EPSTEIN-BARR VIRUS ANTIBODIES AND USES THEREOF
20200055924 ยท 2020-02-20
Inventors
- Javier Gordon OGEMBO (San Dimas, CA, US)
- Lorraine Zvichapera MUTSVUNGUMA (Duarte, CA, US)
- Alison Evelynn ONDRUS (Pasadena, CA, US)
Cpc classification
C12N2710/16222
CHEMISTRY; METALLURGY
A61K47/6811
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
A61K47/65
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
C07K16/085
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
Abstract
Disclosed herein are antibodies or immunogenic fragments thereof that specifically bind to Epstein-Barr virus (EBV) glycoprotein 350 (gp350) or 220 or one or more epitopes of EBV gp350 and neutralize EBV infection. Also disclosed are immunogenic peptides comprising one or more gp350 epitopes, EBV antibody-small molecule conjugates and pharmaceutical compositions comprising the antibody or an immunogenic fragment thereof, one or more epitopes of EBV gp350, one or more immunogenic peptides, or the EBV antibody-small molecule conjugate. The antibodies, epitopes, immunogenic peptides, conjugates, and pharmaceutical compositions can be used to treat or prevent EBV infections and EBV-associated conditions and diseases.
Claims
1. An antibody or an immunogenic fragment thereof that specifically binds to Epstein-Barr virus (EBV) glycoprotein (gp) 350 or glycoprotein 220.
2. The antibody or the immunogenic fragment thereof of claim 1, wherein the antibody or the immunogenic fragment thereof specifically binds to a gp350 epitope comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
3. The antibody or the immunogenic fragment thereof of claim 1 or claim 2, comprising a VH region comprising CDR1, CDR2 and CDR3 having an amino acid sequence of SEQ ID NOs: 4-51.
4. The antibody or the immunogenic fragment thereof of claim 1 or claim 2, comprising a VL region comprising CDR1, CDR2 and CDR3 having an amino acid sequence of SEQ ID NOs: 52-99.
5. The antibody of any one of claims 1-4, wherein the antibody is a monoclonal antibody.
6. The antibody of any one of claims 1-4, wherein the antibody is a chimeric antibody, a humanized antibody or a human antibody.
7. An immunogenic peptide comprising one or more gp350 epitopes, wherein each epitope has an amino acid sequence identical to or sharing at least 60% similarity to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
8. The immunogenic peptide of claim 7, comprising a first domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO:1, a second domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 2, and a third domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 3.
9. The immunogenic peptide of claim 7, comprising a first domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3, and a second domain comprising a known immunogenic peptide such as keyhole limpet hemocyanin (KLH) peptide.
10. An antibody-small molecule conjugate comprising: an antibody or an immunogenic fragment thereof that specifically binds to EBV gp350 or EBV gp220; and a small molecule having an anti-proliferative activity against EBV-transformed cells, wherein the small molecule is conjugated to the antibody.
11. The conjugate of claim 10, wherein the antibody is a monoclonal antibody.
12. The conjugate of claim 10, wherein the antibody is a chimeric antibody, a humanized antibody or a human antibody.
13. The conjugate of any one of claims 10-12, wherein the small molecule is a growth inhibitor of EBV infected B cells.
14. The conjugate of any one of claims 10-13, wherein the small molecule is L.sub.2P.sub.4, 2-butynediamide, or a derivative thereof.
15. The conjugate of any one of claims 10-14, wherein the small molecule is conjugated to the antibody via a linker or an adaptor.
16. The conjugate of any one of claims 10-15, wherein the small molecule is conjugated to the constant region of the heavy chain or the light chain of the antibody.
17. A pharmaceutical composition comprising the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, or the conjugate of any one of claim 10-16.
18. A method of neutralizing EBV infection comprising administering to a subject infected with EBV a therapeutically effective amount of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, the conjugate of any one of claim 10-16, or the pharmaceutical composition of claim 17.
19. A method of preventing EBV infection comprising administering to a subject at an elevated risk of EBV infection a therapeutically effective amount of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, the conjugate of any one of claim 10-16, or the pharmaceutical composition of claim 17.
20. A method of preventing a post-transplant lymphoproliferative disease (PTLD) comprising administering to a subject who is a transplant recipient a therapeutically effective amount of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, the conjugate of any one of claim 10-16, or the pharmaceutical composition of claim 17.
21. The method of claim 20, wherein the subject is a pediatric transplant recipient who is EBV nave or an adult transplant recipient.
22. The method of claim 20 or claim 21, wherein the administration is before, during, and/or after the transplant.
23. A method of treating an EBV-associated cancer comprising administering to a subject suffering from an EBV-associated cancer a therapeutically effective amount of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, the conjugate of any one of claim 10-16, or the pharmaceutical composition of claim 17.
24. The method of claim 23, wherein the EBV-associated cancer is selected from the group consisting of Hodgkin lymphoma, Burkitt lymphoma, gastric cancer, and nasopharyngeal carcinoma.
25. A method of immunizing or vaccinating a subject against EBV infection comprising administering to the subject a therapeutically effective amount of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9, or a pharmaceutical composition thereof.
26. A method of inducing the production of neutralizing antibodies against a EBV in a subject, comprising administering an effective amount of a gp350 epitope represented by SEQ ID NO: 3 or an immunogenic peptide comprising SEQ ID NO: 3.
27. The method of any one of claims 18-26, wherein the subject is human.
28. Use of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9 for inducing the production of a neutralizing antibody against EBV in a subject.
29. Use of the antibody or the immunogenic fragment thereof of any one of claims 1-6, the immunogenic peptide of any one of claims 7-9 for the manufacture of a medicament for inducing the production of a neutralizing antibody against EBV in a subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
DETAILED DESCRIPTION
[0021] Disclosed herein are EBV antibodies or immunogenic fragments thereof that specifically bind to gp350/gp220 or an epitope of gp350, immunogenic peptides comprising one or more gp350 epitopes, or one or more amino acid sequences having at least 60% similarity to one or more gp350 epitopes, EBV antibody-small molecule conjugates for treating or preventing EBV infection, in particular, in subjects receiving a transplant. In some embodiments, chimeric (human/mouse) anti-gp350 nAbs are conjugated to L.sub.2P.sub.4 to obtain an EBV-specific ADC that improves the therapeutic efficacy of treating EBV-associated PTLDs. L.sub.2P.sub.4 described by Jiang et al., Nature Biomedical Engineering 1: 0042 (2017), is an example of the small molecules encompassed by this disclosure.
[0022] The term antibody as used herein refers to an immunoglobulin molecule or an immunologically active portion thereof that specifically binds to, or is immunologically reactive with a particular antigen, for example, EBV gp350/gp220, or a particular domain or fragment of gp350/gp220. In some embodiments, the antibody disclosed herein specifically binds to one or more epitopes on EBV gp350. The epitopes can be neutralizing epitopes or immunodominant epitopes. In some embodiments, the epitope has an amino acid sequence selected from .sub.253TPIPGTGYAYSLRLTPRPVSRFL.sub.275 (SEQ ID NO: 1), .sub.875LLLLVMADCAFRRNLSTSHTYTTPPY.sub.899 (SEQ ID NO: 2), and .sub.381GAFASNRTFDIT.sub.392 (SEQ ID NO: 3).
[0023] In a related aspect, this disclosure relates to a method of producing an EBV antibody using the epitopes disclosed herein according to any known technology. The method entails immunizing an animal such as a mouse or a rabbit with an immunogenic peptide disclosed herein or the epitope represented by SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO:3 alone, and screening for and isolating a hybridoma producing an EBV antibody. The EBV antibody produced from such hybridomas can be used for treating or preventing EBV infections.
[0024] In certain embodiments an antibody for use in the present methods or compositions is a full-length immunoglobulin molecule, which comprises two heavy chains and two light chains, with each heavy and light chain containing three complementary determining regions (CDRs). The CDRs of various antibodies are identified and listed in Table 1 below.
TABLE-US-00001 TABLE1 CDRSequences Anti- VH VL bodies CDR-1 CDR-2 CDR-3 CDR-1 CDR-2 CDR-3 72A1 GSSFTDY INPYNGG GGLRRVNWFAYW TGAVTTSNY GTN VLWHSNHWV (SEQIDNO:4) (SEQIDNO:20) (SEQIDNO:36) (SEQIDNO:52) (SEQIDNO:68) (SEQIDNO: 84) HB-1 GFLLTTY IWAGGS RDRGYGYLYAMDYW QNVGTN STD QQYNTYPYT (SEQIDNO:5) (SEQIDNO:21) (SEQIDNO:37) (SEQIDNO:53) (SEQIDNO:69) (SEQIDNO: 85) HB-2 GYTFTAY INYKTGE PYGYALDYW SSVNY* ATS* QQWSSNPPT* (SEQIDNO:6) (SEQIDNO:22) (SEQIDNO:38) (SEQIDNO:54) (SEQIDNO:70) (SEQIDNO: 86) HB-3 GYTFASY INPNNGH* RNLYYYGRPDYW* QDIGNY* YTS* QQGNTLPPT* (SEQIDNO:7) (SEQIDNO:23) (SEQIDNO:39) (SEQIDNO:55) (SEQIDNO:71) (SEQIDNO: 87) HB-5 GYTFTNH INPYNDY RSEGWLRRGAWFAY QSIGTS YAS QQSNSWPMLT (SEQIDNO:8) (SEQIDNO:24) (SEQIDNO:40) (SEQIDNO:56) (SEQIDNO:72) (SEQIDNO: 88) HB-6 GYTFTDY* INTRTGE PYGYALDYW SSVNY* ATS* QQWSSNPPT* (SEQIDNO:9) (SEQIDNO:25) (SEQIDNO:41) (SEQIDNO:57) (SEQIDNO:73) (SEQIDNO: 89) HB-7 GYTFTDY* ISPGRSG RYGHPSYLDVW QSVGNA SAS QQYSSYPLT (SEQIDNO:10) (SEQIDNO:26) (SEQIDNO:42) (SEQIDNO:58) (SEQIDNO:74) (SEQIDNO: 90) HB-8 GYSFTNY* INTYTGE RYYYGSVYSAWFAYW QSIVHSNGNTY* KVS* FQGSHVPYT* (SEQIDNO:11) (SEQIDNO:27) (SEQIDNO:43) (SEQIDNO:59) (SEQIDNO:75) (SEQIDNO: 91) HB-9 GFTFSSY ISSGGSY REDFYYGSSYGFFDVW QSIVHSNGNTY* KVS* FQGSHVPYT* (SEQIDNO:12) (SEQIDNO:28) (SEQIDNO:44) (SEQIDNO:60) (SEQIDNO:76) (SEQIDNO: 92) HB-10 GYTFTSY* INPSNGH RNLYYYGRPDYW QDIGNY* YTS* QQNTLPPT (SEQIDNO:13) (SEQIDNO:29) (SEQIDNO:45) (SEQIDNO:61) (SEQIDNO:77) (SEQIDNO: 93) HB-11 GDSITSG ISYSGS RGNGGNYDWYFDVW SSVNF YIS QQFTSSPSWT (SEQIDNO:14) (SEQIDNO:30) (SEQIDNO:46) (SEQIDNO:62) (SEQIDNO:78) (SEQIDNO: 94) HB-12 GYTFTNY* INPNNGH* RNLYYYGRPDYW* QSLVHSNGNTY KVS* SQSTHVPLT (SEQIDNO:15) (SEQIDNO:31) (SEQIDNO:47) (SEQIDNO:63) (SEQIDNO:79) (SEQIDNO: 95) HB-14 GYTFTDY* IHPRRGG RYGYPWYFDVW QSIVHDNGNTY KVS* FQGSHVPPT (SEQIDNO:16) (SEQIDNO:32) (SEQIDNO:48) (SEQIDNO:64) (SEQIDNO:80) (SEQIDNO: 96) HB-17 GYTFTSY* INPNNGH* RNLFYYSRPDYW QDIGNY* YTS* QQGNTLPPT* (SEQIDNO:17) (SEQIDNO:33) (SEQIDNO:49) (SEQIDNO:65) (SEQIDNO:81) (SEQIDNO: 97) HB-20 GYTFTSY* INPTNGH RNLYYYGRPDYW* QDIGNY* YTS* QQGNALPPT (SEQIDNO:18) (SEQIDNO:34) (SEQIDNO:50) (SEQIDNO:66) (SEQIDNO:82) (SEQIDNO: 98) HB-22 GFSLTNY IWSDGS RNYYGNSYPAWFAYW QSIVHSNGNTY KVS* FQGSHVPVVT (SEQIDNO:19) (SEQIDNO:35) (SEQIDNO:51) (SEQIDNO:67) (SEQIDNO:83) (SEQIDNO: 99)
[0025] The term antibody, in addition to natural antibodies, also includes genetically engineered or otherwise modified forms of immunoglobulins, such as synthetic antibodies, intrabodies, chimeric antibodies, fully human antibodies, humanized antibodies, peptibodies and heteroconjugate antibodies (e.g., bispecific antibodies, multispecific antibodies, dual-specific antibodies, anti-idiotypic antibodies, diabodies, triabodies, and tetrabodies). The antibodies disclosed herein can be monoclonal antibodies or polyclonal antibodies. In those embodiments wherein an antibody is an immunologically active portion of an immunoglobulin molecule, the antibody may be, for example, a Fab, Fab, Fv, Fab F(ab).sub.2, disulfide-linked Fv, single chain Fv antibody (scFv), single domain antibody (dAb), or diabody. The antibodies disclosed herein, including those that are immunologically active portion of an immunoglobulin molecule, retain the ability to bind a specific antigen, for example, EBV gp350 or one or more epitopes thereof, EBV gp220 or one or more epitopes thereof, or to bind a specific fragment of gp350/gp220.
[0026] In some embodiments, the EBV antibodies disclosed herein have undergone post-translational modifications such as phosphorylation, methylation, acetylation, ubiquitination, nitrosylation, glycosylation, or lipidation associated with expression in a mammalian cell line, including a human or a non-human host cell. Techniques for producing recombinant antibodies and for in vitro and in vivo modifications of recombinant antibodies are known in the art.
[0027] Provided in certain embodiments herein are chimeric, and/or humanized EBV antibodies. Various techniques are known in the art for humanizing antibodies from non-human species such that the antibodies are modified to increase their similarity to antibodies naturally occurring in humans. Six CDRs are present in each antigen binding domain of a natural antibody. These CDRs are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding domain as the antibody assumes its three dimensional configuration. CDR sequences of certain antibodies identified herein are shown in Table 1. The remainder of the amino acids in the antigen binding domains, referred to as framework regions, show less inter-molecular variability and form a scaffold to allow correct positioning of the CDRs. This disclosure also relates to antibodies comprising VH and VL regions comprising the CDRs shown in Table 1.
[0028] Treating or treatment of a disease or a condition may refer to preventing the disease or condition, slowing the onset or rate of development of the disease or condition, reducing the risk of developing the disease or condition, preventing or delaying the development of symptoms associated with the disease or condition, reducing or ending symptoms associated with the disease or condition, generating a complete or partial regression of the disease or condition, or some combinations thereof.
[0029] As used herein, the term subject refers to mammalian subject, preferably a human. The phrases subject and patient are used interchangeably herein.
[0030] The method for treating a condition or a viral infection includes administering a therapeutically effective amount of a therapeutic agent or a pharmaceutical composition. An effective amount, therapeutically effective amount or effective dose is an amount of a composition (e.g., a therapeutic agent or a pharmaceutical composition) that produces a desired therapeutic effect in a subject, such as preventing or treating a target disease or condition or alleviating symptoms associated with the disease or condition. The precise therapeutically effective amount is an amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given subject. This amount will vary depending upon a variety of factors, including but not limited to the characteristics of the therapeutic agent (including activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication), the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration. One skilled in the clinical and pharmacological arts will be able to determine a therapeutically effective amount through routine experimentation, namely by monitoring a subject's response to administration of a compound and adjusting the dosage accordingly. For additional guidance, see Remington: The Science and Practice of Pharmacy 21.sup.st Edition, Univ. of Sciences in Philadelphia (USIP), Lippincott Williams & Wilkins, Philadelphia, Pa., 2005.
[0031] The pharmaceutical composition may include, among other things, an EBV antibody disclosed herein or an immunogenic fragment thereof, one or more gp350 epitopes represented by SEQ ID NOs: 1-3, one or more immunogenic peptides disclosed herein, or an EBV antibody-small molecule conjugate disclosed herein.
[0032] The pharmaceutical composition may also include one or more pharmaceutically acceptable carriers. A pharmaceutically acceptable carrier refers to a pharmaceutically acceptable material, composition, or vehicle that is involved in carrying or transporting a compound of interest from one tissue, organ, or portion of the body to another tissue, organ, or portion of the body. For example, the carrier may be a liquid or solid filler, diluent, excipient, solvent, or encapsulating material, or some combination thereof. Each component of the carrier must be pharmaceutically acceptable in that it must be compatible with the other ingredients of the formulation. It also must be suitable for contact with any tissue, organ, or portion of the body that it may encounter, meaning that it must not carry a risk of toxicity, irritation, allergic response, immunogenicity, or any other complication that excessively outweighs its therapeutic benefits.
[0033] The pharmaceutical compositions described herein may be administered by any suitable route of administration. A route of administration may refer to any administration pathway known in the art, including but not limited to aerosol, enteral, nasal, ophthalmic, oral, parenteral, rectal, transdermal (e.g., topical cream or ointment, patch), or vaginal. Transdermal administration may be accomplished using a topical cream or ointment or by means of a transdermal patch. Parenteral refers to a route of administration that is generally associated with injection, including infraorbital, infusion, intraarterial, intracapsular, intracardiac, intradermal, intramuscular, intraperitoneal, intrapulmonary, intraspinal, intrasternal, intrathecal, intrauterine, intravenous, subarachnoid, subcapsular, subcutaneous, transmucosal, or transtracheal. In some embodiments, the therapeutic compositions described herein are administered by intravenous injection or intraperitoneal injection.
[0034] The epitopes disclosed herein have various uses. For example, the epitopes can be used to produce immunogenic peptides. Such an immunogenic peptide comprises one or more gp350 epitopes having an amino acid sequence identical to or sharing at least 60% similarity to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3. In some embodiments, the immunogenic peptide comprises a first domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO:1, a second domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 2, and a third domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 3. In some embodiments, the immunogenic peptide comprises a first domain comprising an amino acid sequence having at least 60% similarity to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3, and a second domain comprising a known immunogenic peptide such as keyhole limpet hemocyanin (KLH) peptide.
[0035] Additionally, the epitopes or immunogenic peptides disclosed herein can be used for producing anti-gp350 antibodies using any existing technology.
[0036] In certain embodiments, disclosed herein is a method of treating or preventing EBV infection in a subject, comprising administering a therapeutically effective amount of an anti-gp350 antibody disclosed herein or an immunogenic fragment thereof, one or more epitopes represented by SEQ ID NOs: 1-3, an immunogenic peptide described herein, an EBV antibody-drug conjugate described herein, or a pharmaceutical composition comprising the anti-gp350 antibody or an immunogenic fragment thereof, one or more epitopes, one or more immunogenic peptides, or the EBV antibody-drug conjugate.
[0037] In certain embodiments, disclosed herein is a method of treating or preventing EBV infection in a subject, comprising administering a therapeutically effective amount of an anti-gp350 antibody disclosed herein or an immunogenic fragment thereof, one or more epitopes represented by SEQ ID NOs: 1-3, an immunogenic peptide described herein, an EBV antibody-drug conjugate described herein, or a pharmaceutical composition comprising the anti-gp350 antibody or an immunogenic fragment thereof, one or more epitopes, one or more immunogenic peptides, or the EBV antibody-drug conjugate.
[0038] In certain embodiments, disclosed herein is a method of treating or preventing EBV-associated PTLD in a subject, comprising administering a therapeutically effective amount of an anti-gp350 antibody disclosed herein or an immunogenic fragment thereof, one or more epitopes described herein, one or more immunogenic peptides described herein, an EBV antibody-drug conjugate described herein, or a pharmaceutical composition comprising the anti-gp350 antibody or an immunogenic fragment thereof, one or more epitopes, one or more immunogenic peptides, or the EBV antibody-drug conjugate, before or after the transplant in the subject.
[0039] As shown in the working examples, 15 novel EBV gp350-specific mAbs were generated, their binding to gp350 was characterized, their neutralization activity against EBV infection in vitro was determined, their cognate epitopes were mapped, and the exact aa residues they recognize on gp350 were defined. Six of the eight previously described epitopes responsible for generating neutralizing and non-nAbs were confirmed and the exact aa residues that they bind were defined. This study also confirmed that the binding epitopes on gp350 that elicit nAbs are between aa 4-443 (59). An additional neutralizing epitope and two new non-neutralizing epitopes, with one located downstream of the gp350 ectodomain (aa 1-841) were identified. Importantly, the newly developed mAbs have many uses in vaccine development, diagnosis of viral infection, and therapeutic/prophylactic management of post-transplant lymphoproliferative diseases, either individually, in combination with nAb-72A1, or with other mAbs such as anti-gH/gL (E1D1).
[0040] To overcome the existing challenges facing PTLD treatment, novel EBV antibodies and EBV antibody-drug conjugates (ADCs) are developed. The EBV neutralizing antibodies (nAbs) that specifically block new or reactivated EBV infection are conjugated with small molecules that specifically target latent viral protein, EBV nuclear antigen 1 expressed in all EBV+ malignancies. The recent identification and isolation of nAbs against the highly variable viruses HIV-1 (10, 11), influenza (12-14), and respiratory syncytial virus (15) has direct implications for successful EBV protection. Indeed, in 2012, an international, multidisciplinary expert panel recommended use of intravenous (IV) anti-viral nAbs for preventing or treating EBV+ PTLD (16). EBV uses multiple surface glycoproteins (gps), including the major gp350, to infect host cells (17, 18). These gps are expressed on EBV virions and in EBV+ cells (19, 20), and stimulate immune responses in humans and in animal models (21-23), making them attractive targets for an EBV vaccine (24). Multiple lines of evidence suggest that use of anti-gp350 nAbs to protect against EBV-PTLDs is feasible (16): (A) Maternal Abs protect against EBV infection in neonates (25, 26); (B) gp350-expressing EBV+ cells activate complement (27) and mediate Ab-dependent cellular cytotoxicity (28); (C) gp350 vaccines reduce EBV load and protect against EBV+ lymphomas in marmosets (29-32) and protect EBV-nave adults from EBV-induced mononucleosis (32-34); (D) Compared to control mice, SCID mice injected with peripheral blood mononuclear cells from EBV-nave donors and immunized with anti-gp350 (72A1) mouse nAb are completely protected against EBV and development of EBV+ tumors or PTLD-like lesions (35); and (E) 72A1 also conferred short-term protection against acquiring EBV after transplantation in 3 out of 4 pediatric patients in a small phase 1 clinical trial (35). However, there was a major drawback: all 4 patients who received 72A1 developed human anti-mouse Abs (HAMA), which can cause side effects and limit treatment efficacy, with one developing a hypersensitivity reaction. This suggests that 72A1 in its native form is not a safe treatment for humans (35). Thus, chimeric (human/mouse), humanized, or human nAbs, which are safe and effective in the treatment of various cancers, are needed (7, 36-38).
[0041] Pre-existing antibodies provide the primary defense against viral infection. Prophylactic prevention of EBV primary infection has mainly focused on blocking the first step of viral entry by generating neutralizing antibodies (nAbs) that target EBV envelope glycoproteins. Five glycoproteins, in particular, gp350/220 (gp350), gp42, gH, gL, and gB, are required for efficient infection of permissible host cells and have emerged as potential prophylactic targets (23, 24, 61, 64).
[0042] Several studies have indicated that the EBV gp350 as the major immunodominant glycoprotein is an ideal target for EBV nAbs production. Although the ectodomain of EBV gp350 (aa 1-841) has been shown to contains at least eight unique CD21 binding epitopes, only one of these epitopes (aa 142-161) is capable of eliciting nAbs (57-58). The aa residues that constitute the other epitopes and their role in generating nAb has not been elucidated, as this information would be valuable in the precise design of effective EBV peptide vaccine. To date, nAb-72A1 remains the only EBV antibody with proven clinical prophylactic efficacy, as its been shown to confer short-term protection by reducing and delaying EBV infection onset in immunized pediatric transplant patients (35).
[0043] EBV predominantly infects epithelial cells and B cells, reflecting the viral tropism and the cellular ontogeny for EBV-associated malignancies (17). There are two schools of thought on how the initial EBV transmission into the human host occurs. In the first infection model, the incoming virus engages with ephrin receptor A2 via heterodimeric gH/gL, which triggers gB fusion with the epithelial cell membrane and entry of the virus into the cytoplasm (17). This interaction is thought to occur in the oral mucosa, where the virus undergoes lytic replication to release virions that subsequently infect B cells. In the alternative model, the incoming virus binds to the host cell via complement receptor type 1 (CR1)/CD35 (45) and/or CR2/CD21 through its major immunodominant glycoprotein, gp350 (65). The interaction between gp350 and CD35 and/or CD21 triggers viral adsorption, capping, and endocytosis into the B cell (66), which subsequently leads to interaction between heterotrimeric viral glycoproteins complex, gp42/gH/gL, binding to HLA class II molecules to activate gB membrane fusion and entry. Because these two models are not necessarily mutually exclusive, and given that both gp350 and gH/gL complex are important in initiating the first viral contact with host cells, use of nAbs that target either gp350 or gH/gL complex or both may potently block incoming virus at the oral mucosa.
[0044] Nearly all EBV-infected individuals develop nAbs directed to the ectodomains of these glycoproteins (52, 67). These antibodies can prevent neonatal infection, and can protect against acute infectious mononucleosis in adolescents and several human lymphoid and epithelial malignancies associated with EBV infection (30, 32-34). Although numerous monoclonal antibodies (mAbs) have been generated against EBV gp350 (53, 68, 69), only two murine mAbs, the non-neutralizing 2L10 and the neutralizing 72A1, have been extensively characterized and made commercially available (68, 69). Importantly, nAb-72A1 conferred short-term clinical protection against EBV transmission after transplantation in pediatric patients in a small phase I clinical trial (35).
[0045] EBV gp350 is the most immunogenic envelope glycoproteins on the virions. It is a type 1 membrane protein that encodes for 907 amino acid (aa) residues. A single splice of the primary transcript deletes 197 codons and joins gp350 codons 501 and 699, in frame, to generate the gp220 messenger RNA. Both gp350 and gp220 are comprised of the same 18-aa residue at the C terminus that is located within the viral membrane, a 25-aa residue at the transmembrane-spanning domain, and a large highly glycosylated N-terminal ectodomain, aa 1-841 (57). The first 470 aa of gp350 are sufficient for binding CD21 in B cells, as demonstrated by a truncated gp350 (aa 1-470) blocking the binding of EBV to B cells and reducing viral infectivity (17). The gp350-binding domain on CD21 is mapped to N-terminal short consensus repeats (SCRs) 1 and 2, which also bind to a bioactive fragment of complement protein 3 (C3d) (34, 68). A soluble truncated EBV gp350 fragment (aa 1-470) and soluble CD21 SCR1 and SCR2 can block EBV infection and immortalization of primary B cells (57). However, gp350 binding to CD35 is not restricted to N-terminal SCRs; it binds long homologous repeat regions as well as SCRs 29-30 (57).
[0046] The gp350 ectodomain is heavily glycosylated, with both N- and O-linked sugars, which accounts for over half of the molecular mass of the protein. Currently there is only one crystal structure available for gp350, comprised of a truncated structure between 4-443 aa, with at least 14 glycosylated arginines coating the protein with sugars, with the exception of a single glycan-free patch (59). Mutational studies of several residues in the glycan-free patch resulted in the loss of CD21 binding (59), suggesting that binding of CD35 and CD21 by gp350 is mediated within this region.
[0047] There are at least eight unique CD21 binding epitopes located at the N-terminus of the gp350 ectodomain (58); at least one of these epitopes (aa 142-161) is capable of eliciting nAbs (57, 58). The aa residues 142-161 are also the binding site for nAb-72A1 (59, 68). Using gp350 synthetic peptides binding to CD21 on the surface of a B cell line, additional gp350 epitope was identified in the C-terminal region of gp350 (aa 822-841), suggesting it is involved in EBV invasion of B cells (58). The role of other epitopes in eliciting nAbs has not been fully investigated. Furthermore, the exact aa residues that comprise the core binding sites for epitope capable of eliciting neutralization and non-neutralization antibodies have not been determined. Mapping the EBV gp350 protein residues defining immunodominant epitopes, identifying the critical aa residues of the eight epitopes, and defining their roles in generating neutralizing and non-nAbs will guide rational design and construction of an efficacious EBV gp350-based vaccine that would focus the B-cell responses to the protective epitopes.
[0048] As demonstrated in the working examples, 23 hybridomas producing antibodies against EBV gp350 were generated. To assess their clinical potential and utility in informing future prophylactic and therapeutic vaccine design: (1) the ability of the antibodies produced by the new hybridomas to detect gp350 protein was tested by enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunoblot; (2) the unique CDRs of the heavy and light chains of all 23 hybridomas were sequenced to identify novel mAbs; (3) the efficacy of each mAb to neutralize EBV infection in vitro was measured; and (4) RepliTope peptide microarrays were used to identify gp350 core aa residues recognized by neutralizing and non-neutralizing mAbs. Using the newly generated antibodies, a new epitope bound preferentially by nAbs was identified, distinct from the canonical neutralizing epitope bound by nAb-72A1, as well as two immunodominant epitopes bound by both neutralizing and non-nAbs.
[0049]
[0050] Following confirmation that the new mAbs recognized EBV gp350 antigen and had unique VH-VL sequences, further characterization revealed that mAbs HB9, HB10, HB11, HB17, and HB20 inhibited EBV infection in a dose-dependent manner, with HB17 and HB20 being the best neutralizers (
[0051] Various methods, including lectin/ricin immune-affinity assay (69), purified mAbs (53, 70), purified soluble gp350 mutants (57), synthetic peptides (51, 55, 54), cell binding assays (58), and crystal structure of partial gp350 protein (4-443) (59), have been used to identify the critical gp350 epitopes responsible for its interaction with the CD35 and CD21 cellular receptors (for a detailed summary review see Table 2).
TABLE-US-00002 TABLE 2 Summary of gp350 Epitope Mapping over Time Using Different Methodologies Method mAbs/protein/peptides Number of epitopes Reference Competitive binding Newly generated 8 epitopes- Qualtiere et al., assay mAbs from purified Sequence not 1987 (53) Tagged mAb vs virus or whole cell defined untagged mAbs perp after induction Binding studies- Newly generated 2 possible regions Nemerow et al determine the mAbs (61) identified by 1987 (54) effects of anti-gp350 sequence mAbs on gp350 alignment to C3d binding to CR2 sequence. 1. aa 21-28 2. aa 372-378 Binding studies Peptide and protein 1. aa 21-28 Nemerow et al 2. N-terminus of gp350 1989 (55) Dot Blot Protein - 8 clones 3 sequences defined Zhang et al., 1991 immunoasaay overlapping N and 1. aa 310-325 (56) Purified truncated C terminus portions 2. aa 326-439 protein incubated of protein 3. aa 733-841 with mAbs mAbs from Qualtiere et al., 1987 Peptide digest and Truncated and Narrowed down to Tanner et al., immunoprecipitation mutant protein the first 470 1998 (57) mAbs (72A1 and residues BOS-1) Peptide cell binding Synthesized 7 regions Urquiza et al 2005 assay- to 2 CR2 peptides covering 3 identified (58) positive (Raji and gp350 (907aa) 1. aa 142-161 Ramos) and 1 2. aa 282-301 negative (P3HR-1) 3. aa 822-841 cell line Crystal structure Mutant proteins, 3 epitopes (based Szakonyi et al., and binding studies mAbs 72a1 on 72A1 binding 2006 (59) and gp350 4-443) 1. aa 16-29 2. aa 142-161 3. aa 282-301 Structural docking Gp350 and CR2 Single epitope Sitompul et al., studied and crystal structure (based on gp350 2012 (60) antigenicity alignment/docking (1-470)) mapping 1. aa147-165 Structural alignment Peptides (used in 3 epitopes Tanner et al., (computer modeling immunization) and 1. aa 14-20 2015 (51) of gp350 and 72A1)/ mAb (72A1) 2. aa 144-161 docking studies 3. aa 194-211
[0052] The epitope mapping assay identified a total of nine epitopes including two new epitopes, one bound by all mAbs, including nAb-72A1 and 2L10, regardless of the mAb neutralizing capability suggesting it is an immunodominant epitope on the gp350 protein. Portions of six of the previously described epitopes, including the only currently recognized neutralizing epitope were also identified and their exact aa residues were defined. However, two previously reported epitopes located at aa 282-301 and aa 194-211, which have been reported to be involved in the binding of nAb-72A1 or CD21, respectively (51, 58, 59), were not identified.
[0053] As demonstrated in the working examples, the comparative epitope mapping analysis results identified a novel neutralizing epitope, .sub.381GAFASNRTFDIT.sub.392 (SEQ ID NO; 3), which was bound preferentially by the nAbs HB20 and nAb-72A1, but not the non-neutralizing mAb HB5. The new neutralizing epitope is distinct from the reported canonical nAb-72A1 binding epitope aa 142-161, on gp350, suggesting that epitope 381-392 is a novel epitope on gp350 capable of eliciting nAbs using existing technology and protocols.
[0054] Virus-specific treatments are less likely to target basic metabolic mechanisms of healthy cells, making them more likely to efficiently kill virus-infected cells with fewer side effects. Until recently, few drug regimens have specifically targeted EBV+ lymphomas. However, in 2015, a few small molecules showed activity against EBV-transformed cells (39). Furthermore, in 2017, Jiang et al. described a novel small molecule (L.sub.2P.sub.4) that shows discriminating anti-proliferative activities against EBV-transformed B lymphoma cells (40).
[0055] Having described the invention with reference to the embodiments and illustrative examples, those in the art may appreciate modifications to the invention as described and illustrated that do not depart from the spirit and scope of the invention as disclosed in the specification. The examples are set forth to aid in understanding the invention but are not intended to, and should not be construed to limit its scope in any way. The examples do not include detailed descriptions of conventional methods. Such methods are well known to those of ordinary skill in the art and are described in numerous publications. Further, all references cited above and in the examples below are hereby incorporated by reference in their entirety, as if fully set forth herein.
EXAMPLES
Example 1: Materials and Methods
[0056] Cells and Viruses.
[0057] EBV-AGS, a human gastric carcinoma cell line infected with a recombinant Akata virus expressing enhanced fluorescent green protein (eGFP) was a kind gift of Dr. Lisa Selin (University of Massachusetts Medical School). Anti-EBV gH/gL (E1D1) hybridoma cell line was a kind gift of Dr. Lindsey Hutt-Fletcher (Louisiana State University Health Sciences Center). Chinese hamster ovary cells (CHO); human embryonic kidney cells expressing SV-40 T antigen (HEK-293T); HEK-293 6E suspension cells; EBV-positive Burkitt lymphoma cells (Raji); myeloma cells (P3X63Ag8.653); and anti-EBV gp350 nAb-72A1 hybridoma cells (HB168) were purchased from American Type Culture Collection (ATCC). EBV-AGS cells were maintained in Ham's F-12 media supplemented with 500 g/ml neomycin (G418, Gibco). Raji, P3X63Ag8.653, and HB168 hybridoma cells were maintained in RPMI 1640. CHO and HEK-293T cells were maintained in DMEM. HEK-293 6E cells were maintained in FreeStyle F17 Expression Medium supplemented with 0.1% Pluronic F-68. All culture media were supplemented with 10% fetal bovine serum (FBS), 2% penicillin-streptomycin, and 1% 1-glutamine, with the exception of Freestyle F17 expression medium.
[0058] Antibodies and Plasmids.
[0059] Primary antibodies: EBV anti-gp350 nAb (72A1) and anti-gH/gL (E1D1) were purified from the supernatant of HB168 and E1D1 hybridoma cell lines, respectively, using Capturem Protein A Maxiprep spin columns (Takara). Anti-gp350/220 mAb (2L10) was purchased from Millipore Sigma.
[0060] Secondary antibodies: Horseradish peroxidase (HRP)-conjugated goat anti-mouse IgG for immunoblot or ELISA were purchased from Bio-Rad. Alexa Fluor (AF) 488-conjugated goat anti-mouse IgG (H+L) for flow cytometry was purchased from Life Sciences Tech. Goat anti-mouse IgG (H+L) secondary antibody and DyLight 650 for epitope mapping were purchased from Thermo Fisher Scientific.
[0061] The construction of the pCI-puro vector and pCAGGS-gp350/220-F has been described (23, 45).
[0062] Virus Production and Purification.
[0063] eGFP-tagged EBV was produced from the EBV-infected AGS cell line as described (46). Briefly, EBV-AGS cells were seeded to 90% confluency in T-75 flasks in Ham's F-12 medium containing G418 antibiotic. After the cells reached confluency, G418 media was replaced with Ham's F-12 medium containing 33 ng/ml 12-O-tetradecanoylphorbol-13-acetate (TPA) and 3 mM sodium butyrate (NaB) to induce lytic replication of the virus. Twenty-four h post-induction, the media was replaced with complete Ham's F-12 media without G418, TPA, or NaB and cells were incubated for 4 days at 37 C. The cell supernatant was collected, centrifuged, and filtered using 0.8 m filter to remove cell debris. The filtered supernatant was ultra-centrifuged using a Beckman-Coulter type 19 rotor for 70 min at 10,000 rpm to pellet the virus. EBV-eGFP virus was titrated in both HEK-293T cells and Raji cells, and stocks were stored at 80 C. for subsequent experiments.
[0064] Generation and Purification of gp350 Virus-Like Particles.
[0065] To generate gp350 VLPs, equal amounts (8 g/plasmid) of the relevant plasmids (pCAGGS-Newcastle disease virus (NDV) M, -NP, and gp350 ectodomain fused to fusion protein cytoplasmic and transmembrane domains) were co-transfected into 80% confluent CHO cells seeded in T-175 cm2 flasks; supernatant from transfected cells was collected and VLPs were purified and composition characterized as previously described (47).
[0066] Production of Hybridoma Cell Lines.
[0067] Seven days prior to immunization, two eight-week-old BALB/c mice were bled for collection of pre-immune serum. The mice were immunized with purified UV-inactivated EBV three times (Day 0, 21, and 35), and boosted every 7 days three times (Day 42, 49, and 56) with VLPs incorporating gp350 on the surface after Day 35. The mice were sacrificed, and their splenocytes were isolated, purified, and used to fuse with P3X63Ag8.653 myeloma cells at a ratio of 3:1 in the presence of polyethylene glycol (PEG, Sigma). Hybridoma cells were seeded in flat-bottom 96-well plates and selected in specialized hybridoma growth media with HAT (Sigma) and 10% FBS.
[0068] Indirect ELISA.
[0069] Hybridoma cell culture supernatant from wells that had colony-forming cells were tested for antibody production by indirect ELISA. Briefly, immunoplates (Costar 3590; Corning Incorporated) were coated with 50 l of 0.5 g/ml recombinant EBV gp350/220 (Millipore) protein diluted in phosphate buffered saline (PBS, pH 7.4) and incubated overnight at 4 C. After washing three times with PBS containing 0.05% (v/v) Tween 20 (washing buffer), plates were blocked with 100 l washing buffer containing 2% (w/v) bovine serum albumin (BSA) then incubated for 1 h at room temperature and washed as above. 100 l of hybridoma supernatant was added to each well (in triplicate) and incubated for 2 h at room temperature. PBS and nAb-72A1 were added as negative and positive controls, respectively. The plates were washed as described above, followed by incubation with goat anti-mouse IgG horseradish peroxidase-conjugated secondary antibody (1:2,000 diluted in PBS) at room temperature for 1 h. The plates were washed again and the chromogenic substrate 2,2-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid) (ABTS, Life Science Technologies) was added. The reaction was stopped using ABTS peroxidase stop solution containing 5% sodium dodecyl sulfate (SDS) in water. The absorbance was read at an optical density of 405 nm using an ELISA reader (Molecular Devices). Three independent were performed.
[0070] Antibody Purification, Quantification, and Isotyping.
[0071] Hybridoma cells from selected individual positive clones were expanded stepwise from 96-well plates to T-75 flasks. At confluence in T-75 flasks, supernatant from individual clones was collected, clarified by centrifugation (4,000 g, 10 min, 4 C.), and filtered through a 0.22-m-membrane filter (Millipore). Antibodies were further purified by Capturem Protein A Maxiprep (Takara) and stored in PBS (pH 7.4) at 4 C. Antibodies were analyzed by SDS-PAGE to determine purity. Bicinchoninic acid assay (BCA assay; Thermo Fisher Scientific) was conducted to determine the concentration of purified antibodies. Isotype identification was performed with the Rapid ELISA mouse mAb isotyping kit (Thermo Fisher Scientific).
[0072] RNA Extraction, cDNA Synthesis, and Sequencing of the Variable Region of the mAbs.
[0073] Total RNA was extracted from 110.sup.6 hybridoma cells using the RNeasy Mini Kit (Qiagen). Each hybridoma clone cDNA was synthesized in a total volume of 20 l using Tetro Reverse Transcriptase (200 u), RiboSafe RNase Inhibitor, Oligo(dT)18 primer, dNTP mix (10 mM each nucleotide), and 100-200 ng RNA. Reverse transcription was performed at 45 C. for 30 min, and terminated at 85 C. for 5 min. The cDNA was stored at 20 C. Immunoglobulin (Ig) VH and VL were amplified using the mouse Ig specific primer set purchased from Novagen (48). The VH and VL genes were amplified in separate reactions and PCR products were visualized on 1% agarose gel.
[0074] The VH and VL amplicons were sequenced using an Illumina MiSeq platform: duplicate 50 l PCR reactions were performed, each containing 50 ng of purified cDNA, 0.2 mM dNTPs, 1.5 mM MgCl2, 1.25 U Platinum Taq DNA polymerase, 2.5 l of 10PCR buffer, and 0.5 M of each primer designed to amplify the VH and VL. The amplicons were purified using AxyPrep Mag PCR Clean-up kit (Thermo Fisher Scientific). The Illumina primer PCR PE1.0 and index primers were used to allow multiplexing of samples. The library was quantified using ViiA 7 Real-Time PCR System (Life Technologies) and visualized for size validation on an Agilent 2100 Bioanalyzer (Agilent Technologies) using a high-sensitivity cDNA assay. The sequencing library pool was diluted to 4 nM and run on a MiSeq desktop sequencer (Illumina). The 600-cycle MiSeq Reagent Kit (Illumina) was used to run the 6 pM library with 20% PhiX (Illumina), and FASTQ files were used for data analysis.
[0075] Chimeric mAb Construct Generation.
[0076] To generate chimeric mAbs, the VH and VL sequences were cloned into the dual-vector system pFUSE CHIg/pFUSE CLIg (InvivoGen), which express the constant region of the heavy and light chains of human immunoglobulins, respectively (Genewiz). The constructs were transiently transfected into HEK-293 6E cells. The supernatants were collected at 72 h post-transfection and IgG was purified using protein A/G affinity chromatography.
[0077] Immunoblot Analysis.
[0078] CHO cells were cultured and stably co-transfected with pCAGGS-gp350/220 F and pCI-puro vector containing a puromycin resistance gene. Forty-eight h post-transfection, DMEM media containing 10 g/ml of puromycin was added to enrich for cells expressing gp350 protein. Puromycin-resistant clones were expanded, followed by flow cytometry sorting using nAb-72A1 to a purity >90%. EBV gp350-positive CHO cells were harvested and lysed in radioimmunoprecipitation assay buffer (RIPA) followed by centrifugation at 15,000 g for 15 min on a benchtop centrifuge. The supernatants were collected and heated at 95 C. for 10 min in SDS sample buffer containing -mercaptoethanol, then separated using SDS-PAGE. Proteins were transferred onto a nitrocellulose membrane using an iBlot Transfer System (Thermo Fisher Scientific) followed by incubation in blocking buffer (1% BSA; 20 mM Tris-HCl, pH 7.5; 137 mM NaCl; and 0.1% Tween-20 [TBST]) for 1 h. The blots were incubated in TBST containing purified anti-gp350 antibodies (1:50) overnight at 4 C. After three washes with TBST, the blots were incubated with a goat anti-mouse conjugated to horseradish peroxidase (1:2000) in TBST for 1 h. After three washes, the antibody-protein complexes were detected using the Amersham ECL Prime Western Blotting Detection Reagent (GE Healthcare). All experiments were independently repeated three times.
[0079] Flow Cytometry.
[0080] To assess the ability of purified anti-gp350 mAb to detect surface expression of EBV gp350 protein by flow cytometry, CHO cells that stably express EBV gp350 were harvested and stained with purified anti-gp350 (10 g/ml), followed by Alexa Fluor 488 goat anti-mouse IgG secondary antibody. Flow cytometric analysis was performed on a C-6 FC (BD Biosciences) and data was analyzed using FlowJo Cytometry Analysis software (FlowJo, LLC) as described (47). All the experiments were independently repeated three times.
[0081] EBV Neutralization Assay.
[0082] Purified individual anti-gp350 mAbs were incubated with purified AGS-EBV-eGFP (titer calculated to infect at least 20% of HEK293 cells seeded in 100 l of serum-free DMEM) for 2 h at 37 C. To represent EBV infection of B cells, the pre-incubated anti-gp350 mAbs/AGS-EBV-eGFP were used to infect 5105 Raji cells seeded in a 96-well plate. Anti-gp350 neutralizing 72A1 and non-neutralizing 2L10 mAbs served as positive and negative controls, respectively. Plates were incubated at 37 C. and the number of eGFP+ cells was determined using flow cytometry 48 h post-infection. All dilutions were performed in quintuplicate and the assays repeated three times for Raji cells. Antibody EBV neutralization activity was calculated as: % neutralization=(EBValoneEBVmAb)/(EBValone)100.
[0083] Epitope Mapping.
[0084] Anti-gp350 mAbs were incubated with a multi-well EBV GP350/GP340 RepliTope (JPT) peptide microarray displaying 224 peptides (15mers with 11 aa overlap) in 37 subarrays. Briefly, anti-gp350 mAbs were diluted in blocking solution (TBS-T and 2% BSA) to a final concentration of 10 g/ml and incubated with the microarray slide for 1 h at 30 C. with shaking. Slides was washed 5 times with wash buffer (TBS-T), followed by incubation with 1 g/ml secondary antibody Dylight 650 (Thermo Fisher Scientific) for 1 h at 30 C. After washing 5 times with wash buffer and 2 times with distilled water, microarray slides were dried by centrifugation. Detection was performed using the Agilent DNA microarray scanner.
Example 2: Development and Characterization of Monoclonal Antibodies Against EBV gp350
[0085] New EBV gp350-specific mAbs were generated and biochemically characterized, and their ability to neutralize EBV infection was evaluated. In addition, the antibodies were used to map immunodominant epitopes on the EBV gp350 protein. 23 novel monoclonal antibodies specific against EBV gp350 were developed. To generate hybridomas, BALB/c mice were immunized with purified UV-inactivated EBV and boosted with virus-like particles (VLPs) that incorporate EBV gp350 ectodomain on the surface to enrich for production of anti-gp350 antibodies, then splenocytes were isolated from the immunized mice and fused with myeloma cells. Specifically, five eight-week-old BALB/c mice were immunized with virus-like particles incorporating gp350/220 on the surface, four times (day 0, 14, 28, and 56) via intraperitoneal injection without adjuvants. At day 64, immunized mice were boosted once intravenously. Animals were sacrificed at Day 70 to harvest splenocytes for fusion with the mouse myeloma P3X63Ag8 cell line.
[0086] Indirect ELISA was used to screen supernatants from the hybridomas for specificity against purified EBV gp350 ectodomain protein (aa 4-863) and 23 hybridomas producing gp350 specific antibodies were identified. These novel antibodies were analyzed by flow cytometric analysis for surface expression of gp350 protein on 10.sup.6 CHO cells transfected with 1 g of pCAGGS-gp350. gp350 expressing cells were resuspended in PBS, stained with anti-gp350 mAb, which detects the gp350 ED, followed by secondary Ab goat anti-mouse conjugated to AF488. Additionally, western blot analysis was conducted on untransfected and pCAGGS-gp350 transfected CHO lysate. Anti-gp350 mAb 72A1 was used as a positive control (1:100) and anti-gp350 hybridoma clone supernatants were used at 1:50, and anti-mouse secondary antibody was used at 1:2000.
[0087] The isotypes of the new antibodies were determined to be IgG1 (n=14), IgG2a (n=5), IgG2b (n=1), a mixture of IgG1 and IgG2b (n=1), and a mixture of IgG1 and IgM (n=2). It was found that all 23 hybridoma producing antibodies, designated HB1-23, recognized the gp350 antigen in an initial ELISA screening using unfractionated and unpurified hybridoma supernatants (data not shown). Affinity purification with protein A followed by SDS-PAGE was used to confirm the purity of the antibodies. When quantified amount of the purified antibodies (10 g/ml) was re-evaluated using indirect ELISA, all of the 23 antibodies had ELISA signals two times greater than those of phosphate buffered saline (negative control), and were considered as positive or specific to gp350. Of these, five (HB4, HB5, HB7, HB13, and HB14) demonstrated binding affinity equal to or greater than that of the positive control, nAb-72A1 (
[0088] Determining the nature of the binding between an antibody and its target antigen is an important consideration for the performance and specificity of an antibody, as it can involve the recognition of a linear or conformational epitope (49). The antibodies were characterized using immunoblot analysis of denatured gp350 antigen expressed from Chinese hamster ovary (CHO) cells, and 16 of the antibodies reacted to both the 350 kDa and the 220 kDa splice variant. In contrast, HB2, HB3, HB6, HB7, HB13, HB20, and HB21 failed to recognize either of the denatured isoforms of gp350 (
Example 3: Analysis of the Variable Heavy and Variable Light Chain Sequences
[0089] The complementarity determining regions (CDRs) of the anti-gp350 mAbs were sequenced by amplifying mRNA representing unique heavy/light variable chain sequences using RT-PCR. RT-PCR products were sequenced and analyzed. The sequences of the heavy and light chain variable region genes (VH and VL, respectively) of the 23 new anti-gp350 antibodies, as well as the nAb-72A1, were determined and compared the sequences to published nAb-72A1 sequences (50, 51). The sequence of the CDR of this antibody was recently determined and published, revealing two unique IgG1 heavy chains and two unique light chains, one kappa and one lambda (50, 51). PCR was used to amplify the genes encoding the VH and VL chain regions in cDNA generated from the 23 hybridoma cells as well as from HB168 (nAb-72A1). The PCR products presented distinct bands at approximately 350-400 bp and 450-500 bp for VH and VL, respectively (data not shown). The purified fragments were sequenced using Illumina MiSeq, followed by in silico analysis and CDRs for both VH and VL were identified (
TABLE-US-00003 TABLE 3 Summary of Illumina Dual Demultiplex of V.sub.H and V.sub.L Regions >5% PEAR Length Primer >5% Unique Starting Merged Filtered Matched 3x Unique Non- Sample Chain Pairs Reads Reads Reads Reads Coding Coding HB1 HEAVY 51,641 51,210 46,655 32,482 22,725 1 0 LIGHT 280,048 279,012 100,725 68,041 58,570 1 1 HB2 HEAVY 22,793 22,621 16,475 11,415 7,429 1 0 LIGHT 167,230 166,496 161,764 132,752 115,886 1 1 HB3 HEAVY 26,382 26,162 25,542 16,910 11,709 1 0 LIGHT 12,681 12,609 11,753 9,809 8,023 1 1 HB4 HEAVY 38,811 38,238 17,151 11,957 7,217 2 0 LIGHT 179,249 129,752 111,996 78,392 66,419 1 1 HB.5 HEAVY 42,951 42,173 35,793 25,842 17,173 1 0 LIGHT 176,073 175,267 168,806 141,712 127,045 1 1 HB6 HEAVY 26,142 25,981 22,245 15,658 10,453 1 0 LIGHT 171,996 171,370 167,730 138,348 122,397 1 1 HB7 HEAVY 32,443 32,094 25,449 17,615 11,836 1 0 LIGHT 67,031 63,924 37,344 26,271 22,378 1 1 * HB8 HEAVY 140,091 103,349 92,744 58,292 31,583 1 0 LIGHT 151,244 115,527 102,439 82,154 70,803 1 1 HB9 HEAVY 37,057 36,473 19,544 11,585 7,358 1 0 LIGHT 409,432 310,529 136,074 106,820 90,063 1 2 * HB10 HEAVY 38,181 37,981 26,043 17,104 11,391 1 0 LIGHT 114,255 112,498 106,914 84,368 75,370 1 1 HB11 HEAVY 22,225 21,841 6,956 4,408 2,465 1 0 LIGHT 106,465 102,278 65,332 50,232 44,527 1 0 HB12 HEAVY 83,044 82,355 46,350 30,276 20,886 1 0 LIGHT 53,098 47,336 15,823 7,560 5,845 1 1 HB13 HEAVY 81,451 80,372 47,995 32,216 20,139 2 0 LIGHT 27,314 24,774 8,987 5,457 4,104 2 1 HB14 HEAVY 76,299 75,357 28,309 19,104 12,939 1 0 LIGHT 153,011 149,264 48,474 29,710 25,133 1 1 HB.15 HEAVY 26,551 26,410 16,387 11,434 7,002 2 0 LIGHT 78,525 77,778 43,509 29,504 24,731 1 1 HB16 HEAVY 54,249 53,943 9,517 7,128 4,179 1 0 LIGHT 42,048 40,351 30,602 22,758 18,251 2 1 HB17 HEAVY 111,614 110,882 81,428 50,844 35,949 1 0 LIGHT 102,490 100,488 83,925 65,925 57,727 1 1 * HB18 HEAVY 211,215 155,410 146,256 91,009 50,308 1 0 LIGHT 212,261 161,879 155,235 123,096 105,959 1 1 HB19 HEAVY 109,692 82,221 20,546 12,587 7,274 1 1 LIGHT 70,828 69,744 62,572 48,354 42,051 1 1 HB20 HEAVY 15,781 15,632 12,789 7,757 4,852 1 0 LIGHT 135,527 133,208 118,513 90,717 78,701 1 1 HB21 HEAVY 15,312 15,202 8,577 5,645 3,420 1 0 LIGHT 102,450 100,171 89,059 68,552 60,500 1 1 HB22 HEAVY 217,959 156,488 154,008 95,755 50,245 1 0 LIGHT 205,334 156,986 143,386 108,728 85,136 1 0 HB23 HEAVY 196,390 143,929 123,028 71,076 39,358 2 0 LIGHT 158,594 120,140 115,476 90,004 78,787 2 0 72A1 HEAVY 213,480 158,199 156,215 107,395 68,486 2 0 LIGHT 187,216 140,964 132,945 105,783 91,208 1 1 * Hybridoma with V.sub.L chain sequences identified with >1% frequency, Hybridoma with more than one unique, plausible-coding V.sub.H chain sequence with >5% frequency. The term unique refers to unique sequence counts (so, identical sequences found in a substantial frequency of merged reads, not necessarily unique compared to other samples).
[0090] The analysis and comparison of the VH and VL chain gene sequences of the 23 hybridomas compared to HB168 (nAb-72A1) showed unique sequences within the CDR 1-3 region. Only HB8 and HB18 had identical VH and VL chain gene sequences, suggesting that the two are the same clone isolated separately; therefore, HB18 was excluded from subsequent experiments. One of the two HB15 antibodies had identical VH and VL gene sequences to that of HB10, however based on the previous characterization, the presence of the additional antibody in HB15 was sufficient to confer subtle differences in biochemical characterizations for gp350 between the two antibodies. Thus, based on the sequence analysis (
Example 4: Neutralization Assay
[0091] The ability of the 15 mAbs (10 g/ml or 50 g/ml) to neutralize purified eGFP-tagged AGS-EBV infection of the Raji B cell line in vitro was evaluated following standardized procedures (52) and determined the percentage of eGFP+ cells using flow cytometry as described (45, 47). The nAbs 72A1 and E1D1 were used as positive controls, whereas the non-neutralizing mAb 2L10 was used as a negative control. Because HB4, HB7, HB13, HB15, HB16, HB19, HB21, and HB23 were confirmed to be mixtures based on isotyping or sequence data, they were eliminated from further consideration in the neutralization assay. An antibody was considered a neutralizer if it inhibited EBV infection >20% at 10 g/ml and >60% at 50 g/ml. Several mAbs inhibited EBV infection in a dose-dependent manner. HB20 and HB17 were the most effective at preventing EBV infection of Raji cells in vitro, whereby they reduced infection by 40% and >60%, and >30% and 80% at 10 g/ml and 50 g/ml, respectively (
TABLE-US-00004 TABLE 4 Summarized Biochemical and Functional Characterizations of Anti-gp350 Antibodies ELISA binding to FACS Light purified EBV (CHO Western Neutralization Antibody IgG sub-class chain gp350/220 Cells) blot activity HB1 IgG1 + + + HB2 IgG2a + + HB3 IgG2a + HB4 IgG1 + + ND HB5 IgG2a + + + HB6 IgG1 + HB7 IgG1 + HB8 IgG1 + + HB9 IgG2a + + + HB10 IgG1 + + HB11 IgG1 + + + + HB12 IgG1 + + HB13 IgG1 + ND HB14 IgG1 + + HB15 IgG1 + + + ND HB16 IgG1/IgM + + ND HB17 IgG2b + + + + HB19 IgG1/IgM + + + ND HB20 IgG2a + + HB21 IgG1/IgG2b + ND HB22 IgG1 + HB23 IgG1 + + ND 72A1 IgG1 + + + + E1D1 (anti IgG1 + gH/gL) ND = Not determined, + = positive, = negative, ELISA = enzyme-linked immunosorbent assay, = Kappa.
Example 5: Epitope Mapping
[0092] The 15 new anti-gp350 mAbs (neutralizers vs. non-neutralizers) were used to identify most, if not all, of the relevant immunodominant aa residues targeted by both the nAbs and non-nAbs. RepliTope approach was used, in which overlapping peptides [15-mer with 11 aa overlap] that cover the complete sequence of gp350 (aa 1-907) were immobilized on microarray slides and probed with the purified anti-gp350 antibodies in an ELISA format. nAb-72A1 was used as positive control, because the cognate epitopes bound by the antibody have previously been reported.
[0093] Two epitopes, .sub.253TPIPGTGYAYSLRLTPRPVSRFL.sub.275 and .sub.393VSGLGTAPKTLIITRTATNATTT.sub.415, were both bound by all 15 mAbs, as well as nAb-72A1 and 2L10, regardless of their neutralizing or non-neutralizing capabilities. This consensus suggests that these epitopes are immunodominant. Several of the 15 mAbs (HB2, HB3, HB8, HB11, HB12, HB14, HB17, and HB22), as well as nAb-72A1, bound to .sub.341ANSPNVTVTAFWAWPNNTE.sub.359. Two epitopes, aa 341-359 and aa 393-415, were found within the previously identified single epitope II, which is encoded by nucleotides between 3,186 bp and 3,528 bp, corresponding to aa 326-439 of gp350 (56). Two mAbs, HB1 and HB10, bound .sub.605TTPTPNATGPTVGETSPQA.sub.623, an epitope located within the gp350 (501-699) splice region that is involved in generation of the 220 kDa splice variant. A total of eight mAbs (HB1-3, HB8, HB10-12, and HB22) also bound to the region between .sub.1MEAALLVCQYTIQSLIHLTGEDPG.sub.24, which includes a region homologous to C3d, another molecule known to interact with CD21 (51, 55). Two epitopes common between most nAbs and non-nAbs, .sub.821PPSTSSKLRPRWTFTSPPV.sub.839 and .sub.875LLLLVMADCAFRRNLSTSHTYTTPPY.sub.899, were located upstream and downstream, respectively, of the transmembrane domain on the C-terminus of gp350. Epitope aa 821-839 is located within the previously identified epitope I, which is located between aa 733-841 (56). Furthermore, epitope aa 821-839 is potentially involved in EBV infection of B cells (58). However, the study could not identify two epitopes located at aa 282-301 and aa 194-211, which were previously shown to be involved in the binding of nAb-72A1 and CD21, respectively (51, 58, 59). It was shown that nAb-72A1 bound .sub.145EMQNPVYLIPETVPYIKWDN.sub.164, one of the neutralizing epitopes on gp350 (51, 58, 59). Nine gp350 epitopes identified by 15 neutralizing and non-neutralizing mAbs are shown in the sequence below and summarized in Table 5). Residues in bold represent the gp220 splice variant region. Residues in boxes represent RepliTope-identified epitopes and exact residues. Italic residues represent canonical neutralizing epitope, underlined residues represent epitope bound by all assayed mAb.
TABLE-US-00005
TABLE-US-00006 TABLE 5 Antibody Binding gp350 Epitopes Epitope Amino acid sequence Epitope Properties 1 .sub.1MEAALLVCQYTIQSLIHLTGEDPG.sub.24 2 .sub.145EMQNPVYLIPETVPYIKWDN.sub.164 Neutralizing 3 .sub.253TPIPGTGYAYSLRLTPRPVSRFL.sub.275 Immunodominant/novel 4 .sub.341ANSPNVTVTAFWAWPNNTE.sub.359 5 .sub.381GAFASNRTFDIT.sub.392 Neutralizing/novel 6 .sub.393VSGLGTAPKTLIITRTATNATTT.sub.415 Immunodominant 7 .sub.605TTPTPNATGPTVGETSPQA.sub.623 8 .sub.821PPSTSSKLRPRWTFTSPPV.sub.839 9 .sub.875LLLLVMADCAFRRNLSTSHTYTTPPY.sub.899 novel
Example 6: Construction of Chimeric gp350 nAbs
[0094] Chimeric gp350 nAbs were constructed according to the diagrams of
[0095] Analysis of VH-VL sequence from the HB168 (nAb-72A1) hybridoma revealed that the hybridoma produced two antibodies: one that is gp350-specific and another that recognizes mineral oil-induced plasmacytoma (MOPC) (57). To further investigate gp350 for additional neutralizing epitopes, the gp350-specific nAb-72A1 VH-VL sequence was used to generate chimeric (mouse/human) recombinant antibodies. Similarly, the VH-VL sequence for the HB20 antibody, which the neutralization analysis above showed to be one of the best nAb, was used to generate chimeric antibody. A negative control chimeric recombinant antibody was generated using VH-VL sequences from the gp350-specific but non-neutralizing HB5 antibody mentioned above (
[0096] Comparative analysis of the epitope binding pattern was performed using the chimeric recombinant antibodies and a novel epitope was revealed, .sub.381GAFASNRTFDIT.sub.392, which was bound by HB20 and nAb-72A1, but not by HB5, and is distinct from the .sub.145EMQNPVYLIPETVPYIKWDN.sub.164 epitope, which is bound only by the nAb-72A1. The sequence below shows the novel gp350-neutralizing epitope identified by epitope mapping of neutralizing (nAb-72A1 and HB20) vs non-neutralizing (HB5) anti-gp350 mAbs. Epitopes bound by nAb-72A1 (double underlined), HB20 (wavy underlined), and HB5 (boxed) are indicated. Residues 501-700 represent splice variant region (bold), single underlined residues represent epitopes bound by nAb-72A1, HB20 and HB5, and italic residues represent epitopes bound by nAbs.
TABLE-US-00007 1 MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTINFDVGGKKHQ 61 LDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAGELALTMRSKKLPINVTTGEE
Example 7: Development of Antibody-Small Molecule Conjugates (ADCs)
[0097] Using small molecule L.sub.2P.sub.4 as an example, antibody-small molecule conjugates can be developed as illustrated in
Example 8: Efficacy Test of ADCs
[0098] To screen for optimal dose and identify the best nAb clone for pre-clinical studies, the ability of the ADC to neutralize EBV in vitro and to protect against PTLD in vivo is tested using a humanized mouse, as described.sup.43,44. In brief, purified chimeric ADC (or controls: PBS, or isotype-matched non-nAbs) is injected by I.V. into humanized mice, followed by EBV-B95-8-eGFP challenge. Mice are monitored regularly and euthanized upon signs of illness or after a preset limit of 100 days. Routine histology and necropsy are conducted to assess the efficacy of the ADC to protect against EBV infection and PTLD development.
REFERENCES
[0099] The references listed below, and all references cited in the specification are hereby incorporated by reference in their entireties, as if fully set forth herein. [0100] 1. Rickinson A B, Kieff E. Epstein-Barr Virus. In: Knipe D M, Howley P M, eds. Fields Virology. Philadelphia: Lippincott, Williams & Wilkins; 2007:2680-2700. [0101] 2. Goedert J J, Cote T R, Virgo P, et al. Spectrum of AIDS-associated malignant disorders. Lancet 1998; 351:1833-9. [0102] 3. Cot T R, Biggar R J, Rosenberg P S, et al. Non-Hodgkin's lymphoma among people with AIDS: Incidence, presentation and public health burden. International Journal of Cancer 1998; 73:645-50. [0103] 4. Benkerrou M, Jais J P, Leblond V, et al. Anti-B-cell monoclonal antibody treatment of severe posttransplant B-lymphoproliferative disorder: prognostic factors and long-term outcome. Blood 1998; 92:3137-47. [0104] 5. Cruz R J, Jr., Ramachandra S, Sasatomi E, et al. Surgical management of gastrointestinal posttransplant lymphoproliferative disorders in liver transplant recipients. Transplantation 2012; 94:417-23. [0105] 6. Faro A, Kurland G, Michaels M G, et al. Interferon-alpha affects the immune response in post-transplant lymphoproliferative disorder. Am J Respir Crit Care Med 1996; 153:1442-7. [0106] 7. Milpied N, Vasseur B, Parquet N, et al. Humanized anti-CD20 monoclonal antibody (Rituximab) in post transplant B-lymphoproliferative disorder: a retrospective analysis on 32 patients. Ann Oncol 2000; 11 Suppl 1:113-6. [0107] 8. Papadopoulos E B, Ladanyi M, Emanuel D, et al. Infusions of donor leukocytes to treat Epstein-Barr virus-associated lymphoproliferative disorders after allogeneic bone marrow transplantation. N Engl J Med 1994; 330:1185-91. [0108] 9. Starzl T E, Holmes J H. Experience in renal transplantation. 1964. [0109] 10. Stamatatos L, Morris L, Burton D R, Mascola J R. Neutralizing antibodies generated during natural HIV-1 infection: good news for an HIV-1 vaccine? Nature medicine 2009; 15:866-70. [0110] 11. Walker L M, Phogat S K, Chan-Hui P-Y, et al. Broad and potent neutralizing antibodies from an African donor reveal a new HIV-1 vaccine target. Science 2009; 326:285-9. [0111] 12. Sui J, Hwang W C, Perez S, et al. Structural and functional bases for broad-spectrum neutralization of avian and human influenza A viruses. Nature structural & molecular biology 2009; 16:265-73. [0112] 13. Han T, Marasco W A. Structural basis of influenza virus neutralization. Annals of the New York Academy of Sciences 2011; 1217:178-90. [0113] 14. Wrammert J, Smith K, Miller J, et al. Rapid cloning of high-affinity human monoclonal antibodies against influenza virus. Nature 2008; 453:667-71. [0114] 15. Piedimonte G, King K A, Holmgren N L, Bertrand P J, Rodriguez M M, Hirsch R L. A humanized monoclonal antibody against respiratory syncytial virus (palivizumab) inhibits RSV-induced neurogenic-mediated inflammation in rat airways. Pediatr Res 2000; 47:351-6. [0115] 16. Glotz D, Chapman J R, Dharnidharka V R, et al. The seville expert workshop for progress in posttransplant lymphoproliferative disorders. Transplantation 2012; 94:784-93. [0116] 17. Connolly S A, Jackson J O, Jardetzky T S, Longnecker R. Fusing structure and function: a structural view of the herpesvirus entry machinery: A structural view of herpesvirus entry machinery. Nat Rev Microbiol 2011; 9:369-81. [0117] 18. Eisenberg R J, Atanasiu D, Cairns T M, Gallagher J R, Krummenacher C, Cohen G H. Herpes virus fusion and entry: a story with many characters. Viruses 2012; 4:800-32. [0118] 19. Henle G, Henle W, Diehl V. Relation of Burkitt's tumor-associated herpes-type virus to infectious mononucleosis. Proceedings of the National Academy of Sciences of the United States of America 1968; 59:94. [0119] 20. Cohen J I, Fauci A S, Varmus H, Nabel G J. Epstein-Barr Virus: An Important Vaccine Target for Cancer Prevention. Science Translational Medicine 2011; 3:107fs7-fs7. [0120] 21. Khanna R, Sherritt M, Burrows S R. EBV structural antigens, gp350 and gp85, as targets for ex vivo virus-specific CTL during acute infectious mononucleosis: potential use of gp350/gp85 CTL epitopes for vaccine design. The Journal of Immunology 1999; 162:3063-9. [0121] 22. Thorley-Lawson D A, Geilinger K. Monoclonal antibodies against the major glycoprotein (gp350/220) of Epstein-Barr virus neutralize infectivity. Proceedings of the National Academy of Sciences of the United States of America 1980; 77:5307-11. [0122] 23. Perez E M, Foley J, Tison T, Silva R, Ogembo J G. Novel Epstein-Barr virus-like particles incorporating gH/gL-EBNA1 or gB-LMP2 induce high neutralizing antibody titers and EBV-specific T-cell responses in immunized mice. Oncotarget 2016. [0123] 24. Cohen J I. Epstein-barr virus vaccines. Clin Transl Immunology 2015; 4:e32. [0124] 25. Biggar R J, Henle W, Fleisher G, Bcker J, Lennette E T, Henle G. Primary Epstein-Barr virus infections in african infants. I. Decline of maternal antibodies and time of infection. International Journal of Cancer 1978; 22:239-43. [0125] 26. Biggar R J, Henle G, Bcker J, Lennette E T, Fleisher G, Henle W. Primary Epstein-Barr virus infections in African infants. II. Clinical and serological observations during seroconversion. International Journal of Cancer 1978; 22:244-50. [0126] 27. Mold C, Bradt B, Nemerow G, Cooper N. Activation of the alternative complement pathway by EBV and the viral envelope glycoprotein, gp350. The Journal of Immunology 1988; 140:3867-74. [0127] 28. Khyatti M, Patel P C, Stefanescu I, Menezes J. Epstein-Barr virus (EBV) glycoprotein gp350 expressed on transfected cells resistant to natural killer cell activity serves as a target antigen for EBV-specific antibody-dependent cellular cytotoxicity. Journal of virology 1991; 65:996-1001. [0128] 29. Finerty S, Mackett M, Arrand J R, Watkins P E, Tarlton J, Morgan A J. Immunization of cottontop tamarins and rabbits with a candidate vaccine against the Epstein-Barr virus based on the major viral envelope glycoprotein gp340 and alum. Vaccine 1994; 12:1180-4. [0129] 30. Gu S Y, Huang T M, Ruan L, et al. First EBV vaccine trial in humans using recombinant vaccinia virus expressing the major membrane antigen. Dev Biol Stand 1995; 84:171-7. [0130] 31. Mok H, Cheng X, Xu Q, et al. Evaluation of Measles Vaccine Virus as a Vector to Deliver Respiratory Syncytial Virus Fusion Protein or Epstein-Barr Virus Glycoprotein gp350. Open Virol J 2012; 6:12-22. [0131] 32. Moutschen M, Leonard P, Sokal E M, et al. Phase I/II studies to evaluate safety and immunogenicity of a recombinant gp350 Epstein-Barr virus vaccine in healthy adults. Vaccine 2007; 25:4697-705. [0132] 33. Sokal E M, Hoppenbrouwers K, Vandermeulen C, et al. Recombinant gp350 vaccine for infectious mononucleosis: a phase 2, randomized, double-blind, placebo-controlled trial to evaluate the safety, immunogenicity, and efficacy of an Epstein-Barr virus vaccine in healthy young adults. Journal of Infectious Diseases 2007; 196:1749-53. [0133] 34. Rees L, Tizard E J, Morgan A J, et al. A phase I trial of epstein-barr virus gp350 vaccine for children with chronic kidney disease awaiting transplantation. Transplantation 2009; 88:1025-9. [0134] 35. Haque T, Johannessen I, Dombagoda D, et al. A mouse monoclonal antibody against Epstein-Barr virus envelope glycoprotein 350 prevents infection both in vitro and in vivo. J Infect Dis 2006; 194:584-7. [0135] 36. Ferrara N, Hillan K J, Gerber H-P, Novotny W. Discovery and development of bevacizumab, an anti-VEGF antibody for treating cancer. Nat Rev Drug Discov 2004; 3:391-400. [0136] 37. Hudis C A. TrastuzumabMechanism of Action and Use in Clinical Practice. New England Journal of Medicine 2007; 357:39-51. [0137] 38. Jonker D J, O'Callaghan C J, Karapetis C S, et al. Cetuximab for the Treatment of Colorectal Cancer. New England Journal of Medicine 2007; 357:2040-8. [0138] 39. Dzeng R K, Jha H C, Lu J, Saha A, Banerjee S, Robertson E S. Small molecule growth inhibitors of human oncogenic gammaherpesvirus infected B-cells. Mol Oncol 2015; 9:365-76. [0139] 40. Jiang L, Lan R, Huang T, et al. EBNA1-targeted probe for the imaging and growth inhibition of tumours associated with the Epstein-Barr virus. Nature Biomedical Engineering 2017; 1:0042. [0140] 41. Dubowchik G M, Firestone R A. Cathepsin B-sensitive dipeptide prodrugs. A model study of structural requirements for efficient release of doxorubicin. Bioorganic & medicinal chemistry letters 1998; 8:3341-6. [0141] 42. Senter P D, Sievers E L. The discovery and development of brentuximab vedotin for use in relapsed Hodgkin lymphoma and systemic anaplastic large cell lymphoma. Nature biotechnology 2012; 30:631-7. [0142] 43. Haque T, Johannessen I, Dombagoda D, et al. A mouse monoclonal antibody against Epstein-Barr virus envelope glycoprotein 350 prevents infection both in vitro and in vivo. J Infect Dis 2006; 194:584-7. [0143] 44. Jangalwe S, Shultz L D, Mathew A, Brehm M A. Improved B cell development in humanized NOD-scid IL2Rgammanull mice transgenically expressing human stem cell factor, granulocyte-macrophage colony-stimulating factor and interleukin-3. Immun Inflamm Dis 2016; 4:427-40. [0144] 45. Ogembo J G, Kannan L, Ghiran I, Nicholson-Weller A, Finberg R W, Tsokos G C, Fingeroth J D. 2013. Human complement receptor type 1/CD35 is an Epstein-Barr Virus receptor. Cell Rep 3:371-385. [0145] 46. Speck P, Longnecker R. 1999. Epstein-Barr virus (EBV) infection visualized by EGFP expression demonstrates dependence on known mediators of EBV entry. Arch Virol 144:1123-1137. [0146] 47. Ogembo J G, Muraswki M R, McGinnes L W, Parcharidou A, Sutiwisesak R, Tison T, Avendano J, Agnani D, Finberg R W, Morrison T G. 2015. A chimeric EBV gp350/220-based VLP replicates the virion B-cell attachment mechanism and elicits long-lasting neutralizing antibodies in mice. Journal of Translational Medicine 13:50. [0147] 48. Jones S T, Bendig M M. 1991. Rapid PCR-cloning of full-length mouse immunoglobulin variable regions. Biotechnology (NY) 9:579. [0148] 49. Sela M, Schechter B, Schechter I, Borek F. 1967. Antibodies to Sequential and Conformational Determinants. Cold Spring Harbor Symposia on Quantitative Biology 32:537-545. [0149] 50. Herrman M, Muhe J, Quink C, Wang F. 2015. Epstein-Barr Virus gp350 Can Functionally Replace the Rhesus Lymphocryptovirus Major Membrane Glycoprotein and Does Not Restrict Infection of Rhesus Macaques. J Virol 90:1222-1230. [0150] 51. Tanner J E, Coincon M, Leblond V, Hu J, Fang J M, Sygusch J, Alfieri C. 2015. Peptides designed to spatially depict the Epstein-Barr virus major virion glycoprotein gp350 neutralization epitope elicit antibodies that block virus-neutralizing antibody 72A1 interaction with the native gp350 molecule. J Virol 89:4932-4941. [0151] 52. Sashihara J, Burbelo P D, Savoldo B, Pierson T C, Cohen J I. 2009. Human antibody titers to Epstein-Barr Virus (EBV) gp350 correlate with neutralization of infectivity better than antibody titers to EBV gp42 using a rapid flow cytometry-based EBV neutralization assay. Virology 391:249-256. [0152] 53. Qualtiere L F, Decoteau J F, Hassan Nasr-el-Din M. 1987. Epitope mapping of the major Epstein-Barr virus outer envelope glycoprotein gp350/220. J Gen Virol 68 (Pt 2):535-543. [0153] 54. Nemerow G R, Mold C, Schwend V K, Tollefson V, Cooper N R. 1987. Identification of Gp350 as the Viral Glycoprotein Mediating Attachment of Epstein-Barr-Virus (Ebv) to the Ebv/C3d Receptor of B-CellsSequence Homology of Gp350 and C3-Complement Fragment C3d. Journal of Virology 61:1416-1420. [0154] 55. Nemerow G R, Houghten R A, Moore M D, Cooper N R. 1989. Identification of an epitope in the major envelope protein of Epstein-Barr virus that mediates viral binding to the B lymphocyte EBV receptor (CR2). Cell 56:369-377. [0155] 56. Zhang P F, Klutch M, Armstrong G, Qualtiere L, Pearson G, Marcus-Sekura C J. 1991. Mapping of the epitopes of Epstein-Barr virus gp350 using monoclonal antibodies and recombinant proteins expressed in Escherichia coli defines three antigenic determinants. J Gen Virol 72 (Pt 11):2747-2755. [0156] 57. Tanner J, Whang Y, Sample J, Sears A, Kieff E. 1988. Soluble gp350/220 and deletion mutant glycoproteins block Epstein-Barr virus adsorption to lymphocytes. J Virol 62:4452-4464. [0157] 58. Urquiza M, Lopez R, Patino H, Rosas J E, Patarroyo M E. 2005. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells. J Biol Chem 280:35598-35605. [0158] 59. Szakonyi G, Klein M G, Hannan J P, Young K A, Ma R Z, Asokan R, Holers V M, Chen X S. 2006. Structure of the Epstein-Barr virus major envelope glycoprotein. Nat Struct Mol Biol 13:996-1001. [0159] 60. Sitompul L S, Widodo N, Djati M S, Utomo D H. 2012. Epitope mapping of gp350/220 conserved domain of epstein barr virus to develop nasopharyngeal carcinoma (npc) vaccine. Bioinformation 8:479-482. [0160] 61. Balfour H H, Jr. 2014. Progress, prospects, and problems in Epstein-Barr virus vaccine development. Curr Opin Virol 6C:1-5. [0161] 62. Henle G, Henle W. 1979. The virus as the etiologic agent of infectious mononucleosis, p 297-320, The Epstein-Barr Virus. Springer. [0162] 63. Luzuriaga K, Sullivan J L. 2010. Infectious mononucleosis. N Engl J Med 362:1993-2000. [0163] 64. Cui X, Cao Z, Chen Q, Arjunaraja S, Snow A L, Snapper C M. 2016. Rabbits immunized with Epstein-Barr virus gH/gL or gB recombinant proteins elicit higher serum virus neutralizing activity than gp350. Vaccine. [0164] 65. Fingeroth J D, Weis J J, Tedder T F, Strominger J L, Biro P A, Fearon D T. 1984. Epstein-Barr virus receptor of human B lymphocytes is the C3d receptor CR2. Proc Natl Acad Sci USA 81:4510-4514. [0165] 66. Tanner J, Weis J, Fearon D, Whang Y, Kieff E. 1987. Epstein-Barr virus gp350/220 binding to the B lymphocyte C3d receptor mediates adsorption, capping, and endocytosis. Cell 50:203-213. [0166] 67. Weiss E R, Alter G, Ogembo J G, Henderson J L, Tabak B, Bakis Y, Somasundaran M, Garber M, Selin L, Luzuriaga K. 2017. High Epstein-Barr Virus Load and Genomic Diversity Are Associated with Generation of gp350-Specific Neutralizing Antibodies following Acute Infectious Mononucleosis. J Virol 91. [0167] 68. Hoffman G J, Lazarowitz S G, Hayward S D. 1980. Monoclonal antibody against a 250,000-dalton glycoprotein of Epstein-Barr virus identifies a membrane antigen and a neutralizing antigen. Proc Natl Acad Sci USA 77:2979-2983. [0168] 69. Thorley-Lawson D A, Geilinger K. 1980. Monoclonal antibodies against the major glycoprotein (gp350/220) of Epstein-Barr virus neutralize infectivity. Proc Natl Acad Sci USA 77:5307-5311. [0169] 70. Alfarano C, Andrade C E, Anthony K, Bahroos N, Bajec M, Bantoft K, Betel D, Bobechko B, Boutilier K, Burgess E, Buzadzija K, Cavero R, D'Abreo C, Donaldson I, Dorairajoo D, Dumontier M J, Dumontier M R, Earles V, Farrall R, Feldman H, Garderman E, Gong Y, Gonzaga R, Grytsan V, Gryz E, Gu V, Haldorsen E, Halupa A, Haw R, Hrvojic A, Hurrell L, Isserlin R, Jack F, Juma F, Khan A, Kon T, Konopinsky S, Le V, Lee E, Ling S, Magidin M, Moniakis J, Montojo J, Moore S, Muskat B, Ng I, Paraiso J P, Parker B, Pintilie G, Pirone R, et al. 2005. The Biomolecular Interaction Network Database and related tools 2005 update. Nucleic Acids Res 33:D418-424.