells through enhanced cell delivery via endosomes or nanocarriers.
14. The method of claim 9, wherein the MRJP1 is paired with an analgesic, anti-inflammatory, or antiseptic compound.
15. The method of claim 9, wherein the MRJP1 is paired with other skin growth factors from a natural or synthetic origin, from human or non-human organisms, of proteic or non-proteic composition.
16.-21. (canceled)
Description
DESCRIPTION OF THE DRAWINGS
[0008]
[0009]
[0010]
DETAILED DESCRIPTION
[0011] By isolating the effective component of royal jelly, major royal jelly protein 1 (MRJP1), and adding it to another composition in an effective concentration, a pharmaceutical composition that enhances tissue granulation, re-epithelialization and vascularization is obtained. MRJP1 in sufficient amounts may be used to treat mechanical, surgical, ischemic, infectious, or neuropathic skin wounds or ulcers. Additionally, topical MRJP1 may be used in mechanical injuries of the skin, vascular angiology, surgery recovery, dermatological disorders, burn treatment, reconstructive surgery, geriatric medicine, treatment of gangrenes and cosmetics.
[0012] The problem with other therapeutics attempting to use royal jelly is that other major royal jelly proteins that are not as effective as MRJP1 are kept in solution near a wound site. Additionally, other large chemicals such as sugars, fats, oils and other proteins are kept in solution as well. These other chemicals not only necessitate a smaller concentration of MRJP1, but also interfere with MRJP1 interacting with necessary proteins to aid in healing. Utilizing an effective amount of MRJP1 solves the problem of royal jellies and other pharmaceutical compositions that do not significantly aid in healing.
[0013] MRJP1 when isolated can be found in monomer or oligomer form. Depending on the topical pharmaceutical being produced, it may be advantageous to adjust the proportion of MRJP1 monomer to MRJP1 oligomer. Some topical formulations of MRJP1 may require a higher proportion of oligomer MRJP1 to monomer MRJP1 whereas in others the case may be reversed. As a general rule, the more oligomers of MRJP1 in solution, the more enhanced the healing will be.
[0014] MRJP1 stimulates cell proliferation by binding to the epidermal growth factor receptor (EGFR) of human cells. Epidermal growth factor receptors are a transmembrane protein found in cells making up epithelial tissue. MRJP1 displays a unique ability to interact with EGFR in humans and stimulate growth of epidermal cells. Although royal jellies often have different content compositions, some have 60-70% water, 12-15% proteins (including MRJPs), 10-16% sugar, and 3-6% lipids, vitamins, salts, and free amino acids. This means that when royal jelly is rubbed on a wound very little if any MRJP1 actually interacts with epithelial cells. If other royal jelly proteins or molecules are at a wound site, they may compete to bind, interact, or even block EGFR receptors. Even if other molecules show no binding affinity to EGFR, they may denature or interact with MRJP1, causing less MRJP1 to be available to interact with EGFR. Rather than apply royal jelly to a wound in the hopes that some MRJP1 gets to some receptors, a more effective therapy is to isolate the actual protein responsible for wound healing (MRJP1) and apply that protein in an effective dosage to actually bring about useful results.
[0015] Additionally, MRJP1 has been found to have bacteriostatic effects. Not only does MRJP1 stimulate EGFR, but MRJP1 can inhibit pathogens from causing infections at a wound site. Inhibiting infections at a wound site further aids in healing because the body's resources are spent growing new cells and tissue rather than fighting pathogens.
[0016] Adding MRJP1 alone to a wound site is an effective treatment. Other effective treatments involve combining an effective amount of MRJP1 with an acceptable pharmaceutical or cosmetic product. Whatever product is used must ensure that MRJP1 protein is not denatured, or if some MRJP1 is denatured, that enough MRJP1 remains able to interact with EGFR when introduced to a wound site.
[0017] An effective amount of MRJP1 can be added to various topical pharmaceutical compounds such as creams, lotions, ointments and other substances discussed below. This topical MRJP1 could then be applied to a wound area for enhanced healing. A pharmaceutical formulation of topical MRJP1 should include 1-10,000 mg/L of isolated MRJP1 to be effective. In other circumstances, so long as MRJP1 is 1-10% the weight of the end product, topical MRJP1 will retain its efficacy. In human patients, application of topical MRJP1 containing 1-10,000 mg/L MRJP1 to a wound, may yield an up to 300% increase in the speed of healing. Patients undergoing treatment may also exhibit an increase in cell proliferation, cell migration, and vascularization. MRJP1 also increases re-epithelialization and granulation, which further helps with wound healing.
[0018] MRJP1 may be added alone to other topical pharmaceutical compounds as to maximize the amount of MRJP1 available to interact with EGFR. Other times, it may be beneficial to add MRJP1 to only a limited number of other chemicals that do not negatively interact with MRJP1 as to affect its binding affinity to EGFR. In other instances, already available cosmetic or pharmaceutical products may be fortified with MRJP1.
[0019] MRJP1 may be incorporated into other topical pharmaceuticals. Topical pharmaceuticals include creams, powders, dressings, liquids, ointments, gels, sunscreens, chap sticks, aerosols, sprays, nose, ear and eye drops, lotions, lozenges, paints, sprays and pastilles. MRJP1 may also be ingested orally as in a pill or tablet. In certain cases, MRJP1 alone may be added to the wound without any additives or in combination with any other compositions. MRJP1 can also be injected into a wound site or other parts of the body.
[0020] It may be beneficial to lyophilize (freeze dry) MRJP1 before adding it to certain topical formulations. To lyophilize MRJP1, MRJP1 should be isolated from other proteins or compounds and suspended in distilled water or an appropriate buffer solution. The isolated MRJP1 may then be freeze dried in a freezer. The entire lyophilization process may be done at 4 C. The lyophilization process can also start at a lower temperature, and gradually be heated up to 4 C. Once lyophilized, the lyophilized MRJP1 may be added to the compositions discussed below. In other instances, lyophilized MRJP1 may simply be introduced to a wound.
[0021] MRJP1 may be combined with a powder to create an effective powder formulation of MRJP1. This powder formulation may be applied to a wound site for enhanced healing. An example powder formulation of MRJP1 could be made by combining 1%-10% by weight lyophilized or non-lyophilized MRJP1, with 90%-99% dusting agent. Appropriate dusting agents include, talcum powder, cornstarch, cellulose products, sodium bicarbonate, montmorillonite, bentonite, leaf or other plant cell extract, ulmus fulva bark powder, rosa centifolia flower extract, and limonene. Dusting agents may either be combined with MRJP1 alone or in combination with other dusting agents and additives. For example, one effective powder formulation may be obtained by combining 10% lyophilized MRJP1, 83% talcum powder and 7% plant cell extract all by weight. Conventional solid makeups such as foundation and cover-up may also constitute a dusting agent.
[0022] MRJP1 may also be administered through, gels, creams, lotions, and ointments, to create an MRJP1 rub. The major difference between gels, creams, lotions, and ointments may either be the viscosity of the final product, or the entire formulation. Thus, a formulation appropriate for an ointment may be very similar to a lotion, the major difference being the lotion has more water or comparable liquid in it, making the final topical compound less viscous while the ointment has less water or comparable liquid in it, making it more viscous. Other times a lotion may have an almost entirely different chemical composition than the ointment (except for the addition of MRJP1). For example, an appropriate MRJP1 formulation for an ointment could consist of, zinc oxide, cetearyl alcohol, ceteareth-20, cetyl alcohol, glyceryl stearate, titanium dioxide, castor oil, bentonite, phenoxyethanol, iron oxides, and MRJP1, while an appropriate formulation of skin lotion for MRJP1, could consist of olive oil, castor oil, and MRJP1. However, note that by increasing the amount of castor oil in the skin lotion solution, one can obtain an ointment by the same formula because castor oil would make the lotion thicker.
[0023] A topical MRJP1 cream may be obtained by combining an effective amount of MRJP1 with creaming agent. Suitable creaming agents include sorbitan monooleate, sorbitan sequioleate, sorbitan trioleate, glyceryl stearate, sorbitan stearate, sorbitan tristearate, glycerin, glycerol, olive oil, triethanolamine, honey, carbomer, emulsifying wax, cetyl alcohol, quaternium, phenoxyethanol, benzyl salicylate, limonene, linalool, and beeswax. Additionally, effective creaming agents may be creams already on the market that would not denature proteins or MRJP1.
[0024] One potential formulation for an MRJP1 cream would be 1 cup vegetable oil, cup MRJP1 solution, 3 tbs cocoa butter, 6 tsp glycerin, 1 aloe vera juice, 1 tsp borax, and 2 tsp rosemary extract.
[0025] Other topical formulations include eye drops, and nose drops. A lyophilized version of MRJP1 can be placed in a solution of commercial eye drops or nose drops. In other instances, MRJP1 can be suspended in a solution of artificial tears. MRJP1 may also be combined with corticosteroids to enhance uptake in the nasal cavity and eyes. Fluticasone and triamcinolone may be used with MRJP1 without effecting MRJP1's efficacy. Other topical formulations include wound dressings such as gauze, tape, and bandages. To make a wound dressing, the dressing must be impregnated with MRJP1, and the MRJP1 must be allowed to diffuse to a wound site when applied near the wound. In one formulation MRJP1 may be added to hydrogel to create a dressing that when applied to a wound releases MRJP1. Lyophilized or non-lyophilized MRJP1 may be also be added to bandages, or gauze. A wound dressing may be soaked in a solution of MRJP1 and either dried then applied or applied directly to a wound site.
[0026] In other instances, MRJP1 can be suspended in water or an appropriate buffer, then added to a topical pharmaceutical or simply applied to a wound site. Appropriate buffers include phosphate buffer saline (20 mM Na2HPO4, 2 mM NaH2PO4.2H2O and 150 mM NaCl). Other buffers include Tris-acetate-EDTA, Tris-borate-EDTA, Tris-glycine buffer, SDS-Tris-glycine buffer, 4 Tris/SDS, and Tris-Tricine. An appropriate buffer should be kept at a pH of 7.4-8.0 to maximize MRJP1 efficacy.
[0027] When suspended in water or put in a buffer, a solution of MRJP1 may be combined with an aerosol and applied to a wound site. The solution of MRJP1 may also be put into a spray applicator such as a spray bottle and then sprayed on a wound as well.
[0028] Some users of topical MRJP1 may find it difficult to incorporate a new topical pharmaceutical into their daily routine. In this case, MRJP1 can be added to an already existing and purchased pharmaceutical or cosmetic product that the user already applies. For example, many people purchase moisturizers such as Neutrogena Hydro Boost or acne creams such as Keeva. An effective amount of MRJP1 may be mixed with these products before use to enhance the healing effects of those products. Additionally, MRJP1 may be incorporated into a cosmetic facemask. Along with being composed of the lotions and creams disclosed, facemasks may also be made from minerals, vitamins, fruit extracts, clays, and mud. MRJP1 may either be applied to the skin before the application of a mask or be applied to the material making the mask.
[0029] It may be appropriate to infuse other additives with a topical formulation of MRJP1. These additives may either enhance healing or have other perceived health benefits. Appropriate additives include vitamin A, vitamin C, vitamin D, vitamin E, vitamin K, thiamine, riboflavin, niacin, pantothenic acid, biotin, vitamin B-6, vitamin B-12 folate, gold nano particles, minerals including calcium, chloride, magnesium, phosphorus, potassium, sodium, and sulfur. Corticosteroids may also be added. In other formulations antibiotics may also be added. A proper pharmaceutical incorporating MRJP1 should not have so many other proteins or large molecules in it, that MRJP1 can no longer interact with EGFR.
[0030] Often times wound sites may become infected. Thus, including other compounds that reduce infection such as bactericides may be beneficial. Other additives include analgesic, anti-inflammatory and/or antiseptic compounds. More specifically, chlorhexidine, povidone-iodine, iodine, chloroxylenol, benzalkonium chloride, hexachlorophene, polyhexanide, acriflavine, merbromin, and sodium hypochlorite may be added in diluted forms.
[0031] MRJP1 successfully stimulates skin growth. Still, in certain topical formulations it may be beneficial to combine MRJP1 with other molecules that stimulate skin growth, or skin growth factors. Skin growth factors may be other proteins or biologically produced molecules such as adrenomedullin, angiopoietin, autocrine motility factor, bone morphogenetic proteins, ciliary neurotrophic factor, leukemia inhibitory factor, interleukin-6 (IL-6), colony-stimulating factors, macrophage colony-stimulating factor (M-CSF), granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage colony-stimulating factor (GM-CSF), epidermal growth factor (EGF), ephrins, erythropoietin, fibroblast growth factor, foetal bovine somatotrophin, neurturin, persephin, artemin, neuregulins, placental growth factor, T-cell growth factor, thrombopoietin, transforming growth factors, and vascular endothelial growth factor. Note, the skin factors above although mostly human in origin may be obtained from non-human organisms. Synthetic or non-synthetic growth factors are appropriate in most cases. Additionally, growth factors may be synthesized in a lab or harvested from an organism, or grown in cell culture.
[0032] If MRJP1 is not available, then other major royal jelly proteins may be used in concentrated form to enhance healing. For example, a concentration of major royal jelly protein 2 in concentration of 1-10,000 mg/L or 1-10% MRJP1 by weight may also lead to enhanced healing. The same is true for major royal jelly proteins 3-9. Note however MRJP1 will likely yield the best results in comparison to other concentrated royal jellies.
[0033] MRJP1 may also be administered though injection or intravenous drip. MRJP1 can also be introduced to endosomes or nanocarriers which can either be applied to the skin or bloodstream. However, using topical MRJP1 treatment may be less painful because injections often need to pierce the skin. Additionally, whereas injections are usually administered by medical personnel, topical MRJP1 can be administered by a patient themselves without the need for highly trained staff or cumbersome doctor visits.
[0034] MRJP1 added to topical pharmaceuticals is superior to other treatments not only because it makes wounds heal faster, but because its use reduces other negative impacts associated with conventional treatment. For example, the cost of healthcare can be reduced because patients spend less time in the hospital when their wounds heal faster. Additionally, patients may take less trips to the hospital if their wounds heal faster. Unlike most topical pharmaceuticals, topical MRJP1 not only stimulates re-epithelialization but also granulation and vascularization of an affected area of the body. This makes MRJP1 a unique component for pharmaceutical formulations for the treatment of skin wounds or ulcers of any type or etiology.
[0035] A sufficient concentration of MRJP1 can be obtained by isolating MRJP1 from royal jelly produced by a bee hive. MRJP1 can also be obtained by organic or other chemical synthesis. MRJP1 can also be produced through biotechnology production methods. Recombinant DNA technology can be used to create transgenic prokaryotic or eukaryotic cells. Bacteria, yeast, fungi, algae, microalgae animals, plant, vegetables or their cultured cells can then produce MRJP1 in an adequate amount to produce a concentration sufficient for a pharmaceutical solution of MRJP1. Experimental evolution techniques such as adaptive evolution could also be used to either give an organism the ability to or enhance an organism's capabilities of producing MRJP1. Another method of producing MRJP1 is to create knockout versions of bees that only express MRJP1 and no other major royal jelly proteins. RNAi, and CRISPR can be used to silence genes coding for all major royal jelly proteins besides MRJP1. Additionally, MRJP1 genes can be upregulated using a strong promoter to increase production of MRJP1. Rather than delete other major royal jelly proteins, major royal jelly proteins 2-9 could simply be replaced by MRJP1 genes to increase production of MRJP1.
[0036] Genetic sequences from the following organisms may be used to create MRJP1 through biotechnological processes, Apis mellifera, Apis cerana, Bactrocera dorsalis, Ceratitis capitate, Apis dorsata, Zeugodacus cucurbitae, and Aedes albopictus.
[0037] Genetic sequences that code for the following amino acids may be used to create MRJP1.
TABLE-US-00001 Sequence1: MTRLFMLVCLGIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERR QDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDG GPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMC SPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSD TMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQ DGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQN ILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDET LQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNF RIMNANVNELILNTRCENPDNDRTPFKISIHL Sequence2: MTRWLFMVVCLGIVCQGTTSSILRGESLNKSLSVLHEWKFFDYDFDSDER RQDAILSGEYDYRKNYPSDVDQWHGKIFVTMLRYNGVPSSLNVISKKIGD GGPLLQPYPDWSFAKYDDCSGIVSATKLAIDKCDRLWVLDSGLVNNTQPM CSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQPLDCNING DTMVYIADEKGEGLIVYHDSDNSFHRLTSKTFDYDPKFTKMTINGESFTT QSGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSNYEQNAVHYEGVQ NILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRSLERHNIRTVAQSDE TLQMIVGMKIKEALPHVPIFDRYINREYILVLSNRMQKMANNDYNFNDVN FRIMDANVNDLILNTRCENPNNDNTPFKISIHL Sequence3: MRALQSLVCTALALACVLASDDDKDMEPVIWTGGETLDPRTGQTHFNGLA TRCQIHEHWGFVAIPKLKPDVQSSCAKLDMRKQIGVQTKHILTPFPPNEP TDPQSPKRLQSVVDLCIDHLNSVWVLDVGAIYPPKNEDDPTPIICHPKIC AYNAADGKLRFDMNLLPYVGPMSRLQFINVDYDEHGDPFVHVSDAGTKAL IVCDVKRNTCHRVELPEDVISDYAPRDVLYTVLVRKANGRNKLYFTYRSG ESLWCVNTQDLQKDKSCSKAWVVGKKEHKMIILGTDDWESMYFRWEENTK EVYKWNTETAFDSKNFLLVHKSHTDLTPTHAMADYKNGVMRICLGNLIDY LKHDTHTKEAKNSLEVMAIGDEPSPSSHLGHSGMREL
[0038] MRJP1 may also be applied in a probiotic form. A probiotic form would comprise a microorganism either naturally expressing or engineered to express MRJP1 either intracellularly, or extracellularly. Suitable microorganisms include bacteria already naturally living in humans including, Acinetobacter calcoaceticus, Burkholderia cepacia, Pseudomonas pseudoalcaligenes, Fusobacterium necrophorum, Staphylococcus aureus, and Staphylococcus epidermidis. In particular, it may be even more beneficial to select a microorganism that normally lives on human skin to express MRJP1. Some of these species and specific organisms include, Bacillus, Candida albicans, Corynebacterium, Corynebacterium parvum, Demodex folliculorum, Enterobacter cloacae, Epidermophyton floccosum, Micrococcus, Micrococcus luteus, Mycobacterium, Neisseria, Peptostreptococcus, Malassezia ovale, Propionibacterium, Propionibacterium acnes, Pseudomonas aeruginosa, Sarcina, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus haemolyticus, Streptococcus viridans, Trichophyton. In other embodiments, organisms besides bacteria such as yeast and fungi may be engineered to express MRJP1 while residing on a human body.
[0039] MRJP1 in probiotic form may either be applied directly to a wound site, ingested, or injected into a human. The benefit of MRJP1 applied in probiotic form to a wound site may be twofold. First, the MRJP1 produced by the organism will benefit a wound for the reasons described above. Second, the organisms producing MRJP1 if near or on a wound will crowd out the surface space by being present there. This means that other harmful organisms that would usually infect a wound site would be unable to cause an infection, because the space the infectious organisms would occupy has literally already been taken up by beneficial organisms expressing MRJP1.
[0040] MRJP1 can also be obtained by isolating it from royal jelly. Appropriate methods for isolating MRJP1 from the other chemicals in royal jelly include ultrafiltration, liquid-liquid extraction, ultracentrifugation, centrifugation, chromatography, ion-exchange, and gel filtration chromatography. Additionally, straining royal jelly may also be able to separate MRJPs from one another. Fractionation of the MRJPs on DEAE cellulose may also be used. Royal Jelly proteins may also be centrifuged to separate them from one another. A combination of the above filtration methods may also be used.
[0041] MRJP1 should not exceed a final concentration of 10,000 mg/L or 1%-10% MRJP1 by weight when added to any other pharmaceutical or used in treatment. A higher concentration may produce adverse side effects. Although a concentration of 1 mg/L may be enough to bring beneficial results, compositions should strive to include a concentration above 1 mg/L.
[0042] It should be noted that MRJP1 itself may have a short shelf life. However, when combined with other pharmaceutical compounds MRJP1 will retain its efficacy for two years if kept in room temperature storage. Lyophilized MRJP1 will retain its shelf life faster than MRJP1 stored in solution. This is important for reducing the cost and transportation of the formulation. As a general rule, MRJP1 formulations should be kept in a refrigerator or cold area to increase shelf life. Topical MRJP1 is suitable for use in humans, veterinary care, and experimental medicine.
[0043] Depending on the wound, topical MRJP1 should be applied at different frequencies. As a general rule, MRJP1 in a cream is better for dry ulcers exhibiting normal or moderate exudation. MRJP1 with powder or aerosol may be better for treating ulcers exhibiting high exudation. Applying a topical formulation of MRJP1 once per day may be enough. For some wounds, once every other day, once every three days, two to three times per week or once per week may be appropriate. Generally, MRJP1 should be applied whenever a wound dressing is changed, or wound cleaning takes place. As a general rule the more severe the wound, the higher the frequency of MRJP1 applications. In other cases, simply applying topical MRJP1 liberally will enhance healing. In other instances, a topical form of MRJP1 can be integrated into a person's own skincare routine. For example, if someone applies acne cream twice a day (once in the morning and once at night) they can also apply topical MRJP1 once in the morning and once at night. If recommended or prescribed by a doctor, patients or users of MRJP1 should apply MRJP1 according to the doctor's instructions.
[0044] For enhanced results a wound should be cleaned and disinfected before applying Topical MRJP1. Wound cleaning will often depend on the wound. For example, depending on the severity of a burn wound, dead skin will likely need to be removed to clean the wound. If possible, debridement should occur before the application of topical MRJP1. The severity and type of ulcer will also mandate cleaning before applying topical MRJP1.
[0045] As used herein, plurality means two or more. As used herein, a set of items may include one or more of such items. As used herein, whether in the written description or the claims, the terms comprising, including, carrying, having, containing, involving, and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases consisting of and consisting essentially of, respectively, are closed or semi-closed transitional phrases with respect to claims. Use of ordinal terms such as first, second, third, etc., in the claims to modify a claim element does not by itself connote any priority, precedence, or order of one claim element over another or the temporal order in which acts of a method are performed, but are used merely as labels to distinguish one claim element having a certain name from another element having a same name (but for use of the ordinal term) to distinguish the claim elements. As used herein, and/or means that the listed items are alternatives, but the alternatives also include any combination of the listed items.