Chagasin-based scaffold compositions, methods, and uses

10562946 ยท 2020-02-18

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are novel, non-naturally occurring chagasin scaffold proteins derived from chagasin or chagasin-like protease inhibitor proteins. Also provided are libraries of non-naturally occurring chagasin scaffold proteins and methods of using such libraries to generate non-naturally occurring chagasin scaffold proteins that specifically bind to a target ligand. The present invention further provides methods of using non-naturally occurring chagasin protein scaffold that bind to a target ligand, including diagnostic and therapeutic compositions and methods. The invention also provides novel non-naturally occurring chagasin scaffold proteins that specifically bind low density lipoprotein receptor-related protein 6 (LRP6) and novel non-naturally occurring chagasin scaffold proteins that specifically bind vascular endothelial growth factor (VEGF).

Claims

1. A peptide that comprises the amino acid sequence of SEQ ID NO: 117 and specifically binds vascular endothelial growth factor (VEGF).

2. The peptide of claim 1 conjugated to a therapeutic agent.

3. The peptide of claim 1 conjugated to a label.

4. The peptide according to claim 3, wherein the label is selected from the group consisting of a radioisotope, a fluorescent dye, and an enzyme.

5. A composition comprising the peptide of claim 1 and a pharmaceutically acceptable carrier.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows a sequence alignment of chagasin-like protease inhibitors from different organisms.

(2) FIG. 2A shows the results of an ELISA performed to measure binding of phage-displayed chagasin to papain.

(3) FIG. 2B shows the results of an ELISA performed to measure binding of phage-displayed chagasin to an antibody specific to the gD epitope tag fused to the N-terminus of chagasin.

(4) FIG. 3 shows a crystal structure of LRP6-E1 in complex with Dkk1 peptide Ac-NSNAIKN-NH.sub.2 (SEQ ID NO: 109)

(5) FIG. 4A shows the results of experiments performed to determine the binding kinetics of LRP6 binder H, the amino acid sequence of which is set forth in SEQ ID NO: 87.

(6) FIG. 4B shows the results of experiments performed to determine the binding kinetics of LRP6 binder P, the amino acid sequence of which is set forth in SEQ ID NO: 88.

(7) FIG. 4C shows the results of experiments performed to determine the binding kinetics of LRP6 binder S, the amino acid sequence of which is set forth in SEQ ID NO: 89.

(8) FIG. 5A shows the results of experiments performed to determine the binding kinetics of LRP6 binder H2, the amino acid sequence of which is set forth in SEQ ID NO: 15.

(9) FIG. 5B shows the results of experiments performed to determine the binding kinetics of LRP6 binder H15, the amino acid sequence of which is set forth in SEQ ID NO: 16.

(10) FIG. 5C shows the results of experiments performed to determine the binding kinetics of LRP6 binder S11, the amino acid sequence of which is set forth in SEQ ID NO: 17.

(11) FIG. 6 shows the results of experiments performed to determine whether LRP6 binders H2, H15, and S11 are capable of inhibiting Wnt-dependent cellular signaling.

(12) FIG. 7 shows phage binding titration of chagasin VEGF variants 5-44-D8 (SEQ ID NO: 36), 4-66-F6 (SEQ ID NO: 37), 2-40-D4 (SEQ ID NO: 38), 1-90-H6 (SEQ ID NO: 39), and 3-65-F5 (SEQ ID NO: 40) to VEGF coated onto ELISA plates (5 g/ml VEGF coated on 384 well MAXISORP plates).

(13) FIG. 8 shows the results of experiments performed to determine the ability of GST-fused chagasin VEGF variants 1-90-H6 (SEQ ID NO: 39), 2-40-D4 (SEQ ID NO: 38), 3-65-F5 (SEQ ID NO: 40), 4-66-F6 (SEQ ID NO: 37), and 5-44-D8 (SEQ ID NO: 36) to block VEGF binding to VEGFR1-ECD Fc fusion in a competition binding ELISA.

(14) FIG. 9 shows the results of experiments performed to determine the ability of VEGF variant 4-66-F6 (SEQ ID NO: 37) alone and fused to GST to block VEGF binding to VEGFR1-ECD Fc fusion in a competition binding ELISA.

(15) FIG. 10A shows the results of experiments performed to determine the inhibitory activity of GST-fused chagasin VEGF variants against human VEGF in a cell-based assay. (The amino acid sequence of Variant 3 is set forth in SEQ ID NO: 40; the amino acid sequence of Variant 4 is set forth in SEQ ID NO: 37; the amino acid sequence of WT is set forth in SEQ ID NO: 1.)

(16) FIG. 10B shows the results of experiments performed to determine the inhibitory activity of GST-fused chagasin VEGF variants against mouse VEGF in a cell-based assay. (The amino acid sequence of Variant 3 is set forth in SEQ ID NO: 40; the amino acid sequence of Variant 4 is set forth in SEQ ID NO: 37; the amino acid sequence of WT is set forth in SEQ ID NO: 1.)

(17) FIG. 10C shows the results of experiments performed to determine the inhibitory activity of GST-fused chagasin VEGF variants against rat VEGF in a cell-based assay. (The amino acid sequence of Variant 3 is set forth in SEQ ID NO: 40; the amino acid sequence of Variant 4 is set forth in SEQ ID NO: 37; the amino acid sequence of WT is set forth in SEQ ID NO: 1.)

(18) FIG. 11 shows the results of experiments performed to determine the inhibitory activity of GST-chagasin VEGF variant 4, variant 4 (SEQ ID NO: 37), and anti-VEGF antibodies against human VEGF in cell-based assays.

(19) FIG. 12 shows partial sequence of 33 phage clones with high target affinity and specificity to VEGF determined by phage spot ELISA.

(20) FIG. 13 shows the results of experiments performed to determine the inhibitory activity of affinity matured chagasin VEGF variants against human VEGF in cell-based assays. (The amino acid sequence of WT is set forth in SEQ ID NO: 1; the amino acid sequence of Binder 4 is set forth in SEQ ID NO: 37; the amino acid sequence of E4B-5 is set forth in SEQ ID NO: 70; the amino acid sequence of E4B-7 is set forth in SEQ ID NO: 71; the amino acid sequence of E4B-10 is set forth in SEQ ID NO: 69; the amino acid sequence of L4X6-3 is set forth in SEQ ID NO: 73; the amino acid sequence of L4X6-7 is set forth in SEQ ID NO: 75; and the amino acid sequence of L4X6-9 is set forth in SEQ ID NO: 74.)

(21) FIG. 14 shows the results of experiments performed to determine the binding kinetics of monomeric chagasin VEGF variant L4X6-7 (the amino acid sequence of which is set forth in SEQ ID NO: 75) in solution to biotinylated VEGF109.

(22) FIG. 15 shows SDS-PAGE analysis and binding kinetics of chagasin VEGF variants 37 (i.e., SEQ ID NO: 72) and 66 (SEQ ID NO: 76).

DETAILED DESCRIPTION OF THE INVENTION

(23) The present invention provides novel, non-naturally occurring chagasin scaffold proteins derived from chagasin or chagasin-like protease inhibitor proteins. The chagasin scaffold proteins provided herein are highly thermostable, which in turn can increase yield of recombinant protein obtained, improve solubility of the purified molecule, improve activity of intracellular scaffolds, decrease immunogenicity, and minimize the need of a cold chain in manufacturing.

(24) The overall fold of a non-naturally occurring chagasin scaffold proteins makes it possible to display three of its loops (L2, L4, and L6) in an analogous fashion to antibody CDRs in relative orientations. Because of this structure, the scaffolds of the invention possess antigen binding properties that are similar in nature and affinity to those of antibodies. Accordingly, a non-naturally occurring chagasin scaffold protein provided herein binds to epitopes (i.e., determinants) on target ligands much like an antibody binds to an epitope of an antigen.

(25) Provided herein are libraries of non-naturally occurring chagasin scaffold proteins and methods of using such libraries to generate non-naturally occurring chagasin scaffold proteins that specifically bind to a target ligand. Also provided are methods of using a non-naturally occurring chagasin protein scaffold that bind to a target ligand, as disclosed herein. The methods can include but are not limited to diagnostic and therapeutic methods. Also encompassed herein are diagnostic and therapeutic compositions.

(26) In a related aspect, the invention provides novel non-naturally occurring chagasin scaffold proteins that specifically bind low density lipoprotein receptor-related protein 6 (LRP6) and novel non-naturally occurring chagasin scaffold proteins that specifically bind vascular endothelial growth factor (VEGF).

(27) Also provided are chimeric molecules and conjugates comprising non-naturally occurring chagasin scaffold proteins described herein, nucleic acids encoding the non-naturally occurring chagasin scaffold proteins described herein, and compositions (such as pharmaceutical compositions). The invention also provides methods of using non-naturally occurring chagasin scaffold proteins described herein to detect LRP6 or VEGF or another target in a sample (such as an in vivo or ex vivo sample), compositions comprising such non-naturally occurring chagasin scaffold proteins described herein for use in treating diseases and disorders resulting from abnormal LRP6 activity or expression or from abnormal VEGF activity or expression, and uses of such non-naturally occurring chagasin scaffold proteins in the manufacture of a medicament for the treatment of cancer.

(28) Practice of the present disclosure employs, unless otherwise indicated, standard methods and conventional techniques in the fields of cell biology, toxicology, molecular biology, biochemistry, cell culture, immunology, oncology, recombinant DNA and related fields as are within the skill of the art. Such techniques are described in the literature and thereby available to those of skill in the art. See, for example, Alberts, B. et al., Molecular Biology of the Cell, 5.sup.th edition, Garland Science, New York, N.Y., 2008; Voet, D. et al. Fundamentals of Biochemistry: Life at the Molecular Level, 3.sup.rd edition, John Wiley & Sons, Hoboken, N.J., 2008; Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, 3.sup.rd edition, Cold Spring Harbor Laboratory Press, 2001; Ausubel, F. et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, 1987 and periodic updates; Freshney, R. I., Culture of Animal Cells: A Manual of Basic Technique, 4.sup.th edition, John Wiley & Sons, Somerset, N J, 2000; and the series Methods in Enzymology, Academic Press, San Diego, Calif.

Definitions

(29) As used herein non-naturally occurring means a polypeptide or nucleic acid that is not found in nature. The non-naturally occurring chagasin scaffold protein (or nucleic acid encoding the same) can be produced by genetic engineering methods or by chemical synthesis methods. Thus, a non-naturally occurring chagasin scaffold protein described herein may be recombinant, i.e., produced by a cell, or nucleic acid, or vector, that has been modified by the introduction of a heterologous nucleic acid or the alteration of a native nucleic acid to a form not native to that cell, or that the cell is derived from a cell so modified. Alternatively, a non-naturally occurring chagasin scaffold protein described herein can be produced via chemical peptide synthesis.

(30) As used herein, an amino acid alteration refers to the addition, deletion, or substitution of at least one amino acid from a corresponding sequence in a naturally occurring protein sequence (such as a naturally occurring chagasin protein sequence or chagasin-like protease inhibitor protein sequence).

(31) An isolated non-naturally occurring chagasin scaffold protein or composition is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the non-naturally occurring chagasin scaffold protein, and can include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the non-naturally occurring chagasin scaffold protein or composition will be purified (1) to greater than 95% by weight of non-naturally occurring chagasin scaffold protein as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated non-naturally occurring chagasin scaffold protein includes the chagasin scaffold protein in situ within recombinant cells since at least one component of the chagasin scaffold protein's natural environment will not be present. Ordinarily, however, isolated non-naturally occurring chagasin scaffold protein will be prepared by at least one purification step.

(32) Percent (%) amino acid sequence identity or homology with respect to the polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.

(33) An effective amount of a non-naturally occurring chagasin scaffold protein or composition as disclosed herein is an amount sufficient to carry out a specifically stated purpose. An effective amount can be determined empirically and by known methods relating to the stated purpose.

(34) The term therapeutically effective amount refers to an amount of a non-naturally occurring chagasin scaffold protein or composition as disclosed herein, effective to treat a disease or disorder in a mammal (aka patient). In the case of cancer, the therapeutically effective amount of a non-naturally occurring chagasin scaffold protein or composition as disclosed herein can reduce the number of cancer cells; reduce the tumor size or weight; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer. To the extent that a non-naturally occurring chagasin scaffold protein or composition as disclosed herein can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic. In one embodiment, the therapeutically effective amount is a growth inhibitory amount. In another embodiment, the therapeutically effective amount is an amount that extends the survival of a patient. In another embodiment, the therapeutically effective amount is an amount that improves progression free survival of a patient.

(35) As used herein, treatment or treating is an approach for obtaining beneficial or desired results including clinical results. For purposes of this invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods of the invention contemplate any one or more of these aspects of treatment.

(36) A disorder is any condition that would benefit from treatment with a non-naturally occurring chagasin scaffold protein described herein. For example, mammals who suffer from or need prophylaxis against abnormal LRP6 expression or activity or against abnormal VEGF expression or activity. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question. Non-limiting examples of LRP6-related disorders to be treated herein include cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease, as described elsewhere herein. Non-limiting examples of VEGF-related disorders to be treated herein include cancer, ocular disease, inflammatory disease, as described elsewhere herein.

(37) As used herein, by pharmaceutically acceptable or pharmacologically compatible is meant a material that is not biologically or otherwise undesirable, e.g., the material may be incorporated into a pharmaceutical composition administered to a patient without causing any significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the composition in which it is contained. Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration.

(38) The term detecting is intended to include determining the presence or absence of a substance or quantifying the amount of a substance (such as a target ligand). The term thus refers to the use of the materials, compositions, and methods of the present invention for qualitative and quantitative determinations. In general, the particular technique used for detection is not critical for practice of the invention.

(39) For example, detecting according to the invention may include: observing the presence or absence of a target ligand (including, but not limited to, a human low density lipoprotein receptor-related protein 6 (LRP6) polypeptide or a human vascular endothelial growth factor (VEGF) polypeptide); a change in the levels of a target ligand; and/or a change in biological function/activity of a target ligand. In certain embodiments, detecting may include detecting levels of a target ligand (e.g., polypeptide levels of a human LRP6 or human VEGF). Detecting may include quantifying a change (increase or decrease) of any value between 10% and 90%, or of any value between 30% and 60%, or over 100%, when compared to a control. Detecting may include quantifying a change of any value between 2-fold to 10-fold, inclusive, or more e.g., 100-fold.

(40) The word label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the non-naturally occurring chagasin scaffold protein. The label may itself be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.

(41) With regard to the binding of a non-naturally occurring chagasin scaffold protein to a target ligand, the term specific binding or specifically binds to or is specific for a particular target ligand means that binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target. In certain embodiments, the extent of binding of the non-naturally occurring chagasin scaffold protein to a non-target ligand will be less than about 10% of the binding of the non-naturally occurring chagasin scaffold protein to its target ligand as determined by, e.g., fluorescence activated cell sorting (FACS) analysis or radioimmunoprecipitation (RIA). In certain embodiments, a non-naturally occurring chagasin scaffold protein of the present disclosure specifically binds to a target ligand (including, but not limited to, a human low density lipoprotein receptor-related protein 6 (LRP6) or a human vascular endothelial growth factor (VEGF)) with a dissociation constant (Kd) equal to or lower than 100 nM, optionally lower than 10 nM, optionally lower than 1 nM, optionally lower than 0.5 nM, optionally lower than 0.1 nM, optionally lower than 0.01 nM, or optionally lower than 0.005 nM; measured at a temperature of about 4 C., 25 C., 37 C., or 45 C.

(42) Reference to about a value or parameter herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to about a value or parameter herein includes (and describes) aspects that are directed to that value or parameter per se. For example, description referring to about X includes description of X.

(43) It is understood that aspects and embodiments of the invention described herein include comprising, consisting, and consisting essentially of aspects and embodiments.

(44) All references cited herein, including patent applications and publications, are hereby incorporated by reference in their entirety.

(45) Non-Naturally Occurring Chagasin Scaffold Proteins

(46) Chagasin is a natural inhibitor of Clan CA, Family C1 cysteine peptidases (CP), which was identified in the protozoan Trypanosoma cruzi, the causative agent of human Chagas disease (Monteiro et al. (2001) J. Cell Sci. 114:3933-3942; Marin-Neto et al. (2007) Circulation. 115:1101-1108). It is a single 110-residue polypeptide chain with no sequence similarity to other known groups of CP inhibitors and potently inactivates papain-like enzymes through the formation of 1:1 tight-binding complexes. Chagasin-like inhibitors which occur in other protozoa and bacteria have been designated as ICP (Inhibitor of Cysteine Peptidases), and together comprise the chagasin family (Family 142 of Clan JL) (Rigden et al. (2002) Protein Sci. 11, 1971-1977; Sanderson et al. (2003) FEBS Lett 542:12-16; MEROPS database (world wide web at-merops.sanger.ac.uk/).

(47) Chagasin homologs are typically 110-130 amino acids long and do not contain any additional domains. The conserved core structure includes seven predicted -strands (FIG. 1) with one or two more potential -strands on the flanks. Previous fold recognition and modeling experiments convincingly favored an Ig-type domain over other -sandwich structures. Furthermore, comparison of the chagasin sequence with an antibody light-chain variable domain consensus sequence revealed conservation of key residues, including an invariant tryptophan and several neighbors, suggestive of a distant evolutionary relationship.

(48) The solution structures of chagasin and of Leishmania mexicana ICP determined by NMR showed that the molecule has an Ig-like fold and three exposed loop regions (i.e., Loop 2 (L2), Loop 4 (L4), and Loop 6 (L6)), which bear evolutionarily conserved residues, located at one end of the molecule (Salmon D et al. (2006) J. Mol. Biol. 357:1511-1521; Smith et al. (2006) J. Biol. Chem. 281:5821-5828. These three key loops, L2 (residues 28-34), L4 (residues 59-69) and L6 (residues 91-100) contain, respectively: (i) the NPTTG motif; (ii) a conserved region bearing two hydrophobic residues followed by GXGG; and (iii) the RPW/F motif (Salmon D et al. (2006) J. Mol. Biol. 357:1511-1521). Studies of chemical shift perturbations upon chagasin contact with cruzipain identified residues in L2, L4 and L6 as candidates to comprise chagasin's binding-site to target enzymes (Salmon D et al. (2006) J. Mol. Biol. 357:1511-1521). This hypothesis was reinforced by docking of a high resolution crystal structure of chagasin to the high-resolution structure of cruzain (truncated recombinant cruzipain) (Figueiredo da Silva et al. (2006) J. Struct. Biol. 157:416-423).

(49) A sequence alignment of chagasin-like protease inhibitors from different pathogenic bacteria and protozoa is shown in FIG. 1. Residue numbers refer to T. cruzi chagasin. -Strands and 3.sub.10-helix are displayed by arrows and cylinders, respectively, as found in the T. cruzi chagasin NMR structure, and the sequences relative to the -strands are boxed. The positions of the most conserved residues in loops are highlighted in bold and conserved hydrophobic (aromatic and aliphatic) residues are colored yellow. T. cruzi non-conserved residues are highlighted in blue. Complementarity-determining regions (CDR 1-3) in CD8 are indicated. Swiss-Prot accession codes are as follows: chagasin-like ICPs from T. cruzi (Dm28c clone), Q966X9; CL Brenner strain, isoform 1, Q4DH32; CL Brenner strain, isoform 2, Q4DY71); T. brucei (Q868H0), L. mexicana (Q868H1), L. major (Q868G9), E. hystolytica (Q6KCA4), P. aeruginosa (Q9I5G0) and human structural homologue proteins CD8 T-cell surface glycoprotein (P01732), IL-1 R1, interleukine-1 type1 receptor (P14778); Vcam-1, vascular cell adhesion molecule-1 (P19320). Adapted from D Salmon et al., J Mol Biol, 357, 1511-1521, 2006).

(50) Such sequence alignment reveals a high degree of conservation for residues that constitute Loop 2, whereas Loop 4 and Loop 6, which bind more on the edges of the protease active site cleft are only partially conserved (A Ljunggren et al., J Mol Biol 371, 137-153, 2007; S X Wang et al., Structure 15, 535-543, 2007; I Redzynia et al., J Biol Chem 283, 22815-22825, 2008; I Redzynia et al., FEBS J 276, 793-806, 2009). Loop 4 can vary in length from 10 to 21 residues between different organisms and has been found to be quite flexible based on NMR analysis (D Salmon et al., J Mol Biol 357, 1511-1521, 2006; BO Smith et al., J Biol Chem 281, 5821-5828, 2006).

(51) In one aspect, the invention provides a non-naturally occurring chagasin scaffold protein comprising at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin or wild-type chagasin-like cysteine protease inhibitor. The term scaffold refers to the minimal polypeptide framework or sequence motif that is used as the conserved, common sequence in the construction of protein libraries. In between the fixed or conserved residues/positions of the scaffold lie variable and hypervariable positions, e.g., L2, L4, and/or L6. A large diversity of amino acids is provided in the variable regions between the fixed scaffold residues to provide specific binding to a target ligand. A scaffold is typically defined by the conserved residues that are observed in an alignment of a family of sequence-related proteins. Fixed residues may be required for folding or structure, especially if the functions of the aligned proteins are different.

(52) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (Dm28c clone). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (Dm28c clone). In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target ligand bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(53) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1). In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target ligand bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(54) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 2). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 2). In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target ligand bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(55) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from T. brucei. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from T. brucei. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target ligand bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(56) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from L. mexicana. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from L. mexicana. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target ligand bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(57) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from L. major. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from L. major. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(58) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from E. hystolytica. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from E. hystolytica. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(59) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from P. aeruginosa. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from P. aeruginosa. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(60) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type human CD8 T-cell surface glycoprotein. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type human CD8 T-cell surface glycoprotein. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(61) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from human interleukine-1 type 1 receptor (IL-1 R1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from human interleukine-1 type 1 receptor (IL-1 R1). In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(62) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from human vascular cell adhesion molecule-1 (Vcam-1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from human vascular cell adhesion molecule-1 (Vcam-1). In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(63) In certain embodiments, amino acid alterations (such as additions, deletions or substitutions) are introduced into one or more of the beta strands of a non-naturally occurring chagasin scaffold protein to, e.g., improve binding to a target ligand, to bind a different epitope on the same target ligand, or to bind a different target ligand than the target ligand bound by L2, L4, and/or L6. (See, e.g., Diem et al. (2014) Prot Engineer Des & Sel 27, 419-429.)

(64) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises at least at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1) having the amino acid sequence set forth in SEQ ID NO: 1:

(65) TABLE-US-00001 (SEQIDNO:1) MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEG GTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAA GTHAVNLTYMRPWTGPSHDSERFTVYLKAN

(66) Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1) having the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(67) In certain embodiments, L1 of SEQ ID NO: 1 corresponds to amino acids 17-20 of SEQ ID NO: 1. In certain embodiments, L2 of SEQ ID NO: 1 corresponds to amino acids 28-34 of SEQ ID NO: 1. In certain embodiments, L3 of SEQ ID NO: 1 corresponds to amino acids 39-50 of SEQ ID NO: 1. In certain embodiments, L4 of SEQ ID NO: 1 corresponds to amino acids 59-69 of SEQ ID NO: 1. In certain embodiments, L5 of SEQ ID NO: 1 corresponds to amino acids 77-80 of SEQ ID NO: 1. In certain embodiments, L6 of SEQ ID NO: 1 corresponds to amino acids 91-100 of SEQ ID NO: 1.

(68) In certain embodiments, amino acid alterations (such as additions, deletions or substitutions) are introduced into one or more of the beta strands 1-8 of SEQ ID NO: 1 in order to, e.g., improve binding to a target ligand, to bind a different epitope on the same target ligand, or to bind a different target ligand than the target ligand bound by L2, L4, and/or L6. (See, e.g., Diem et al. (2014) Prot Engineer Des & Sel 27, 419-429.) In certain embodiments, beta strand 1 of SEQ ID NO: 1 corresponds to amino acids 3-6 of SEQ ID NO: 1. In certain embodiments, beta strand 2 of SEQ ID NO: 1 corresponds to amino acids 13-16 of SEQ ID NO: 1. In certain embodiments, beta strand 3 of SEQ ID NO: 1 corresponds to amino acids 21-26 of SEQ ID NO: 1. In certain embodiments, beta strand 4 of SEQ ID NO: 1 corresponds to amino acids 34-38 of SEQ ID NO: 1. In certain embodiments, beta strand 5 of SEQ ID NO: 1 corresponds to amino acids 51-58 of SEQ ID NO: 1. In certain embodiments, beta strand 6 of SEQ ID NO: 1 corresponds to amino acids 70-76 of SEQ ID NO: 1. In certain embodiments, beta strand 7 of SEQ ID NO: 1 corresponds to amino acids 81-90 of SEQ ID NO: 1. In certain embodiments, beta strand 8 of SEQ ID NO: 1 corresponds to amino acids 101-109 of SEQ ID NO: 1.

(69) In certain embodiments, Loop 2 (L2) of SEQ ID NO: 1 is at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13 or at least 14 amino acids in length. In certain embodiments, L2 of SEQ ID NO: 1 comprises the amino acid sequence X.sub.5-8-GF (SEQ ID NO: 151), wherein X represents any amino acid. In certain embodiments, L2 of SEQ ID NO: 1 comprises the amino acid sequence SNX.sub.3-6-GF (SEQ ID NO: 152), wherein X represents any amino acid. In certain embodiments, Loop 4 (L4) of SEQ ID NO: 1 is at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19 amino acids in length. In certain embodiments, L4 of SEQ ID NO: 1 comprises the amino acid sequence X.sub.7-15-GAGG (SEQ ID NO: 153), wherein X represents any amino acid. In certain embodiments, Loop 6 (L6) of SEQ ID NO: 1 is at least 8, at least 9, or at least 10 amino acids in length. In certain embodiments, Loop 6 (L6) of SEQ ID NO: 1 comprises the amino acid sequence X.sub.3-12 (SEQ ID NO: 154), wherein X represents any amino acid. In certain embodiments, Loop 6 (L6) of SEQ ID NO: 1 comprises the amino acid sequence X.sub.10 (SEQ ID NO: 106), wherein X represents any amino acid.

(70) In certain embodiments, the non-naturally occurring chagasin scaffold protein comprises an amino acid sequence set forth in SEQ ID NO: 2:

(71) TABLE-US-00002 (SEQIDNO:2) MSHKVTKAHNGATLTVAVGELVEIQLP-X.sub.5-8-GFAWYFEGGTKE SPNESMFTVENKYFP-X.sub.7-15-GAGGTEHFHVTVKAAGTHAVNLTY MX.sub.10ERFTVYLKAN

(72) In certain embodiments, the non-naturally occurring chagasin scaffold protein specifically binds to a target ligand. In certain embodiments, the target ligand is a protein, a nucleic acid, a polysaccharide, a lipopolysaccharide, a lipid, a phospholipid. In certain embodiments, the non-naturally occurring chagasin scaffold protein binds to a cell surface protein, a soluble protein, a mammalian protein, a viral protein, a bacterial protein, a protein associated with ocular disease, a protein associated with cancer, a protein associated with inflammation, a protein associated with bone disease, a protein associated with neurodegenerative disease, or a therapeutic protein. In certain embodiments, the non-naturally occurring chagasin scaffold protein specifically binds low-density lipoprotein receptor-related protein 6 (LRP6), such as a human LRP6. In certain embodiments, the non-naturally occurring chagasin scaffold protein specifically binds vascular endothelial growth factor (VEGF), such as a human VEGF. In certain embodiments, the VEGF is a VEGF-A.

(73) As described elsewhere herein, a non-naturally occurring chagasin scaffold protein can be generated via genetic engineering. Accordingly, provided by the invention is a non-naturally occurring chagasin scaffold protein obtained by genetically engineering any one of the wild-type chagasins or wild-type chagasin-like cysteine protease inhibitors described herein. Alternatively, a non-naturally occurring chagasin scaffold protein can be generated via chemical peptide synthesis, as described elsewhere herein. Thus, in certain embodiments, the invention provides a non-naturally occurring chagasin scaffold protein obtained via synthesis, e.g., solid phase peptide syntheses, liquid phase peptide synthesis, etc.

(74) In certain embodiments, the invention provides a nucleic acid molecule encoding a non-naturally occurring chagasin scaffold protein. Such a nucleic acid molecule can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof. The DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.

(75) Isolated nucleic acid molecules of the present invention can include, but are not limited to, those encoding a chagasin scaffold protein or a fragment thereof. In some embodiments, the isolated nucleic acids comprise additional, non-coding sequences, including but not limited to, noncoding 5 and 3 sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (for example, ribosome binding and stability of mRNA). In some embodiments, the isolated nucleic acids comprise an additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities. Thus, the sequence encoding a protein scaffold can be fused to a marker sequence, such as a sequence encoding a peptide that facilitates purification of the fused chagasin scaffold protein, a sequence encoding a peptide that facilitates entry into the cell (i.e., a cell-permeability peptide), a peptide that facilitates the secretion of a non-naturally occurring chagasin scaffold protein from a cell and/or a peptide that facilitates the localization of a non-naturally occurring chagasin scaffold protein to, e.g., the endoplasmic reticulum, the golgi apparatus, to endosomes, etc.

(76) In certain embodiments, a nucleic acid encoding a non-naturally occurring chagasin scaffold protein provided herein is transiently transfected in a cell under conditions that allow expression of the non-naturally occurring chagasin scaffold protein and binding of the non-naturally occurring chagasin scaffold protein to a target ligand in the cell.

(77) In certain embodiments, provided is an expression vector comprising an isolated nucleic acid described herein. In certain embodiments, provided is a host cell comprising an expression vector comprising an isolated nucleic acid described herein. In certain embodiments, a host cell is cultured under conditions that allow the expression of the non-naturally occurring chagasin scaffold protein. In certain embodiments, the non-naturally occurring chagasin scaffold protein is expressed in order to identify the intracellular target ligand to which the non-naturally occurring chagasin scaffold protein binds.

(78) The non-naturally occurring chagasin scaffold proteins provided herein can be used as monospecific in monomeric form or as bi- or multi-specific (for different target ligands or different epitopes on the same target ligand) in multimer form. The attachments may be covalent or non-covalent. In certain embodiments, a dimeric bispecific non-naturally occurring chagasin scaffold protein has one subunit with specificity for a first target ligand or epitope and a second subunit with specificity for a second target ligand or epitope. Non-naturally occurring chagasin scaffold protein subunits can be joined in a variety of conformations that can increase the valency and thus the avidity of binding to a target ligand.

(79) Non-Naturally Occurring Chagasin Scaffold Protein Libraries

(80) Provided herein are polypeptide display libraries comprising a plurality of non-naturally occurring chagasin scaffold proteins described herein. Such polypeptide display libraries can be screened to select and/or evolve binding proteins with desired properties for a wide variety of utilities, including but not limited to therapeutic, prophylactic, veterinary, diagnostic, reagent or material applications.

(81) In certain embodiments, the non-naturally occurring chagasin scaffold proteins in the polypeptide display library have at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 99% amino acid homology to the sequence of a naturally occurring chagasin or chagasin-like protease inhibitor described herein.

(82) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that comprise randomized L2, L4, and/or L6 loop region sequences that vary by deletion, substitution or addition by at least one amino acid from the corresponding loop sequences in a naturally occurring chagasin or chagasin-like protease inhibitor.

(83) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin or wild-type chagasin-like cysteine protease inhibitor. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin or wild-type chagasin-like cysteine protease inhibitor.

(84) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (Dm28c clone). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (Dm28c clone).

(85) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1).

(86) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 2). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 2).

(87) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from T. brucei. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from T. brucei.

(88) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from L. mexicana. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from L. mexicana.

(89) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from L. major. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from L. major.

(90) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from E. hystolytica. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from E. hystolytica.

(91) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from P. aeruginosa. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from P. aeruginosa.

(92) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type human CD8 T-cell surface glycoprotein. Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type human CD8 T-cell surface glycoprotein.

(93) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from human interleukine-1 type 1 receptor (IL-1 R1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from human interleukine-1 type 1 receptor (IL-1 R1).

(94) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like inhibitor from human vascular cell adhesion molecule-1 (Vcam-1). Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a wild-type chagasin-like inhibitor from human vascular cell adhesion molecule-1 (Vcam-1).

(95) In certain embodiments, amino acid alterations (such as additions, deletions or substitutions) are introduced into one or more of the beta strands of a non-naturally occurring chagasin scaffold protein to, e.g., improve binding to a target ligand, to bind a different epitope on the same target ligand, or to bind a different target ligand than the target ligand bound by L2, L4, and/or L6. (See, e.g., Diem et al. (2014) Prot Engineer Des & Sel 27, 419-429.)

(96) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise at least at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than 10 (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1) having the amino acid sequence set forth in SEQ ID NO: 1:

(97) TABLE-US-00003 (SEQIDNO:1) MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEG GTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAA GTHAVNLTYMRPWTGPSHDSERFTVYLKAN

(98) Alternatively or additionally, the non-naturally occurring chagasin scaffold protein comprises at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more than ten (e.g., at least 11, at least 12, at least 13, at least 14, or at least 15) amino acid alterations in Loop 1 (L1), Loop3 (L3), and/or Loop 5 (L5), with reference to a with reference to a wild-type chagasin from T. cruzi (CL Brenner strain, isoform 1) having the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, amino acid alterations are introduced into L1, L3, and/or L5, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target than the target bound by L2, L4, and/or L6.

(99) In certain embodiments, L1 of SEQ ID NO: 1 corresponds to amino acids 17-20 of SEQ ID NO: 1. In certain embodiments, L2 of SEQ ID NO: 1 corresponds to amino acids 28-34 of SEQ ID NO: 1. In certain embodiments, L3 of SEQ ID NO: 1 corresponds to amino acids 39-50 of SEQ ID NO: 1. In certain embodiments, L4 of SEQ ID NO: 1 corresponds to amino acids 59-69 of SEQ ID NO: 1. In certain embodiments, L5 of SEQ ID NO: 1 corresponds to amino acids 77-80 of SEQ ID NO: 1. In certain embodiments, L6 of SEQ ID NO: 1 corresponds to amino acids 91-100 of SEQ ID NO: 1.

(100) In certain embodiments, amino acid alterations (such as additions, deletions or substitutions) are introduced into one or more of the beta strands 1-8 of SEQ ID NO: 1 in order to, e.g., improve binding to a target ligand, to bind a different epitope on the same target ligand, or to bind a different target ligand than the target ligand bound by L2, L4, and/or L6. (See, e.g., Diem et al. (2014) Prot Engineer Des & Sel 27, 419-429.) In certain embodiments, beta strand 1 of SEQ ID NO: 1 corresponds to amino acids 3-6 of SEQ ID NO: 1. In certain embodiments, beta strand 2 of SEQ ID NO: 1 corresponds to amino acids 13-16 of SEQ ID NO: 1. In certain embodiments, beta strand 3 of SEQ ID NO: 1 corresponds to amino acids 21-26 of SEQ ID NO: 1. In certain embodiments, beta strand 4 of SEQ ID NO: 1 corresponds to amino acids 34-38 of SEQ ID NO: 1. In certain embodiments, beta strand 5 of SEQ ID NO: 1 corresponds to amino acids 51-58 of SEQ ID NO: 1. In certain embodiments, beta strand 6 of SEQ ID NO: 1 corresponds to amino acids 70-76 of SEQ ID NO: 1. In certain embodiments, beta strand 7 of SEQ ID NO: 1 corresponds to amino acids 81-90 of SEQ ID NO: 1. In certain embodiments, beta strand 8 of SEQ ID NO: 1 corresponds to amino acids 101-109 of SEQ ID NO: 1.

(101) In certain embodiments, Loop 2 (L2) of SEQ ID NO: 1 is at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13 or at least 14 amino acids in length. In certain embodiments, L2 of SEQ ID NO: 1 comprises the amino acid sequence X.sub.5-8-GF (SEQ ID NO: 151), wherein X represents any amino acid. In certain embodiments, Loop 4 (L4) of SEQ ID NO: 1 is at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, or at least 19 amino acids in length. In certain embodiments, L4 of SEQ ID NO: 1 comprises the amino acid sequence X.sub.7-15-GAGG (SEQ ID NO: 153), wherein X represents any amino acid. In certain embodiments, Loop 6 (L6) of SEQ ID NO: 1 is at least 8, at least 9, or at least 10 amino acids in length. In certain embodiments, Loop 6 (L6) of SEQ ID NO: 1 comprises the amino acid sequence X.sub.10 (SEQ ID NO: 106), wherein X represents any amino acid.

(102) In certain embodiments, the polypeptide display library comprises non-naturally occurring chagasin scaffold proteins that each comprise an amino acid sequence set forth in SEQ ID NO: 2:

(103) TABLE-US-00004 (SEQIDNO:2) MSHKVTKAHNGATLTVAVGELVEIQLP-X.sub.5-8-GFAWYFEGGTKE SPNESMFTVENKYFP-X.sub.7-15-GAGGTEHFHVTVKAAGTHAVNLTY MX.sub.10ERFTVYLKAN

(104) In one embodiment, provided herein are non-naturally occurring chagasin scaffold protein libraries comprising at least 2, 3, 4, 5, 10, 30, 100, 250, 500, 750, 1000, 2500, 5000, 7500, 10000, 25000, 50000, 75000, 100000, 250000, 500000, 750000, 1000000, 2500000, 5000000, 7500000, 10000000, or more than 10000000 chagasin scaffold proteins with unique amino acid sequences, including any range in between these values. In certain embodiments, the non-naturally occurring chagasin scaffold library has a sequence diversity of about 2, about 5, about 10, about 50, about 100, about 250, about 500, about 750, about 10.sup.3, about 10.sup.4, about 10.sup.5, about 10.sup.6, about 10.sup.7, about 10.sup.8, about 10.sup.9, about 10.sup.10, about 10.sup.11, about 10.sup.12, about 10.sup.13, about 10.sup.14, or more than about 10.sup.14 (such as about 10.sup.15 or about 10.sup.16), including any range in between these values.

(105) In certain embodiments, a non-naturally occurring chagasin scaffold protein library is generated via genetic engineering. A variety of methods for mutagenesis and subsequent library construction have been previously described (along with appropriate methods for screening or selection). Such mutagenesis methods include, but are not limited to, e.g., error-prone PCR, loop shuffling, or oligonucleotide-directed mutagenesis, random nucleotide insertion or other methods prior to recombination. Further details regarding these methods are described in, e.g., Abou-Nadler et al. (2010) Bioengineered Bugs 1, 337-340; Firth et al. (2005) Bioinformatics 21, 3314-3315; Cirino et al. (2003) Methods Mol Biol 231, 3-9; Pirakitikulr (2010) Protein Sci 19, 2336-2346; Steffens et al. (2007) J. Biomol Tech 18, 147-149; and others. Accordingly, in certain embodiments, provided is a non-naturally occurring chagasin scaffold protein library generated via genetic engineering techniques.

(106) In certain embodiments, a non-naturally occurring chagasin scaffold protein library is generated via in vitro translation. Briefly, in vitro translation entails cloning the protein-coding sequence(s) into a vector containing a promoter, producing mRNA by transcribing the cloned sequence(s) with an RNA polymerase, and synthesizing the protein by translation of this mRNA in vitro, e.g., using a cell-free extract. A desired mutant protein can be generated simply by altering the cloned protein-coding sequence. Many mRNAs can be translated efficiently in wheat germ extracts or in rabbit reticulocyte lysates. Further details regarding in vitro translation are described in, e.g., Hope et al. (1985) Cell 43, 177-188; Hope et al. (1986) Cell 46, 885-894; Hope et al. (1987) EMBO J. 6, 2781-2784; Hope et al. (1988) Nature 333, 635-640; and Melton et al. (1984) Nucl. Acids Res. 12, 7057-7070.

(107) Accordingly, provided are a plurality of nucleic acid molecules encoding a polypeptide display library described herein. An expression vector operably linked to the plurality of nucleic acid molecules is also provided by the invention.

(108) In certain embodiments, a non-naturally occurring chagasin scaffold protein library is generated via chemical synthesis. In certain embodiments, chemically synthesized L2, L4, and/or L6 peptides onto a chagasin framework to generate a non-naturally occurring chagasin scaffold protein library. Methods of solid phase and liquid phase peptide synthesis are well known in the art and described in detail in, e.g., Methods of Molecular Biology, 35, Peptide Synthesis Protocols, (M. W. Pennington and B. M. Dunn Eds), Springer, 1994; Welsch et al. (2010) Curr Opin Chem Biol 14, 1-15; Methods of Enzymology, 289, Solid Phase Peptide Synthesis, (G. B. Fields Ed.), Academic Press, 1997; Chemical Approaches to the Synthesis of Peptides and Proteins, (P. Lloyd-Williams, F. Albericio, and E. Giralt Eds), CRC Press, 1997; Fmoc Solid Phase Peptide Synthesis, A Practical Approach, (W. C. Chan, P. D. White Eds), Oxford University Press, 2000; Solid Phase Synthesis, A Practical Guide, (S. F. Kates, F Albericio Eds), Marcel Dekker, 2000; P. Seneci, Solid-Phase Synthesis and Combinatorial Technologies, John Wiley & Sons, 2000; Synthesis of Peptides and Peptidomimetics (M. Goodman, Editor-in-chief, A. Felix, L. Moroder, C. Tmiolo Eds), Thieme, 2002; N. L. Benoiton, Chemistry of Peptide Synthesis, CRC Press, 2005; Methods in Molecular Biology, 298, Peptide Synthesis and Applications, (J. Howl Ed) Humana Press, 2005; and Amino Acids, Peptides and Proteins in Organic Chemistry, Volume 3, Building Blocks, Catalysts and Coupling Chemistry, (A. B. Hughs, Ed.) Wiley-VCH, 2011. Accordingly, in certain embodiments, provided is a non-naturally occurring chagasin scaffold protein library generated via chemical synthesis techniques.

(109) In certain embodiments, the non-naturally occurring chagasin scaffold protein library comprises a display library. In certain embodiments, the display library is a phage display library, a phagemid display library, a virus display library, a bacterial display library, yeast display library, a gt11 library, a CIS display library, and in vitro compartmentalization library, or a ribosome display library. Methods of making and screening such display libraries are well known to those of skill in the art and described in, e.g., Molek et al. (2011) Molecules 16, 857-887; Boder et al., (1997) Nat Biotechnol 15, 553-557; Scott et al. (1990) Science 249, 386-390; Brisette et al. (2007) Methods Mol Biol 383, 203-213; Kenrick et al. (2010) Protein Eng Des Sel 23, 9-17; Freudl et al. (1986) J Mol Biol 188, 491-494; Getz et al. (2012) Methods Enzymol 503, 75-97; Smith et al. (2014) Curr Drug Discov Technol 11, 48-55; Hanes, et al. (1997) Proc Natl Acad Sci USA 94, 4937-4942; Lipovsek et al., (2004) J Imm Methods 290, 51-67; Ullman et al. (2011) Brief. Funct. Genomics, 10, 125-134; Odegrip et al. (2004) Proc Natl Acad Sci USA 101, 2806-2810; and Miller et al. (2006) Nat Methods 3, 561-570.

(110) In certain embodiments, the non-naturally occurring chagasin scaffold protein library comprises an RNA-protein fusion library generated, for example, by the techniques described in Szostak et al., U.S. Pat. Nos. 6,258,558, 6,261,804, 5,643,768, and 5,658,754. In certain embodiments, the non-naturally occurring chagasin scaffold protein library comprises a DNA-protein library, as described, for example, in U.S. Pat. No. 6,416,950.

(111) Directed Evolution of Non-Naturally Occurring Chagasin Scaffold Proteins

(112) Also provided herein is a method of obtaining a non-naturally occurring chagasin scaffold protein that specifically binds a target ligand (such as a polypeptide, a nucleic acid, a polysaccharide, a lipid, a phospholipid, a lipopolysaccharide, a small molecule, or any target ligand that can be bound by an antibody). In certain embodiments, the method comprises a) contacting a target ligand with a library of non-naturally occurring chagasin scaffold proteins (such as a library described herein) under conditions that allow a non-naturally occurring chagasin scaffold protein: target ligand complex to form, (b) detecting the formation of the non-naturally occurring chagasin scaffold protein: target ligand complex, and (c) obtaining from the complex the non-naturally occurring chagasin scaffold protein that specifically binds the target ligand.

(113) In certain embodiments, provide is a complex comprising a non-naturally occurring chagasin scaffold protein and a target ligand (i.e., a non-naturally occurring chagasin scaffold protein: target ligand complex). In certain embodiments, provided is a non-naturally occurring chagasin scaffold protein capable of binding to a target ligand. In certain embodiments, the method further comprises (d) determining the nucleic acid sequence of the non-naturally occurring chagasin scaffold protein that specifically binds the target ligand.

(114) In certain embodiments, a non-naturally occurring chagasin scaffold protein that specifically binds a target ligand is subject to affinity maturation. In this process, a specific binding protein is subject to a scheme that selects for increased affinity for a specific target (see Wu et al. (1998) Proc Natl Acad Sci USA. 95, 6037-42). In certain embodiments, a non-naturally occurring chagasin scaffold protein that specifically binds a target ligand is further randomized after identification from a library screen. For example, in certain embodiments, the method of obtaining a non-naturally occurring chagasin scaffold protein that specifically binds a target ligand further comprises (e) randomizing L2, L4, and/or L6 of the non-naturally occurring chagasin scaffold protein obtained from the non-naturally occurring chagasin scaffold protein: target ligand complex identified previously to generate further randomized non-naturally occurring chagasin scaffold proteins, (f) contacting the target ligand with the further randomized non-naturally occurring chagasin scaffold proteins, (g) detecting the formation of the further randomized non-naturally occurring chagasin scaffold protein: target ligand complex, and (h) obtaining from the complex the further randomized non-naturally occurring chagasin scaffold protein that specifically binds the target ligand. In certain embodiments, the method further comprises (i) determining the nucleic acid sequence of the non-naturally occurring chagasin scaffold protein that specifically binds the target ligand.

(115) In certain embodiments, the further randomized non-naturally occurring chagasin scaffold proteins comprise at least one or at least two randomized loops which were not previously randomized in the first library. Multiple rounds of randomization, screening and selection can be performed until non-naturally occurring chagasin scaffold protein(s) having sufficient affinity for the target ligand are obtained. Thus, in certain embodiments, steps (e)-(h) or steps (e)-(i) are repeated one, two, three, four, five, six, seven, eight, nine, ten, or more than ten times in order to identify the non-naturally occurring chagasin scaffold protein that specifically binds a target ligand.

(116) In certain embodiments, the non-naturally occurring chagasin scaffold protein that has undergone at least two, three, four, five, six, seven, eight, nine, ten, or more than ten rounds of randomization, screening and selection binds the target ligand with an affinity that is at least as high as that of the non-naturally occurring chagasin scaffold protein that has undergone one round of randomization, screening, and selection. In certain embodiments, the non-naturally occurring chagasin scaffold protein that has undergone at least two, three, four, five, six, seven, eight, nine, ten, or more than ten rounds of randomization, screening and selection binds the target ligand with an affinity that is higher than that of the non-naturally occurring chagasin scaffold protein that has undergone one round of randomization, screening, and selection.

(117) A library of non-naturally occurring chagasin scaffold proteins described herein may be screened by any technique known in the art for evolving new or improved binding proteins that specifically bind a target ligand. In certain embodiments, the target ligand is immobilized on a solid support (such as a column resin or microtiter plate well), and the target ligand is contacted with a library of candidate non-naturally occurring chagasin scaffold proteins (such as any library described herein). Selection techniques can be, for example, phage display (Smith (1985) Science 228, 1315-1317), mRNA display (Wilson et al. (2001) Proc Natl Acad Sci USA 98: 3750-3755) bacterial display (Georgiou, et al. (1997) Nat Biotechnol 15:29-34.), yeast display (Boder and Wittrup (1997) Nat. Biotechnol. 15:553-5577) or ribosome display (Hanes and Pluckthun (1997) Proc Natl Acad Sci USA 94:4937-4942 and WO2008/068637).

(118) In certain embodiments, the library of non-naturally occurring chagasin scaffold proteins is a phage display library. In certain embodiments, provided is a phage particle displaying a non-naturally occurring chagasin scaffold protein described herein. In certain embodiments, provided is a phage particle displaying a non-naturally occurring chagasin scaffold protein described herein capable of binding to a target ligand.

(119) Phage display is a technique by which a plurality non-naturally occurring chagasin scaffold protein variants are displayed as fusion proteins to the coat protein on the surface of bacteriophage particles (Smith, G. P. (1985) Science. 228:1315-7; Scott, J. K. and Smith, G. P. (1990) Science 249: 386; Sergeeva, A., et al. (2006) Adv. Drug Deliv. Rev. 58:1622-54). The utility of phage display lies in the fact that large libraries of selectively randomized protein variants (or randomly cloned cDNAs) can be rapidly and efficiently sorted for those sequences that bind to a target ligand with high affinity.

(120) Display of peptides (Cwirla, S. E. et al. (1990) Proc. Natl. Acad. Sci. USA, 87:6378) or protein (Lowman, H. B. et al. (1991) Biochemistry, 30:10832; Clackson, T. et al. (1991) Nature, 352:624; Marks, J. D. et al. (1991), J. Mol. Biol., 222:581; Kang, A. S. et al. (1991) Proc. Natl. Acad. Sci. USA, 88:8363) libraries on phage have been used for screening millions of polypeptides or oligopeptides for ones with specific binding properties (Smith, G. P. (1991) Current Opin. Biotechnol., 2:668; Wu et al. (1998) Proc Natl Acad Sci USA. May 95, 6037-42). Polyvalent phage display methods have been used for displaying small random peptides and small proteins through fusions to either gene III or gene VIII of filamentous phage. (Wells and Lowman, Curr. Opin. Struct. Biol., 3:355-362 (1992), and references cited therein.) In a monovalent phage display, a protein or peptide library is fused to a gene III or a portion thereof, and expressed at low levels in the presence of wild type gene III protein so that phage particles display one copy or none of the fusion proteins. Avidity effects are reduced relative to polyvalent phage so that sorting is on the basis of intrinsic ligand affinity, and phagemid vectors are used, which simplify DNA manipulations. (Lowman and Wells, Methods: A companion to Methods in Enzymology, 3:205-0216 (1991).)

(121) Sorting phage libraries of non-naturally occurring chagasin scaffold proteins entails the construction and propagation of a large number of variants, a procedure for affinity purification using the target ligand, and a means of evaluating the results of binding enrichments (see for example, U.S. Pat. Nos. 5,223,409, 5,403,484, 5,571,689, and 5,663,143).

(122) Most phage display methods use filamentous phage (such as M13 phage). Lambdoid phage display systems (see WO1995/34683, U.S. Pat. No. 5,627,024), T4 phage display systems (Ren et al. (1998) Gene 215:439; Zhu et al. (1998) Cancer Research, 58:3209-3214; Jiang et al., (1997) Infection & Immunity, 65:4770-4777; Ren et al. (1997) Gene, 195:303-311; Ren (1996) Protein Sci., 5:1833; Efimov et al. (1995) Virus Genes, 10:173) and T7 phage display systems (Smith and Scott (1993) Methods in Enzymology, 217:228-257; U.S. Pat. No. 5,766,905) are also known.

(123) Many other improvements and variations of the basic phage display concept have now been developed. These improvements enhance the ability of display systems to screen peptide libraries for binding to selected target ligands and to display functional proteins with the potential of screening these proteins for desired properties. Combinatorial reaction devices for phage display reactions have been developed (WO 1998/14277) and phage display libraries have been used to analyze and control bimolecular interactions (WO 1998/20169; WO 1998/20159) and properties of constrained helical peptides (WO 1998/20036). WO 1997/35196 describes a method of isolating an affinity ligand in which a phage display library is contacted with one solution in which the ligand will bind to a target ligand and a second solution in which the affinity ligand will not bind to the target ligand, to selectively isolate binding ligands. WO 1997/46251 describes a method of biopanning a random phage display library with an affinity purified antibody and then isolating binding phage, followed by a micropanning process using microplate wells to isolate high affinity binding phage. Such method can be applied to the non-naturally occurring chagasin scaffold proteins disclosed herein. The use of Staphylococcus aureus protein A as an affinity tag has also been reported (Li et al. (1998) Mol Biotech. 9:187). WO 1997/47314 describes the use of substrate subtraction libraries to distinguish enzyme specificities using a combinatorial library which may be a phage display library. Additional methods of selecting specific binding proteins are described in U.S. Pat. Nos. 5,498,538, 5,432,018, and WO 1998/15833. Methods of generating peptide libraries and screening these libraries are also disclosed in U.S. Pat. Nos. 5,723,286, 5,432,018, 5,580,717, 5,427,908, 5,498,530, 5,770,434, 5,734,018, 5,698,426, 5,763,192, and 5,723,323.

(124) In certain embodiments, non-naturally occurring chagasin scaffold proteins produced via directed evolution can be used in the identification and/or validation of disease-causing targets (such as target proteins) or lead therapeutic candidates. For example, a non-naturally occurring chagasin scaffold protein engineered to bind a target ligand of interest can be used to inhibit the expression of the target in vitro (such as in cell culture) or in vivo (such as in an animal model) so that, e.g., the physiological role of the target ligand can be characterized or confirmed, or, e.g., the disease association and therapeutic potential of the target ligand can be investigated and/or validated. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is screened for binding to a human target ligand. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is screened for cross-reactivity to a mouse target ligand. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is screened for effects on in vitro functions (e.g., inhibition of ligand/receptor binding). In certain embodiments, the function and binding of the engineered non-naturally occurring chagasin scaffold protein is investigated in cell-based assays. In certain embodiments, the binding affinity of the engineered non-naturally occurring chagasin scaffold protein is determined. In certain embodiments, the epitope of the target ligand to which the engineered non-naturally occurring chagasin scaffold protein binds is mapped. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to determine the distribution of the target ligand in the body. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to determine the subcellular localization of the target ligand. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to profile the expression of the target ligand in diseased tissue and non-diseased tissue and/or to verify the expression of the target ligand in diseased tissue. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to perform pre-clinical efficacy studies. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to perform toxicity studies. In certain embodiments, the engineered non-naturally occurring chagasin scaffold protein is used to perform pharmacokinetic and/or pharmacodynamic studies. Further details regarding target validation are described in, e.g., Carter et al. (2004) Endocr Relat Cancer 11, 659-687; van Beijnum et al. (2002) Int J Cancer 101, 118-127; Verheesen et al. (2006) Biochim et Biophys Acta 1764, 1307-1319; Shih (2012) Development of Antibody-Based Therapeutics Springer, pp. 9-32; and Wise et al. (2002) Drug Disc Today 7, 235-246.

(125) Non-Naturally Occurring Chagasin Scaffold Proteins that Specifically Bind Human Low Density Lipoprotein Receptor (LDL)-Related Protein 6 (LRP6)

(126) LDL receptors are transmembrane cell surface proteins involved in receptor-mediated endocytosis of lipoprotein and protein ligands. Human LDL receptor-related protein 6 (LRP6) (Accession Nos: NM_002336 (mRNA) and NP_002327 (protein); UniProtKB: 075581) functions as a receptor or, with Frizzled, a co-receptor for Wnt and thereby transmits the canonical Wnt/beta-catenin signaling cascade (Katoh et al. (2007) Clin Cancer Res 13:4042-4045). Through its interaction with the Wnt/beta-catenin signaling cascade, LRP6 plays a role in the regulation of cell differentiation, proliferation, and migration, and in the development of many cancer types (Li et al. (2004) Oncogene 23:9129-9135; Tung et al. (2012) PLoS ONE 7(5): e36565. doi:10.1371/journal.pone.0036565; Liu et al. (2010) Proc Natl Acad Sci USA 107:5136-5141).

(127) Wnt signaling is involved in many biological pathways. With respect to diseases it is involved with cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease. This inhibition of Wnt signaling by blockade of LRP6 may have a wide range of therapeutic utility. Bone loss is a serious medical problem, not only during postmenopausal osteoporosis, but also in rheumatoid arthritis. Bone is degraded in multiple myeloma and in bone metastases. Therapeutic strategies aimed at strengthening bone, fracture prevention, or restoration of damaged bone are therefore of very high interest (Kawai et al. (2011) Nat. Rev. Drug Discov. 10, 141-156; Mason and Williams (2010) J. Osteoporosis, vol. 2010, Article ID 460120, 9 pages; doi:10.4061/2010/460120). The Wnt pathway inhibitors DKK1 and SOST, because of their roles in suppressing new bone formation, are considered highly promising therapeutic targets; antibodies with neutralizing the function of SOST show significant preclinical activity (Ominsky et al. (2010) J. Bone Miner. Res. 25, 948-959) and are now in human clinical trials (Padhi et al. (2011) J. Bone Miner. Res. 26, 19-26.

(128) Misregulated Wnt signaling is implicated in diseases ranging from osteoporosis to cancer (Clevers (2006) Cell 127:469-80; MacDonald et al. 2009. Dev Cell 17: 9-26; Nusse (2008) Cell Res 18:523-7; Polakis (2007) Curr Opin Genet Dev 17:45-51). This list has expanded to include metabolic disorders (Mani et al. (2007) Science 315:1278-82 and neurodegeneration (Caricasole et al. (2004) J Neurosci 24:6021-7; De Ferrari et al. (2007) Proc Natl Acad Sci USA 104: 9434-9). An especially clear link exists between mutations of the protein adenomatous polyposis coli (APC), which prevent effective regulation of -catenin levels, and colorectal cancers (Polakis (2007) Curr Opin Genet Dev 17:45-51). Also of particular note is the strong genetic relationship between LRP5 and bone homeostasis. Loss-of-function mutations in LRP5 cause the autosomal recessive disorder osteoporosispseudoglioma syndrome (OPPG), characterized by low bone mass, ocular defects and a predisposition to fractures (Gong et al. (2001) Cell 107: 513-23.

(129) A non-naturally occurring chagasin scaffold protein specific for human LRP6 described herein binds human LRP6 with sufficient affinity and specificity. Preferably, such non-naturally occurring chagasin scaffold protein can be used as a therapeutic agent in targeting and interfering with diseases or conditions wherein LRP6 activity is involved. A non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 will usually not bind to other LRP proteins, such as LRP1, LRP1B, LRP2, LRP3, LRP4, LRP5, LRP8, LRP10, LRP11, and LRP12.

(130) In some embodiments, provided herein is a non-naturally occurring chagasin scaffold protein that specifically binds to the same epitope as a second non-naturally occurring chagasin scaffold protein that binds human low density lipoprotein receptor-related protein 6 (LRP6), wherein the second non-naturally occurring chagasin scaffold protein that binds human LRP6 comprises an L2 that comprises the amino acid sequence comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2. Also provided herein is an antibody that specifically binds to the same epitope as a non-naturally occurring chagasin scaffold protein that binds human low density lipoprotein receptor-related protein 6 (LRP6), wherein the non-naturally occurring chagasin scaffold protein that binds human LRP6 comprises an comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.

(131) Provided is a non-naturally occurring chagasin scaffold protein that specifically binds human low density lipoprotein receptor-related protein 6 (LRP6), wherein the non-naturally occurring chagasin scaffold protein competes for binding with a second non-naturally occurring chagasin scaffold protein that binds human LRP6, wherein the second non-naturally occurring chagasin scaffold protein that binds human LRP6 comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.

(132) In certain embodiment of (or as applied to) any of the embodiments above the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.

(133) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 binds the same epitope of human LRP6 bound by a second non-naturally occurring chagasin scaffold protein comprising an L2 that comprises the amino acid sequence S-N/S-P/N-Q/T/V/S/A-T/D/C-GF (SEQ ID NO: 6), an L4 that comprises the amino acid sequence P-S/Y-N-N/K-V/I-K/R-G-V/I/L-PGFGAGG (SEQ ID NO: 10), PSN-S/Y-TK-H/R-GAGG (SEQ ID NO: 90), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence G/R/P/S-P/R-W/S/V/Y/E-T/K/Y-G-A/P/S-S/Y/T-Q/D/L/H/K-E/D/V-P/S/M/E (SEQ ID NO: 14), with reference to SEQ ID NO: 2.

(134) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 competitively inhibits the binding of a competing molecule to human LRP6. In certain embodiments, the competing molecule is an anti-LRP6 antibody. In certain embodiments, the competing molecule is a second non-naturally occurring chagasin scaffold protein that binds to human LRP6.

(135) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human LRP6, wherein the second non-naturally occurring chagasin scaffold protein comprises an L2 that comprises the amino acid sequence S-N/S-P/N-Q/T/V/S/A-T/D/C-GF (SEQ ID NO: 6), an L4 that comprises the amino acid sequence P-S/Y-N-N/K-V/I-K/R-G-V/I/L-PGFGAGG (SEQ ID NO: 10), PSN-S/Y-TK-H/R-GAGG (SEQ ID NO: 90), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence G/R/P/S-P/R-W/S/V/Y/E-T/K/Y-G-A/P/S-S/Y/T-Q/D/L/H/K-E/D/V-P/S/M/E (SEQ ID NO: 14), with reference to SEQ ID NO: 2. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 and competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human LRP6 comprises an L2 that comprises the amino acid sequence S-N/S-P/N-Q/T/V/S/A-T/D/C-GF (SEQ ID NO: 6), an L4 that comprises the amino acid sequence P-S/Y-N-N/K-V/I-K/R-G-V/I/L-PGFGAGG (SEQ ID NO: 10), PSN-S/Y-TK-H/R-GAGG (SEQ ID NO: 90), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence G/R/P/S-P/R-W/S/V/Y/E-T/K/Y-G-A/P/S-S/Y/T-Q/D/L/H/K-E/D/V-P/S/M/E (SEQ ID NO: 14), with reference to SEQ ID NO: 2.

(136) Non-naturally occurring chagasin scaffold proteins characterized by binding to overlapping or similar areas on a target can be identified by competitive inhibition/binding assays. Such assays are well known in the art and are described in, e.g., S. J. Mather (ed.) 1996. Current Directions in Radiopharmaceutical Research and Development, 169-179, Kluwer Academic Publishers; Zenner (1973) Clin. Chem. 19, 699-705; Gao (2012) Analytical Methods 4, 3718-3723.

(137) In certain embodiments, the non-naturally occurring chagasin scaffold protein specific for human LRP6 comprises an L2, L4, and/or L6 of any one of the non-naturally occurring chagasin scaffold protein specific for human LRP6 disclosed herein. In certain embodiments, provided herein is a non-naturally occurring chagasin scaffold protein that specifically binds human low density lipoprotein receptor-related protein 6 (LRP6) and comprises: an L2 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 3-5, 78-80, and 146, an L4 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 7-9, 77, and 81-83; and an L6 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 11-13, 84-86, and 147, with reference to SEQ ID NO: 2. The L2, L4, and L6 amino acid sequences described above are provided in Table 1 below:

(138) TABLE-US-00005 TABLE1 L2,L4,andL6AminoAcidSequencesof Non-NaturallyOccurringChagasinScaffold ProteinsthatSpecificallyBindLRP6 SNPQT SNKVKGVPGF GPWTGASQEP (SEQIDNO:3) (SEQIDNO:7) (SEQIDNO:11) SNPTT SNKIKGIPGF RPSTGPSDDS (SEQIDNO:4) (SEQIDNO:8) (SEQIDNO:12) SNVD SNSTKR PRVKGAYLVM (SEQIDNO:5) (SEQIDNO:9) (SEQIDNO:13) SNPTT YNNIRGLPGF RPWTGPSHDS (SEQIDNO:78) (SEQIDNO:81) (SEQIDNO:84) SNPSC DSNEIWYC SPYYGPTKVE (SEQIDNO:79) (SEQIDNO:82) (SEQIDNO:85) SNPAD SNYTKH PREKGSSLVM (SEQIDNO:80) (SEQIDNO:83) (SEQIDNO:86) S-N/S-P/N-Q/T/ P-S/Y-N-N/K-V/ G/R/P/S-P/R-W/ V/S/A-T/D/C-GF I-K/R-G-V/I/L- S/V/Y/E-T/K/Y- (SEQIDNO:6) PGFGAGG G-A/P/S-S/Y/T- (SEQIDNO:10) Q/D/L/H/K-E/D/ V-P/S/M/E (SEQIDNO:14) PSN-S/Y-TK-H/ DSNEIWYC SNAD R-GAGG (SEQIDNO:77) (SEQIDNO:146) (SEQIDNO:90) RREKGSTLVV R/S/P/G-P/R-W/ SNP-T/S/A/Q-T/ (SEQIDNO:147) Y/E/S/V-T/Y/K/ C/D T-G-P/S/A-S/T/ (SEQIDNO:150) Y-H/K/L/Q/D-D/ V/E-S/E/M/P/V SEQIDNO:148 SN-V/A-D Y/S-N-N/K-I/V- SN-Y/S-TK-H/R (SEQIDNO:155) R/K-G-L/V/I-PGF (SEQIDNO:157) (SEQIDNO:156)

(139) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNPQT (SEQ ID NO: 3), an L4 that comprises the amino acid sequence SNKVKGVPGF (SEQ ID NO: 7); and an L6 that comprises the amino acid sequence GPWTGASQEP (SEQ ID NO: 11), with reference to SEQ ID NO: 2.

(140) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNPTT (SEQ ID NO: 4), an L4 that comprises the amino acid sequence SNKIKGIPGF (SEQ ID NO: 8); and an L6 that comprises the amino acid sequence RPSTGPSDDS (SEQ ID NO: 12), with reference to SEQ ID NO: 2.

(141) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNVD (SEQ ID NO: 5), an L4 that comprises the amino acid sequence SNSTKR (SEQ ID NO: 9); and an L6 that comprises the amino acid sequence PRVKGAYLVM (SEQ ID NO: 13), with reference to SEQ ID NO: 2.

(142) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNPTT (SEQ ID NO: 4), an L4 that comprises the amino acid sequence YNNIRGLPGF (SEQ ID NO: 81); and an L6 that comprises the amino acid sequence RPWTGPSHDS (SEQ ID NO: 84), with reference to SEQ ID NO: 2.

(143) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNPSC (SEQ ID NO: 79), an L4 that comprises the amino acid sequence DSNEIWYC (SEQ ID NO: 82); and an L6 that comprises the amino acid sequence SPYYGPTKVE (SEQ ID NO: 85), with reference to SEQ ID NO: 2.

(144) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNPAD (SEQ ID NO: 80), an L4 that comprises the amino acid sequence SNYTKH (SEQ ID NO: 83); and an L6 that comprises the amino acid sequence PREKGSSLVM (SEQ ID NO: 86), with reference to SEQ ID NO: 2.

(145) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNAD (SEQ ID NO: 146), an L4 that comprises the amino acid sequence SNSTKR (SEQ ID NO: 9); and an L6 that comprises the amino acid sequence RREKGSTLVV (SEQ ID NO: 147), with reference to SEQ ID NO: 2.

(146) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 15. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 16. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 17. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 87. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 88. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 89. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises the amino acid sequence set forth in SEQ ID NO: 149. SEQ ID NOs: 15-17, 87-89, and 149 are provided below.

(147) TABLE-US-00006 (SEQIDNO:15) MSHKVTKAHNGATLTVAVGELVEIQLPSNPQTGFAWYFEG GTKESPNESMFTVENKYFPSNKVKGVPGFGAGGTEHFHVT VKAAGTHAVNLTYMGPWTGASQEPERFTVYLKAN (SEQIDNO:16) MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEG GTKESPNESMFTVENKYFPSNKIKGIPGFGAGGTEHFHVT VKAAGTHAVNLTYMRPSTGPSDDSERFTVYLKAN (SEQIDNO:17) MSHKVTKAHNGATLTVAVGELVEIQLPSNVDGFAWYFEGG TKESPNESMFTVENKYFPSNSTKRGAGGTEHFHVTVKAAG THAVNLTYMPRVKGAYLVMERFTVYLKAN (SEQIDNO:87) MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEG GTKESPNESMFTVENKYFPYNNIRGLPGFGAGGTEHFHVT VKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN (SEQIDNO:88) MSHKVTKAHNGATLTVAVGELVEIQLPSNPSCGFAWYFEG GTKESPNESMFTVENKYFPDSNEIWYCGAGGTEHFHVTVK AAGTHAVNLTYMSPYYGPTKVEERFTVYLKAN (SEQIDNO:89) MSHKVTKAHNGATLTVAVGELVEIQLPSNPADGFAWYFEG GTKESPNESMFTVENKYFPSNYTKHGAGGTEHFHVTVKAA GTHAVNLTYMPREKGSSLVMERFTVYLKAN (SEQIDNO:149) MSHKVTKAHNGATLTVAVGELVEIQLPSNADGFAWYFEGG TKESPNESMFTVENKYFPSNSTKRGAGGTEHFHVTVKAAG THAVNLTYMRREKGSTLVVERFTVYLKAN

(148) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 is a variant of any one of the non-naturally occurring chagasin scaffold proteins that specifically bind human LRP6 described herein. In certain embodiments, such a variant chagasin scaffold protein comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid substitutions in one or more of SEQ ID NOs: 3, 4, 5, 7, 8, 9, 11, 12, and/or 13. In certain embodiments, the amino acid substitution(s) are conservative amino acid substitution(s). In certain embodiments, the amino acid substitutions do not substantially reduce the ability of the non-naturally occurring chagasin scaffold protein to specifically bind human LRP6. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce LRP6 binding affinity may be made. The binding affinity of a variant chagasin scaffold protein that specifically binds human LRP6 can be assessed using a method described in the Examples below.

(149) Conservative substitutions are shown in Table 2 under the heading of conservative substitutions. More substantial changes are provided in Table 2 under the heading of exemplary substitutions, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into a variant chagasin scaffold protein and the products screened for a desired activity, e.g., retained/improved LRP6 binding.

(150) TABLE-US-00007 TABLE 2 Conservative Substitutions Preferred Original Residue Exemplary Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu

(151) Non-conservative substitutions will entail exchanging a member of one of these classes for another class. An exemplary substitutional variant is an affinity matured chagasin scaffold protein that specifically binds LRP6, which may be conveniently generated, e.g., using phage display based affinity maturation techniques such as those described herein. Briefly, one or more residues in L2, L4, and/or L6 altered (i.e., added, deleted, or substituted) and the variant chagasin scaffold protein displayed on phage and screened for LRP6 binding affinity. In certain embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, loop shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any chagasin scaffold protein variants with the desired affinity for LRP6. In certain embodiments, introducing diversity involves loop-directed approaches, in which several residues in L2, L4, and/or L6 (e.g., 4-6 residues at a time) are randomized. L2, L4, and/or L6 residues involved in binding a target ligand may be specifically identified, e.g., using alanine scanning mutagenesis or modeling.

(152) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 has a stronger binding affinity for a LRP6 than it has for LRP proteins or LRP6 homologues, such as LRP1, LRP1B, LRP2, LRP3, LRP4, LRP5, LRP8, LRP10, LRP11, and LRP12.

(153) Normally, the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 (i.e., has a binding affinity (Kd) value of no more than about 110.sup.7 M, preferably no more than about 110.sup.8 and most preferably no more than about 110.sup.9 M) but has a binding affinity for another LRP protein which is at least about 50-fold, or at least about 500-fold, or at least about 1000-fold, weaker than its binding affinity for LRP6.

(154) In certain embodiments, the extent of binding of the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 to a non-target ligand (such as LRP 1, LRP1B, LRP2, LRP3, LRP4, LRP5, LRP8, LRP10, LRP11, and LRP12) is less than about 10% of the binding of the non-naturally occurring chagasin scaffold protein to human LRP6 as determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation (RIA). Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target. The term specific binding or specifically binds to or is specific for a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a Kd for the target of at least about 10.sup.4 M, alternatively at least about 10.sup.5M, alternatively at least about 10.sup.6 M, alternatively at least about 10.sup.7 M, alternatively at least about 10.sup.8 M, alternatively at least about 10.sup.9 M, alternatively at least about 10.sup.10 M, alternatively at least about 10.sup.11 M, alternatively at least about 10.sup.12 M, or greater. In one embodiment, the term specific binding refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.

(155) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds LRP6 binds a human LRP6 with a Kd between about 1 pM to about 500 nM. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds LRP6 binds a human LRP6 with a Kd between about 1 pM to about 50 pM, between about 50 pM to about 250 pM, between about 250 pM to about 500 pM, between about 500 pM to 750 pM, between about 750 pM to about 1 nM, between about 1 nM to about 25 nM, between about 25 nM to about 50 nM, between 50 nM to about 100 nM, between about 100 nM to about 250 nM, or between about 250 nM to about 500 nM.

(156) In certain embodiments, the non-naturally occurring chagasin scaffold protein specifically binds LRP6 inhibits Wnt1 signaling, e.g., as determined using methods described in the Examples below.

(157) Nucleic acid molecules encoding the non-naturally occurring chagasin scaffold proteins described herein that specifically bind LRP6, expression vectors comprising nucleic acid molecules encoding the non-naturally occurring chagasin scaffold proteins described herein that specifically bind LRP6, and cells comprising the nucleic acid molecules are also contemplated. Also provided herein are methods of producing a non-naturally chagasin scaffold protein described herein that specifically binds LRP6 by culturing such cells, expressing the non-naturally occurring chagasin scaffold protein, and recovering the non-naturally occurring chagasin scaffold protein from the cell culture.

(158) In certain embodiments, a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 can be produced via in vitro translation, as described elsewhere herein.

(159) As described elsewhere herein, a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 can also be generated via chemical peptide synthesis, e.g., by grafting chemically synthesized L2, L4, and/or L6 peptides onto a chagasin framework.

(160) Non-Naturally Occurring Chagasin Scaffold Proteins that Specifically Bind Human Vascular Endothelial Growth Factor (VEGF)

(161) Vascular endothelial growth factor (VEGF or VEGFA) is a highly specific mitogen for vascular endothelial cells. The expression of VEGF is potentiated in response to hypoxia, by activated oncogenes, and by a variety of cytokines. VEGF induces endothelial cell proliferation, promotes cell migration, and inhibits apoptosis. In vivo VEGF induces angiogenesis as well as permeabilization of blood vessels, and plays a central role in the regulation of vasculogenesis. VEGF has multiple isoforms that can bind various receptors. For example, VEGF-A can bind to VEGFR1 (Flt-1), VEGFR2 (KDR) as well as neuropilin (NRP-1) (Ferarra et al. (2003) Nat Medicine 9, 669-676; Goel et al. Nat Rev Cancer (2013) 12, 871-882).

(162) Deregulated VEGF expression contributes to the development of solid tumors by promoting tumor angiogenesis and to the etiology of several additional diseases that are characterized by abnormal angiogenesis, such as diseases caused by ocular neovascularisation, including, but not limited to, e.g., diabetic blindness, retinopathies, primarily diabetic retinopathy or age-related macular degeneration, choroidal neovascularization (CNV), diabetic macular edema, pathological myopia, von Rippel-Lindau disease, histoplasmosis of the eye, retinal vein occlusion (both branched retinal vein occlusion (BRVO) and central retinal vein occlusion (CRVO), corneal neovascularization, retinal neovascularization and rubeosis; psoriasis, psoriatic arthritis, haemangioblastoma such as haemangioma; inflammatory renal diseases, such as glomerulonephritis, especially mesangioproliferative glomerulonephritis, haemolytic uremic syndrome, diabetic nephropathy or hypertensive nephrosclerosis. Other diseases characterized by deregulated VEGF expression include various inflammatory diseases, such as arthritis, especially rheumatoid arthritis, inflammatory bowel disease, psorsasis, sarcoidosis, arterial arteriosclerosis and diseases occurring after transplants, endometriosis or chronic asthma. Excessive, inappropriate or uncontrolled angiogenesis also occurs when there is new blood vessel growth that contributes to the worsening of the diseased state or cause of a diseased state, such as in cancer, especially vascularized solid tumors and metastatic tumors (including colon, lung cancer (especially small-cell lung cancer), or prostate cancer). The new blood vessels can feed the diseased tissues, destroy normal tissues, and in the case of cancer, the new vessels can allow tumor cells to escape into the circulation and lodge in other organs (tumor metastases). Consequently, inhibition of VEGF signaling abrogates the development of a wide variety of tumors.

(163) A non-naturally occurring chagasin scaffold protein specific for human VEGF described herein binds human VEGF with sufficient affinity and specificity. In certain embodiments, the VEGF is a VEGF-A. Preferably, such non-naturally occurring chagasin scaffold protein can be used as a therapeutic agent in targeting and interfering with diseases or conditions wherein VEGF activity is involved. A non-naturally occurring chagasin scaffold protein that specifically binds human VEGF will usually not bind to other VEGF homologues such as VEGF-B or VEGF-C, or other growth factors such as P1GF, PDGF or bFGF.

(164) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF binds an epitope of human VEGF bound by a second non-naturally occurring chagasin scaffold protein comprising an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35), with reference to SEQ ID NO: 2.

(165) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF binds an epitope of human VEGF bound by a second non-naturally occurring chagasin scaffold protein comprising an L2 that comprises the amino acid sequence SNY-F/Y-Y/C/N/R-D/E (SEQ ID NO: 49), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57), D/N/S-D/G/V/Y-P/N/S-G/Y-S/L/M-G/H/S-L/V/A/Y-W/Y/L/S (SEQ ID NO: 58), or G/H-S/V-S/Q-Y/W-W/G-G/W (SEQ ID NO: 68); and an L6 that comprises the amino acid sequence A/G-PW-S/Q/F/A/L/V-GPSR-Y/E/F/V/D-L (SEQ ID NO: 67), with reference to SEQ ID NO: 2.

(166) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF competitively inhibits the binding of a competing molecule to human VEGF. In certain embodiments, the competing molecule is an anti-VEGF antibody. In certain embodiments, the competing molecule is a second non-naturally occurring chagasin scaffold protein that binds to human VEGF.

(167) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF, wherein the second non-naturally occurring chagasin scaffold protein comprises an comprises an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35), with reference to SEQ ID NO: 2. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF and competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF comprises an comprises an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35), with reference to SEQ ID NO: 2.

(168) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF, wherein the second non-naturally occurring chagasin scaffold protein comprises an comprises an L2 that comprises the amino acid sequence SNY-F/Y-Y/C/N/R-D/E (SEQ ID NO: 49), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57), D/N/S-D/G/V/Y-P/N/S-G/Y-S/L/M-G/H/S-L/V/A/Y-W/Y/L/S (SEQ ID NO: 58), or G/H-S/V-S/Q-Y/W-W/G-G/W (SEQ ID NO: 68); and an L6 that comprises the amino acid sequence A/G-PW-S/Q/F/A/L/V-GPSR-Y/E/F/V/D-L (SEQ ID NO: 67), with reference to SEQ ID NO: 2.

(169) As noted elsewhere herein, non-naturally occurring chagasin scaffold proteins characterized by binding to overlapping or similar areas on a target can be identified by competitive inhibition/binding assays.

(170) In certain embodiments, the non-naturally occurring chagasin scaffold protein specific for human VEGF comprises an L2, L4, and/or L6 of any one of the non-naturally occurring chagasin scaffold protein specific for human VEGF disclosed herein. Thus, in certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 18-22 and 41-48, an L4 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 24-28 and 50-57; and an L6 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 30-34 and 59-66, with reference to SEQ ID NO: 2.

(171) The L2, L4, and L6 amino acid sequences described above are provided in Table 3 below:

(172) TABLE-US-00008 TABLE3 L2,L4,andL6AminoAcidSequencesof Non-NaturallyOccurringChagasinScaffold ProteinsthatSpecificallyBindVEGF SNLRSM AGPSAVPL APWRGPANVI (SEQIDNO:18) (SEQIDNO:24) (SEQIDNO:30) SNYFYD NDPGSRLS APWLGPSRVL (SEQIDNO:19) (SEQIDNO:25) (SEQIDNO:31) SNLQNA LSLYASET NPNWGPDYWI (SEQIDNO:20) (SEQIDNO:26) (SEQIDNO:32) SNLQDS SGTTGKSN FKSRGLMVPL (SEQIDNO:21) (SEQIDNO:27) (SEQIDNO:33) SNYRDS VRAGQANE SPVLGPRFWL (SEQIDNO:22) (SEQIDNO:28) (SEQIDNO:34) A/N/L/S/V-G/D/ A/N/F/S-P/K-W/ SN-L/Y-R/F/Q- S/R-P/L/T/A-S/ N/S/V-R/L/W-G- S/Y/N/D-M/D/A/S G/Y/T-A/S/G/Q- P/L-A/S/D/M/R- (SEQIDNO:35) V/R/S/K/A-P/L/ N/R/Y/V/F-V/W/ E/S/N-L/S/T/N/E P-I/L (SEQIDNO:23) (SEQIDNO:29) SNYFYD DDPGSGLW APWSGPSRYL (SEQIDNO:41) (SEQIDNO:50) (SEQIDNO:59) SNYFYE NGPGLGVY APWQGPSREL (SEQIDNO:42) (SEQIDNO:51) (SEQIDNO:60) SNYYYD NVNGSHAW APWSGPSRFL (SEQIDNO:43) (SEQIDNO:52) (SEQIDNO:61) SNYFCD NYPGSGVL APWFGPSRVL (SEQIDNO:44) (SEQIDNO:53) (SEQIDNO:62) SNYFND GSSYWG APWAGPSRVL (SEQIDNO:45) (SEQIDNO:54) (SEQIDNO:3) SNYFYD SGSYMSYS APWLGPSRDL (SEQIDNO:46) (SEQIDNO:55) (SEQIDNO:4) SNYFRE HVQWGW APWVGPSREL (SEQIDNO:47) (SEQIDNO:56) (SEQIDNO:5) SNYYYD HYYNLGGRYT GPWLGPSRVL (SEQIDNO:48) (SEQIDNO:57) (SEQIDNO:66) SNY-F/Y-Y/C/N/ D/N/S-D/G/V/Y- A/G-PW-S/Q/F/A/ R-D/E P/N/S-G/Y-S/L/ L/V-GPSR-Y/E/F/ (SEQIDNO:49) M-G/H/S-L/V/A/ V/D-L Y-W/Y/L/S (SEQIDNO:67) (SEQIDNO:58) G/H-S/V-S/Q-Y/ W-W/G-G/W (SEQIDNO:68)

(173) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNLRSM (SEQ ID NO: 18), an L4 that comprises the amino acid sequence AGPSAVPL (SEQ ID NO: 24), and an L6 that comprises the amino acid sequence APWRGPANVI (SEQ ID NO: 30), with reference to SEQ ID NO: 2.

(174) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), an L4 that comprises the amino acid sequence NDPGSRLS (SEQ ID NO: 25), and an L6 that comprises the amino acid sequence APWLGPSRVL (SEQ ID NO: 31), with reference to SEQ ID NO: 2.

(175) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNLQNA (SEQ ID NO: 20), an L4 that comprises the amino acid sequence LSLYASET (SEQ ID NO: 26), and an L6 that comprises the amino acid sequence NPNWGPDYWI (SEQ ID NO: 32), with reference to SEQ ID NO: 2.

(176) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNLQDS (SEQ ID NO: 21), an L4 that comprises the amino acid sequence SGTTGKSN (SEQ ID NO: 27); and an L6 that comprises the amino acid sequence FKSRGLMVPL (SEQ ID NO: 33), with reference to SEQ ID NO: 2.

(177) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYRDS (SEQ ID NO: 22), an L4 that comprises the amino acid sequence VRAGQANE (SEQ ID NO: 28); and an L6 that comprises the amino acid sequence SPVLGPRFWL (SEQ ID NO: 34), with reference to SEQ ID NO: 2.

(178) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), an L4 that comprises the amino acid sequence DDPGSGLW (SEQ ID NO: 50), and an L6 that comprises the amino acid sequence APWSGPSRYL (SEQ ID NO: 59), with reference to SEQ ID NO: 2.

(179) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFYE (SEQ ID NO: 42), an L4 that comprises the amino acid sequence NGPGLGVY (SEQ ID NO: 51); and an L6 that comprises the amino acid sequence APWQGPSREL (SEQ ID NO: 60), with reference to SEQ ID NO: 2.

(180) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), an L4 that comprises the amino acid sequence NVNGSHAW (SEQ ID NO: 52); and an L6 that comprises the amino acid sequence APWSGPSRFL (SEQ ID NO: 61), with reference to SEQ ID NO: 2.

(181) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFCD (SEQ ID NO: 44), an L4 that comprises the amino acid sequence NYPGSGVL (SEQ ID NO: 53); and an L6 that comprises the amino acid sequence APWFGPSRVL (SEQ ID NO: 62), with reference to SEQ ID NO: 2.

(182) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF that comprises an L2 that comprises the amino acid sequence SNYFCD (SEQ ID NO: 44), an L4 that comprises the amino acid sequence NYPGSGVL (SEQ ID NO: 53); and an L6 that comprises the amino acid sequence APWFGPSRVL (SEQ ID NO: 62), with reference to SEQ ID NO: 2 forms homodimers.

(183) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFND (SEQ ID NO: 45), an L4 that comprises the amino acid sequence GSSYWG (SEQ ID NO: 54), and an L6 that comprises the amino acid sequence APWAGPSRVL (SEQ ID NO: 63), with reference to SEQ ID NO: 2.

(184) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), an L4 that comprises the amino acid sequence SGSYMSYS (SEQ ID NO: 55); and an L6 that comprises the amino acid sequence APWLGPSRDL (SEQ ID NO: 64), with reference to SEQ ID NO: 2.

(185) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYFRE (SEQ ID NO: 47), an L4 that comprises the amino acid sequence HVQWGW (SEQ ID NO: 56); and an L6 that comprises the amino acid sequence APWVGPSREL (SEQ ID NO: 65), with reference to SEQ ID NO: 2.

(186) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(187) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 36. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 37. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 38. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 39. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 40. The sequences of SEQ ID NOs: 36-40 are provided below:

(188) TABLE-US-00009 (SEQIDNO:36) MSHKVTKAHNGATLTVAVGELVEIQLPSNLRSMGFAWYFE GGTKESPNESMFTVENKYFPAGPSAVPLGAGGTEHFHVTV KAAGTHAVNLTYMAPWRGPANVIERFTVYLKAN (SEQIDNO:37) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFYDGFAWYFE GGTKESPNESMFTVENKYFPNDPGSRLSGAGGTEHFHVTV KAAGTHAVNLTYMAPWLGPSRVLERFTVYLKAN (SEQIDNO:38) MSHKVTKAHNGATLTVAVGELVEIQLPSNLQNAGFAWYFE GGTKESPNESMFTVENKYFPLSLYASETGAGGTEHFHVTV KAAGTHAVNLTYMNPNWGPDYWIERFTVYLKAN (SEQIDNO:39) MSHKVTKAHNGATLTVAVGELVEIQLPSNLQDSGFAWYFE GGTKESPNESMFTVENKYFPSGTTGKSNGAGGTEHFHVTV KAAGTHAVNLTYMFKSRGLMVPLERFTVYLKAN (SEQIDNO:40) MSHKVTKAHNGATLTVAVGELVEIQLPSNYRDSGFAWYFE GGTKESPNESMFTVENKYFPVRAGQANEGAGGTEHFHVTV KAAGTHAVNLTYMSPVLGPRFWLERFTVYLKAN

(189) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 69. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 70. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 71. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 72. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 73. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 74. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 75. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 76. The sequences of SEQ ID NOs: 69-76 are provided below:

(190) TABLE-US-00010 (SEQIDNO:69) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFYDGFAWYFE GGTKESPNESMFTVENKYFPDDPGSGLWGAGGTEHFHVTV KAAGTHAVNLTYMAPWSGPSRYLERFTVYLKAN (SEQIDNO:70) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFYEGFAWYFE GGTKESPNESMFTVENKYFPNGPGLGVYGAGGTEHFHVTV KAAGTHAVNLTYMAPWQGPSRELERFTVYLKAN (SEQIDNO:71) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYYDGFAWYFE GGTKESPNESMFTVENKYFPNVNGSHAWGAGGTEHFHVTV KAAGTHAVNLTYMAPWSGPSRFLERFTVYLKAN (SEQIDNO:72) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFCDGFAWYFE GGTKESPNESMFTVENKYFPNYPGSGVLGAGGTEHFHVTV KAAGTHAVNLTYMAPWFGPSRVLERFTVYLKAN (SEQIDNO:73) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFNDGFAWYFE GGTKESPNESMFTVENKYFPGSSYWGGAGGTEHFHVTVKA AGTHAVNLTYMAPWAGPSRVLERFTVYLKAN (SEQIDNO:74) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFYDGFAWYFE GGTKESPNESMFTVENKYFPSGSYMSYSGAGGTEHFHVTV KAAGTHAVNLTYMAPWLGPSRDLERFTVYLKAN (SEQIDNO:75) MSHKVTKAHNGATLTVAVGELVEIQLPSNYFREGFAWYFE GGTKESPNESMFTVENKYFPHVQWGWGAGGTEHFHVTVKA AGTHAVNLTYMAPWVGPSRELERFTVYLKAN (SEQIDNO:76) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYYDGFAWYFE GGTKESPNESMFTVENKYFPHYYNLGGRYTGAGGTEHFHV TVKAAGTHAVNLTYMGPWLGPSRVLERFTVYLKAN

(191) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF, wherein the second non-naturally occurring chagasin scaffold protein comprises an comprises an L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF and competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF comprises an comprises an L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(192) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF competitively inhibits the binding of a second non-naturally occurring chagasin scaffold protein to human VEGF, wherein the second non-naturally occurring chagasin scaffold protein comprises an comprises an n L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(193) As noted elsewhere herein, non-naturally occurring chagasin scaffold proteins characterized by binding to overlapping or similar areas on a target can be identified by competitive inhibition/binding assays.

(194) In certain embodiments, the non-naturally occurring chagasin scaffold protein specific for human VEGF comprises an L2, L4, and/or L6 of any one of the non-naturally occurring chagasin scaffold protein specific for human VEGF disclosed herein. Thus, in certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 48 and 110, an L4 that comprises an amino acid sequence set forth in any one of SEQ ID NOs: 57 and 111-113; and an L6 that comprises an amino acid sequence set forth in SEQ ID NO: 66, with reference to SEQ ID NO: 2.

(195) The L2, L4, and L6 amino acid sequences described above are provided in Table 4 below:

(196) TABLE-US-00011 TABLE4 SNYYYD HYSNLGGRYT SEQIDNO:48 SEQIDNO:112 SNYYKD HYTNLGGRYT SEQIDNO:110 SEQIDNO:113 HYYNLGGRYT SNYY-Y/K-D SEQIDNO:57 SEQIDNO:114 HYQNLGGRYT HY-Y/Q/S/T-NLGGRYT SEQIDNO:111 SEQIDNO:115

(197) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYKD (SEQ ID NO: 110), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(198) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), an L4 that comprises the amino acid sequence HYQNLGGRYT (SEQ ID NO: 111); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(199) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), an L4 that comprises the amino acid sequence HYSNLGGRYT (SEQ ID NO: 112); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(200) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises an L2 that comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), an L4 that comprises the amino acid sequence HYTNLGGRYT (SEQ ID NO: 113); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.

(201) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 116. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 117. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 118. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF comprises the amino acid sequence set forth in SEQ ID NO: 119. The sequences of SEQ ID NOs: 116-119 are provided below:

(202) TABLE-US-00012 (SEQIDNO:116) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYKDGFAWYFE GGTKESPNESMFTVENKYFPHYYNLGGRYTGAGGTEHFHV TVKAAGTHAVNLTYMGPWLGPSRVLERFTVYLKAN (SEQIDNO:117) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYYDGFAWYFE GGTKESPNESMFTVENKYFPHYQNLGGRYTGAGGTEHFHV TVKAAGTHAVNLTYMGPWLGPSRVLERFTVYLKAN (SEQIDNO:118) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYYDGFAWYFE GGTKESPNESMFTVENKYFPHYSNLGGRYTGGAGTEHFHV TVKAAGTHAVNLTYMGPWLGPSRVLERFTVYLKAN (SEQIDNO:119) MSHKVTKAHNGATLTVAVGELVEIQLPSNYYYDGFAWYFE GGTKESPNESMFTVENKYFPHYTNLGGRYTGGAGTEHFHV TVKAAGTHAVNLTYMGPWLGPSRVLERFTVYLKAN

(203) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF is a variant of any one of the non-naturally occurring chagasin scaffold proteins that specifically bind human VEGF described herein. In certain embodiments, such a variant chagasin scaffold protein comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid substitutions in one or more of SEQ ID NOs: 3, 4, 5, 7, 8, 9, 11, 12, 13, 19, 25, 31, 48, 57, and/or 66. In certain embodiments, the amino acid substitution(s) are conservative amino acid substitution(s). In certain embodiments, the amino acid substitutions do not substantially reduce the ability of the non-naturally occurring chagasin scaffold protein to specifically bind human VEGF. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce VEGF binding affinity may be made. The binding affinity of a variant chagasin scaffold protein that specifically binds human VEGF can be assessed using a method described in the Examples below.

(204) As noted elsewhere herein, conservative substitutions are shown in Table 2 under the heading of conservative substitutions. More substantial changes are provided in Table 2 under the heading of exemplary substitutions, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into a variant chagasin scaffold protein and the products screened for a desired activity, e.g., retained/improved VEGF binding.

(205) Non-conservative substitutions will entail exchanging a member of one of these classes for another class. An exemplary substitutional variant is an affinity matured chagasin scaffold protein that specifically binds VEGF, which may be conveniently generated, e.g., using phage display based affinity maturation techniques such as those described herein. Briefly, one or more residues in L2, L4, and/or L6 are altered (i.e., added, deleted, or substituted) and the variant chagasin scaffold protein displayed on phage and screened for VEGF binding affinity. In certain embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, loop shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any chagasin scaffold protein variants with the desired affinity for VEGF. In certain embodiments, introducing diversity involves loop-directed approaches, in which several residues in L2, L4, and/or L6 (e.g., 4-6 residues at a time) are randomized. L2, L4, and/or L6 residues involved in binding a target ligand may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. In certain embodiments, that non-naturally occurring chagasin scaffold protein that specifically binds VEGF in which one or more residues in L2, L4, and/or L6 is altered for the purpose of generating affinity matured chagasin scaffold proteins that specifically bind VEGF comprises the amino acid sequence set forth in SEQ ID NO: 37. In certain embodiments, that non-naturally occurring chagasin scaffold protein that specifically binds VEGF in which one or more residues in L2, L4, and/or L6 is altered for the purpose of generating affinity matured chagasin scaffold proteins that specifically bind VEGF comprises the amino acid sequence set forth in SEQ ID NO: 76.

(206) In certain embodiments, non-naturally occurring chagasin scaffold protein that specifically binds human VEGF has a stronger binding affinity for a VEGF than it has for a homologue of that VEGF, such as VEGF-B or VEGF-C, or other growth factors such as P1GF, PDGF or bFGF. Normally, non-naturally occurring chagasin scaffold protein that specifically binds human VEGF, i.e., has a binding affinity (Kd) value of no more than about 110.sup.7 M, preferably no more than about 110.sup.8 and most preferably no more than about 110.sup.9 M) but has a binding affinity for a homologue of that VEGF or other growth factor which is at least about 50-fold, or at least about 500-fold, or at least about 1000-fold, weaker than its binding affinity for VEGF.

(207) In certain embodiments, the extent of binding of the non-naturally occurring chagasin scaffold protein that specifically binds human VEGF to a non-target ligand (such as such as VEGF-B or VEGF-C, or other growth factors such as P1GF, PDGF or bFGF) is less than about 10% of the binding of the non-naturally occurring chagasin scaffold protein to human VEGF as determined by methods known in the art, such as ELISA, fluorescence activated cell sorting (FACS) analysis, or radioimmunoprecipitation (RIA). Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target. The term specific binding or specifically binds to or is specific for a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a Kd for the target of at least about 10.sup.4 M, alternatively at least about 10.sup.5 M, alternatively at least about 10.sup.6 M, alternatively at least about 10.sup.7 M, alternatively at least about 10.sup.8 M, alternatively at least about 10.sup.9 M, alternatively at least about 10.sup.10 M, alternatively at least about 10.sup.11 M, alternatively at least about 10.sup.12 M, or greater. In one embodiment, the term specific binding refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.

(208) In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds VEGF binds a human VEGF with a Kd between about 1 pM to about 500 nM. In certain embodiments, the non-naturally occurring chagasin scaffold protein that specifically binds VEGF binds a human VEGF with a Kd between about 1 pM to about 50 pM, between about 50 pM to about 250 pM, between about 250 pM to about 500 pM, between about 500 pM to 750 pM, between about 750 pM to about 1 nM, between about 1 nM to about 25 nM, between about 25 nM to about 50 nM, between 50 nM to about 100 nM, between about 100 nM to about 250 nM, or between about 250 nM to about 500 nM.

(209) Nucleic acid molecules encoding the non-naturally occurring chagasin scaffold proteins described herein that specifically bind VEGF, expression vectors comprising nucleic acid molecules encoding the non-naturally occurring chagasin scaffold proteins described herein that specifically bind VEGF, and cells comprising the nucleic acid molecules are also contemplated. Also provided herein are methods of producing a non-naturally chagasin scaffold protein described herein that specifically binds VEGF by culturing such cells, expressing the non-naturally occurring chagasin scaffold protein, and recovering the non-naturally occurring chagasin scaffold protein from the cell culture.

(210) In certain embodiments, a non-naturally occurring chagasin scaffold protein that specifically binds VEGF can be produced via in vitro translation, as described elsewhere herein.

(211) As described elsewhere herein, a non-naturally occurring chagasin scaffold protein that specifically binds VEGF can also be generated via chemical peptide synthesis, e.g., by grafting chemically synthesized L2, L4, and/or L6 peptides onto a chagasin framework.

(212) Chimeric Molecules Comprising a Non-Naturally Occurring Chagasin Scaffold Protein

(213) A non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein specifically binds VEGF) can also be modified if advantageous in a way to form a chimeric molecule comprising the chagasin scaffold protein fused (e.g., recombinantly fused) to another, heterologous polypeptide or amino acid sequence. In certain embodiments, such a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein with an antibody to form, e.g., a divalent molecule or a bispecific molecule. In certain embodiments, such a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein with a protein transduction domain which targets the polypeptide for delivery to various tissues and more particularly across the brain blood barrier, using, for example, the protein transduction domain of human immunodeficiency virus TAT protein (Schwarze et al., 1999, Science 285:1569-72).

(214) In certain embodiments, a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein with a cell-penetrating peptide (CPP) to facilitate delivery of the non-naturally occurring chagasin scaffold protein into the cytosol, the nucleus or other cellular compartments. CPPs (also referred to as protein transduction domains (PTDs), membrane translocating sequences (MTSs), or Trojan peptides) are a class of peptides with the ability to convey various, otherwise impermeable, macromolecules across the plasma membrane of cells in a relatively non-toxic fashion. The CPP peptides are typically between 5 and about 30 amino acids (aa) in length with a cationic, amphipathic, or hydrophobic nature. Notable examples of cell-penetrating peptides that can be fused to a non-naturally occurring chagasin scaffold protein provided herein include, e.g., Tat from HIV-1, Penetratin, and Transportan. (Fawell, S. et al. Proc. Natl. Acad. Sci. 1994, pp 664-668; Theodore, L. et al. J. Neurosci. 1995, pp 7158-7167; Pooga, M. et al. FASEB J. 1998, pp 67-77). Other examples of CPPs include, but are not limited to, e.g., antennapedia, poly-cationic peptides, etc. or derivatives of such peptides as described in, e.g., van den Berg et al, Curr Opin Biotechnol 22, 1-6, 2011). In certain embodiments, the CPP is recombinantly fused to the N-terminus of a non-naturally occurring chagasin scaffold protein provided herein. In certain embodiments, the CPP is recombinantly fused to the C-terminus of a non-naturally occurring chagasin scaffold protein provided herein.

(215) In certain embodiments, a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein with a signal sequence to facilitate the localization of the non-naturally occurring chagasin scaffold protein to, e.g., the endoplasmic reticulum, the golgi apparatus, endosomes, etc. In certain embodiments, a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein with a signal sequence to facilitate the secretion of the non-naturally occurring chagasin scaffold protein.

(216) In certain embodiments, the non-naturally occurring chagasin scaffold proteins provided herein can be used as bi- or multi-specific (for different target ligands or different epitopes on the same target ligand) in multimer form. For example, a dimeric bispecific non-naturally occurring chagasin scaffold protein has one subunit with specificity for a first target ligand or epitope and a second subunit with specificity for a second target ligand or epitope. Non-naturally occurring chagasin scaffold protein subunits can be joined in a variety of conformations that can increase the valency and thus the avidity of binding to a target ligand.

(217) In certain embodiments a chimeric molecule provided herein comprises two or more (such as three, four, five, six, seven, eight, nine, ten, or more than ten) non-naturally occurring chagasin scaffold proteins. In certain embodiments, a nucleic acid can be engineered to encode two or more copies of a single non-naturally occurring chagasin scaffold protein, which copies are transcribed and translated in tandem to produce a covalently linked multimer of identical scaffold subunits. In certain embodiments, the nucleic acid can be engineered to encode two or more different non-naturally occurring chagasin scaffold proteins, which copies are transcribed and translated in tandem to produce a covalently linked multimer of different scaffold subunits that bind, e.g., different epitopes of a single target ligand, or, e.g., different target ligands. In another embodiment, such a chimeric molecule comprises a fusion of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein specifically binds VEGF) with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag is generally placed at the amino- or carboxyl-terminus of the chagasin scaffold protein. The presence of such epitope-tagged forms of the non-naturally occurring chagasin scaffold protein can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the chagasin scaffold protein to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag. Various tag polypeptides and their respective antibodies are known in the art. Examples include poly-histidine (poly-His) or poly-histidine-glycine (poly-His-Gly) tags; the flu HA tag polypeptide and its antibody 12CA5 (Field et al. (1988) Mol. Cell. Biol. 8, 2159-2165); the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto (Evan et al. (1985) Mol. Cell. Biol. 5, 3610-3616]; and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody (Paborsky et al. (1990) Protein Eng., 3, 547-553). Other tag polypeptides include the Flag-peptide (Hopp et al. (1988) BioTechnology, 6, 1204-1210); the KT3 epitope peptide (Martin et al. (1992) Science, 255, 192-194]; an -tubulin epitope peptide (Skinner et al. (1991) J. Biol. Chem. 266, 15163-15166); and the T7 gene 10 protein peptide tag (Lutz-Freyermuth et al. (1990) Proc. Natl. Acad. Sci. USA 87, 6393-6397].

(218) In certain embodiments, the chimeric molecule can comprise a fusion of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein specifically binds VEGF) with an immunoglobulin or a particular region of an immunoglobulin. For a bivalent form of the chimeric molecule (e.g., an immunoadhesin), such a fusion could be to the Fc region of an IgG molecule. Ig fusions provided herein include polypeptides that comprise approximately or only residues 94-243, residues 33-53 or residues 33-52 of human in place of at least one variable region within an Ig molecule. In a particularly preferred embodiment, the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CH1, CH2 and CH3 regions of an IgG1 molecule. For the production of immunoglobulin fusions see also, U.S. Pat. No. 5,428,130 issued Jun. 27, 1995. In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein specifically binds VEGF) is fused, e.g., at the N or C terminus, to the constant region of an IgG (Fc). In certain embodiments, the chagasin scaffold protein/Fc fusion molecule activates the complement component of the immune response. In certain embodiments, the chagasin scaffold protein/Fc fusion protein increases the therapeutic value of the chagasin scaffold protein. In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) is fused (such as recombinantly fused), e.g., at the N or C terminus, to a complement protein, such as Clq. Various publications describe methods for obtaining non-naturally occurring chagasin scaffold proteins whose half-lives are modified either by introducing an FcRn-binding polypeptide into the molecules (WO 1997/43316, U.S. Pat. Nos. 5,869,046, 5,747,035, WO 1996/32478, WO 1991/14438) or by fusing the non-naturally occurring chagasin scaffold proteins with antibodies whose FcRn-binding affinities are preserved but affinities for other Fc receptors have been greatly reduced (WO 1999/43713) or fusing with FcRn binding domains of antibodies (WO 2000/09560, U.S. Pat. No. 4,703,039). Specific techniques and methods of increasing half-life of physiologically active molecules (e.g., non-naturally occurring chagasin scaffold proteins) can also be found in U.S. Pat. No. 7,083,784. In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein specifically binds VEGF) is fused to an Fc region from an IgG that comprises an amino acid residue mutations (as numbered by the EU index in Kabat): M252Y/S254T/T256E or H433KJN434F/Y436H.

(219) In certain embodiments, non-naturally occurring chagasin scaffold proteins described herein (such as those that specifically bind LRP6 and/or those that specifically bind VEGF) are fused with molecules that increase or extend in vivo or serum half-life. In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) is fused with albumin, such as human serum albumin (HSA), polyethylene glycol (PEG), polysaccharides, immunoglobulin molecules (IgG), complement, hemoglobin, a binding peptide, lipoproteins or other factors to increase its half-life in the bloodstream and/or its tissue penetration.

(220) Additional chimeric molecules comprising chagasin scaffold proteins may be generated through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as DNA shuffling). DNA shuffling may be employed to alter the activities of scaffolds provided herein (e.g., scaffolds with higher affinities and lower dissociation rates). See, generally, U.S. Pat. Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, 5,837,458, Patten et al. (1997) Curr. Opinion Biotechnol. 8, 724-33; Harayama (1998) Trends Biotechnol. 16, 76-82; Hansson, et al., (1999) J. Mol. Biol. 287, 265-76; and Lorenzo and Blasco, (1998) Biotechniques 24, 308-313

(221) In certain embodiments, a non-naturally occurring chagasin scaffold protein encompassed herein is altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination. One or more portions of a polynucleotide encoding a scaffold that binds to a specific target may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.

(222) Any of these fusions can generated by standard techniques, for example, by expression of the fusion protein from a recombinant fusion gene constructed using publicly available gene sequences.

(223) Conjugates Comprising a Non-Naturally Occurring Chagasin Scaffold Protein

(224) Also provided herein are immunoconjugates comprising a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).

(225) Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. Other toxins include maytansine and maytansinoids, calicheamicin and other cytotoxic agents. A variety of radionuclides are available for the production of radioconjugated chagasin scaffold proteins. Examples include .sup.212Bi, .sup.131I, .sup.131In, .sup.90Y, and .sup.186Re.

(226) Conjugates of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) and, e.g., cytotoxic agent, are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bisdiazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionuclide to the non-naturally occurring chagasin scaffold protein. See, WO94/11026.

(227) In another embodiment, the non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) can be conjugated to a receptor (such as streptavidin) for utilization in tumor pre-targeting wherein the non-naturally occurring chagasin scaffold protein-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a ligand (e.g., avidin) that is conjugated to a cytotoxic agent (e.g., a radionuclide).

(228) In certain embodiments, the non-naturally occurring chagasin scaffold proteins provided herein can be used as bi- or multi-specific (for different target ligands or different epitopes on the same target ligand) in multimer form. The attachments may be covalent or non-covalent. For example, a dimeric bispecific non-naturally occurring chagasin scaffold protein has one subunit with specificity for a first target ligand or epitope and a second subunit with specificity for a second target ligand or epitope. Non-naturally occurring chagasin scaffold protein subunits can be joined, e.g., via conjugation, in a variety of conformations that can increase the valency and thus the avidity of binding to a target ligand or to bind multiple target ligands. For example, amino acid alterations (e.g., additions, deletions, and/or substitutions) can be introduced into L1, L3, and/or L5 of a non-naturally occurring chagasin scaffold protein, e.g., to create a bispecific molecule or to add a linker. In certain embodiments L1, L3, and/or L5 are engineered to bind to a different epitope on the same target bound by L2, L4, and/or L6. In certain embodiments, L1, L3, and/or L5 are engineered to bind a different target ligand than the target ligand bound by L2, L4, and/or L6.

(229) In certain embodiments, non-naturally occurring chagasin scaffold proteins provided herein are engineered to provide reactive groups for conjugation. In certain embodiments, the N-terminus and/or C-terminus may also serve to provide reactive groups for conjugation. In certain embodiments, the N-terminus is conjugated to one moiety (such as, but not limited to PEG) while the C-terminus is conjugated to another moiety (such as, but not limited to biotin), or vice versa.

(230) Provided herein is the use of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) conjugated to one or more moieties, including but not limited to, peptides, polypeptides, proteins, fusion proteins, nucleic acid molecules, small molecules, mimetic agents, synthetic drugs, inorganic molecules, and organic molecules. Also provided herein is the use of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) chemically conjugated (including both covalent and non-covalent conjugations) to a heterologous protein or polypeptide (or fragment thereof, to a polypeptide of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids). The fusion does not necessarily need to be direct, but may occur through linker sequences described herein.

(231) In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF), or analogs or derivatives thereof may be conjugated to a diagnostic or detectable agent. Such chagasin scaffold proteins can be useful for monitoring or prognosing the development or progression of a disease as part of a clinical testing procedure, such as determining the efficacy of a particular therapy. Such diagnosis and detection can be accomplished by coupling the scaffold to detectable substances including, but not limited to various enzymes, such as but not limited to horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as but not limited to streptavidinlbiotin and avidin/biotin; fluorescent materials, such as but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as but not limited to iodine (.sup.131I, .sup.125I, .sup.123I, .sup.121I) carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.115In, .sup.113In, .sup.112In, .sup.111In,), and technetium (.sup.99Tc), thallium (.sup.201Ti), gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Fa) molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.1535M, .sup.177Lu, .sup.159Gd, .sup.149Pm, .sup.140La, .sup.175Yb, .sup.166Ho, .sup.90Y, .sup.47Sc .sup.186Re, .sup.188Re, .sup.142Pr .sup.105Rh, .sup.97Ru, .sup.68Ge .sup.57Co, .sup.65Zn, .sup.855R, .sup.32P, .sup.153Gd, .sup.169Yb, .sup.51Cr, .sup.54Mn, .sup.75Se, .sup.113Sn, and .sup.117Tn; positron emitting metals using various positron emission tomographies, nonradioactive paramagnetic metal ions, and molecules that are radiolabelled or conjugated to specific radioisotopes.

(232) Further, provided herein are uses of a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) conjugated to a therapeutic moiety. In certain embodiments, a chagasin scaffold protein may be conjugated to a therapeutic moiety such as a cytotoxin, e.g., a cytostatic or cytocidal agent, a therapeutic agent or a radioactive metal ion, e.g., alpha-emitters. A cytotoxin or cytotoxic agent includes any agent that is detrimental to cells.

(233) In certain embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) is conjugated to therapeutic moieties such as a radioactive metal ion, such as alpha-emitters such as .sup.213Bi or macrocyclic chelators useful for conjugating radiometal ions, including but not limited to, .sup.131In, .sup.131Lu, .sup.131Y, .sup.131Ho, .sup.131Sm, to polypeptides. In certain embodiments, the macrocyclic chelator is 1, 4, 7, 10-tetraazacyclododecane-N,N,N,N-tetra-acetic acid (DOTA) which can be attached to the chagasin scaffold protein via a linker molecule. Such linker molecules are commonly known in the art and described in, e.g., Denardo et al. (1998) Clin Cancer Res. 4, 2483-90; Peterson et al. (1999) Bioconjug. Chem. 10, 553-557; and Zimmerman et al. (1999) Nucl. Med. Biol. 26, 943-50.

(234) Techniques for conjugating therapeutic moieties to antibodies are well known and can be applied to the non-naturally occurring chagasin scaffold proteins disclosed herein, see, e.g., Amon et al., Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56. (Alan R. Liss, Inc. 1985); Hellstrom et al., Antibodies For Drug Delivery, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review, in Monoclonal Antibodies 84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radio labeled Antibody In Cancer Therapy, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., 1982, Immunol. Rev. 62:119-58. Similar approaches may be adapted for use with chagasin scaffold proteins of the invention.

(235) The therapeutic moiety or drug conjugated to a non-naturally occurring chagasin scaffold protein described herein (such as a chagasin scaffold protein that specifically binds LRP6 and/or a chagasin scaffold protein that specifically binds VEGF) should be chosen to achieve the desired prophylactic or therapeutic effect(s) for a particular disorder in a subject. A clinician or other medical personnel should consider the following when deciding on which therapeutic moiety or drug to conjugate to a scaffold: the nature of the disease, the severity of the disease, and the condition of the subject.

(236) In certain embodiments, non-naturally occurring chagasin scaffold proteins described herein (such as a chagasin scaffold proteins that specifically bind LRP6 and/or a chagasin scaffold proteins that specifically bind VEGF) can also be attached to solid supports, which are particularly useful for immunoassays or purification of the target ligand. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.

(237) Covalent Modifications

(238) Covalent modifications of non-naturally occurring chagasin scaffold proteins described herein (such as a chagasin scaffold proteins that specifically bind LRP6 and/or a chagasin scaffold proteins that specifically bind VEGF) are included within the scope of this invention. One type of covalent modification includes reacting targeted amino acid residues of a non-naturally occurring chagasin scaffold protein with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues of the chagasin scaffold protein. Derivatization with bifunctional agents is useful, for instance, for crosslinking the non-naturally occurring chagasin scaffold protein to a water-insoluble support matrix or surface for use in the method for purifying target ligand, and vice-versa. Commonly used crosslinking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3-dithiobis(succinimidyl-propionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-[(p-azidophenyl)-dithio]propioimidate.

(239) Other modifications include deamidation of glutaminyl and asparaginyl residues to the corresponding glutamyl and aspartyl residues, respectively, hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the -amino groups of lysine, arginine, and histidine side chains (T. E. Creighton, Proteins: Structure and Molecular Properties, W.H. Freeman & Co., San Francisco, pp. 79-86 (1983)), acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.

(240) Another type of covalent modification of a chagasin scaffold protein comprises linking the chagasin scaffold protein to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791,192 or U.S. Pat. No. 4,179,337

(241) The term polyethylene glycol or PEG means a polyethylene glycol compound or a derivative thereof, with or without coupling agents, coupling or activating moieties (e.g., with thiol, triflate, tresylate, azirdine, oxirane, N-hydroxysuccinimide or a maleimide moiety). The term PEG is intended to indicate polyethylene glycol of a molecular weight between 500 and 150,000 Da, including analogues thereof, wherein for instance the terminal OR-group has been replaced by a methoxy group (referred to as mPEG).

(242) In certain embodiments, non-naturally occurring chagasin scaffold proteins described herein (such as those that specifically bind LRP6 and/or those that specifically bind VEGF) are derivatized with polyethylene glycol (PEG). PEG is a linear, water-soluble polymer of ethylene oxide repeating units with two terminal hydroxyl groups. PEGs are classified by their molecular weights which typically range from about 500 daltons to about 40,000 daltons. In a presently preferred embodiment, the PEGs employed have molecular weights ranging from 5,000 daltons to about 20,000 daltons. PEGs coupled to the scaffolds provided herein can be either branched or unbranched (for example, Monfardini, C. et al. 1995 Bioconjugate Chem 6:62-69). PEGs are commercially available from Nektar Inc., Sigma Chemical Co. and other companies. Such PEGs include, but are not limited to, monomethoxypolyethylene glycol (MePEG-OH), monomethoxypolyethylene glycol-succinate (MePEG-S), monomethoxypolyethylene glycol-succinimidyl succinate (MePEG-S-NHS), monomethoxypolyethylene glycol-amine (MePEG-NH2), monomethoxypolyethylene glycol-tresylate (MePEG-TRES), and monomethoxypolyethylene glycol-imidazolyl-carbonyl (MePEG-IM).

(243) In certain embodiments, the hydrophilic polymer which is employed, for example, PEG, is capped at one end by an unreactive group such as a methoxy or ethoxy group. Thereafter, the polymer is activated at the other end by reaction with a suitable activating agent, such as cyanuric halides (for example, cyanuric chloride, bromide or fluoride), diimadozle, an anhydride reagent (for example, a dihalosuccinic anhydride, such as dibromosuccinic anhydride), acyl azide, p-diazoiumbenzyl ether, 3-(p-diazoniumphenoxy)-2-hydroxypropylether) and the like. The activated polymer is then reacted with a non-naturally occurring chagasin scaffold proteins described herein (such as those that specifically bind LRP6 and/or those that specifically bind VEGF) to produce a chagasin scaffold protein derivatized with a polymer. Alternatively, a functional group in the non-naturally occurring chagasin scaffold proteins provided herein can be activated for reaction with the polymer, or the two groups can be joined in a concerted coupling reaction using known coupling methods. It will be readily appreciated that the non-naturally occurring chagasin scaffold proteins provided herein can be derivatized with PEG using a myriad of other reaction schemes known to and used by those of skill in the art.

(244) Immunoliposomes

(245) Non-naturally occurring chagasin scaffold proteins disclosed herein (such as those that specifically bind LRP6 or those that specifically bind VEGF) can also be formulated as immunoliposomes. Liposomes containing a non-naturally occurring chagasin scaffold protein described herein are prepared by methods known in the art, such as described in Epstein et al., Proc Natl Acad Sci USA, 82: 3688 (1985); Hwang et al., Proc Natl Acad Sci USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.

(246) Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. An anti-neoplastic agent, a growth inhibitory agent, or a chemotherapeutic agent (such as doxorubicin) is optionally also contained within the liposome. See, Gabizon et al., J. National Cancer Inst., 81(19):1484 (1989).

(247) Methods of Treatment

(248) Diseases and Disorders Associated with LRP6

(249) Non-naturally occurring chagasin scaffold proteins that specifically bind LRP6 and/or compositions provided herein comprising such chagasin scaffold proteins can be administered to subjects (e.g., mammals such as humans) to treat diseases and disorders involving abnormal LRP6 activity, including, for example, cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease, as described elsewhere herein. In certain embodiments, provided are non-naturally occurring chagasin scaffold proteins that specifically bind LRP6 for use in the manufacture of a medicament for the treatment of cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease in a subject. In certain embodiments, provided are non-naturally occurring chagasin scaffold proteins that specifically bind LRP6 for use in treating cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease in a subject. In certain embodiments, the subject to be treated is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In certain embodiments, the subject is a human. In certain embodiments, the subject is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In certain embodiments, the subject is suspected of having or at risk for having cancer, metastatic disease, osteoporosis, a bone metabolism disease, a neuronal disease, a neurodegenerative disease, rheumatoid arthritis or other inflammatory disease, or be diagnosed with a cancer, metastatic disease, osteoporosis, a bone metabolism disease, a neuronal disease, a neurodegenerative disease, rheumatoid arthritis or other inflammatory disease or any other disease having abnormal LRP6 expression or activity.

(250) Diseases and Disorders Associated with VEGF

(251) Non-naturally occurring chagasin scaffold proteins that specifically bind VEGF and/or compositions provided herein comprising such chagasin scaffold proteins can be administered to subjects (e.g., mammals such as humans) to treat diseases and disorders involving abnormal VEGF activity, including, for example diseases and disorders involving abnormal angiogenesis and/or abnormal vascular permeability. Excessive, inappropriate or uncontrolled angiogenesis occurs when there is new blood vessel growth that contributes to the worsening of the diseased state or cause of a diseased state, such as in cancer, especially vascularized solid tumors and metastatic tumors (including colon, lung cancer (especially small-cell lung cancer), or prostate cancer), diseases caused by ocular neovascularisation, especially diabetic blindness, retinopathies, primarily diabetic retinopathy or age-induced macular degeneration, choroidal neovascularization (CNV), diabetic macular edema, pathological myopia, von Rippel-Lindau disease, histoplasmosis of the eye, retinal vein occlusion (both branched retinal vein occlusion (BRVO) and central retinal vein occlusion (CRVO)), corneal neovascularization, retinal neovascularization and rubeosis; psoriasis, psoriatic arthritis, haemangioblastoma such as haemangioma; inflammatory renal diseases, such as glomerulonephritis, especially mesangioproliferative glomerulonephritis, haemolytic uremic syndrome, diabetic nephropathy or hypertensive nephrosclerosis; various inflammatory diseases, such as arthritis, especially rheumatoid arthritis, inflammatory bowel disease, psorsasis, sarcoidosis, arterial arteriosclerosis and diseases occurring after transplants, endometriosis or chronic asthma. The new blood vessels can feed the diseased tissues, destroy normal tissues, and in the case of cancer, the new vessels can allow tumor cells to escape into the circulation and lodge in other organs (tumor metastases). Undesirable vascular permeability is associated with, e.g., edema associated with brain tumors, ascites associated with malignancies, Meigs' syndrome, lung inflammation, nephrotic syndrome, pericardial effusion, pleural effusion, permeability associated with cardiovascular diseases such as the condition following myocardial infarctions and strokes and the like.

(252) In certain embodiments, provided are non-naturally occurring chagasin scaffold proteins that specifically bind VEGF for use in the manufacture of a medicament for the treatment of a disease or disorder characterized by abnormal angiogenesis and/or abnormal vascular permeability in a subject. In certain embodiments, provided are non-naturally occurring chagasin scaffold proteins that specifically bind VEGF for use in treating disease or disorder characterized by abnormal angiogenesis and/or abnormal vascular permeability in a subject. In certain embodiments, the subject to be treated is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In certain embodiments, the subject is a human. In certain embodiments, the subject is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In certain embodiments, the subject is suspected of having or at risk for having a disease or disorder associated with abnormal angiogenesis and/or abnormal vascular permeability (such as those described herein) or be diagnosed with a disease or disorder associated with abnormal angiogenesis and/or abnormal vascular permeability (such as those described herein), or any other disease having abnormal VEGF expression or activity.

(253) Administration and Dosing

(254) Administration of a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) or a composition comprising such a chagasin scaffold protein can be by any suitable route including, e.g., intravenous, intramuscular, or subcutaneous. In certain embodiments, the non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or compositions provided herein are administered in combination with a second, third, or fourth agent (including, e.g., an antineoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent) to treat the diseases or disorders involving, e.g., abnormal LRP6 activity or abnormal VEGF activity. For diseases involving abnormal LRP6 activity, such agents include those described in, e.g., US 2012/0100562 and US 2011/0256127. In certain embodiments, the non-naturally occurring chagasin scaffold that specifically binds LRP6 is conjugated to the additional agent. For diseases involving abnormal VEGF activity, such agents include, e.g., chemotherapeutic agents or other anti-angiogenic molecules. In certain embodiments, the non-naturally occurring chagasin scaffold that specifically binds VEGF is conjugated to the additional agent.

(255) A non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or a composition described herein can be administered to an individual via any route, including, but not limited to, intravenous (e.g., by infusion pumps), intraperitoneal, intraocular, intra-arterial, intrapulmonary, oral, inhalation, intravesicular, intramuscular, intra-tracheal, subcutaneous, intraocular, intrathecal, transdermal, transpleural, intraarterial, topical, inhalational (e.g., as mists of sprays), mucosal (such as via nasal mucosa), subcutaneous, transdermal, gastrointestinal, intraarticular, intracistemal, intraventricular, rectal (i.e., via suppository), vaginal (i.e., via pessary), intracranial, intraurethral, intrahepatic, and intratumoral. In some embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) is administered systemically (for example by intravenous injection). In some embodiments, the chagasin scaffold proteins or compositions provided herein are administered locally (for example by intraarterial or intraocular injection).

(256) In some embodiments, a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or a composition described herein is administered directly to the eye or the eye tissue. In some embodiments, the a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or a composition described herein is administered topically to the eye, for example, in eye drops. In some embodiments, the chagasin scaffold proteins and/or compositions provided herein are administered by injection to the eye (intraocular injection) or to the tissues associated with the eye. A non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or a composition described herein can be administered, for example, by intraocular injection, periocular injection, subretinal injection, intravitreal injection, trans-septal injection, subscleral injection, intrachoroidal injection, intracameral injection, subconjectval injection, subconjuntival injection, sub-Tenon's injection, retrobulbar injection, peribulbar injection, or posterior juxtascleral delivery. These methods are known in the art. For example, for a description of exemplary periocular routes for retinal drug delivery, see Periocular routes for retinal drug delivery, Raghava et al. (2004), Expert Opin. Drug Deliv. 1(1):99-114. A non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) and/or a composition described herein can be administered, for example, to the vitreous, aqueous humor, sclera, conjunctiva, the area between the sclera and conjunctiva, the retina choroids tissues, macula, or other area in or proximate to the eye of an individual. The compositions can also be administered to the individual as an implant. Preferred implants are biocompatible and/or biodegradable sustained release formulations which gradually release the compounds over a period of time. Ocular implants for drug delivery are well-known in the art. See, e.g., U.S. Pat. Nos. 5,501,856, 5,476,511, and 6,331,313. The compositions can also be administered to the individual using iontophoresis, including, but are not limited to, the ionophoretic methods described in U.S. Pat. No. 4,454,151 and U.S. Pat. App. Pub. No. 2003/0181531 and 2004/0058313.

(257) Depending on the indication to be treated and factors relevant to the dosing that a physician of skill in the field would be familiar with, the non-naturally occurring chagasin scaffold proteins described herein (such as non-naturally occurring chagasin scaffold proteins that specifically binds LRP6 and/or non-naturally occurring chagasin scaffold proteins that specifically bind VEGF) provided herein will be administered at a dosage that is efficacious for the treatment of that indication while minimizing toxicity and side effects. A typical dose can be, for example, in the rage of 0.001 to 1000 g; however, doses below or above this exemplary range are within the scope of the invention. The daily dose can be about 0.1 g/kg to about 100 mg/kg of total body weight (e.g., about 5 g/kg, about 10 g/kg, about 100 g/kg, about 500 g/kg, about 1 mg/kg, about 50 mg/kg, or a range defined by any two of the foregoing values), preferably from about 0.3 g/kg to about 10 mg/kg of total body weight (e.g., about 0.5 g/kg, about 1 g/kg, about 50 g/kg, about 150 g/kg, about 300 g/kg, about 750 g/kg, about 1.5 mg/kg, about 5 mg/kg, or a range defined by any two of the foregoing values), more preferably from about 1 g/kg to 1 mg/kg of total body weight (e.g., about 3 g/kg, about 15 g/kg, about 75 g/kg, about 300 g/kg, about 900 g/kg, or a range defined by any two of the foregoing values), and even more preferably from about 0.5 to 10 mg/kg body weight per day (e.g., about 2 mg/kg, about 4 mg/kg, about 7 mg/kg, about 9 mg/kg, or a range defined by any two of the foregoing values). As noted above, therapeutic or prophylactic efficacy can be monitored by periodic assessment of treated patients. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and are within the scope of the invention. The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.

(258) A pharmaceutical composition comprising a non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) can be administered one, two, three, or four times daily. The compositions can also be administered less frequently than daily, for example, six times a week, five times a week, four times a week, three times a week, twice a week, once a week, once every two weeks, once every three weeks, once a month, once every two months, once every three months, or once every six months. The compositions may also be administered in a sustained release formulation, such as in an implant which gradually releases the composition for use over a period of time, and which allows for the composition to be administered less frequently, such as once a month, once every 2-6 months, once every year, or even a single administration. The sustained release devices (such as pellets, nanoparticles, microparticles, nanospheres, microspheres, and the like) may be administered by injection

(259) A non-naturally occurring chagasin scaffold protein described herein (such as a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 and/or a non-naturally occurring chagasin scaffold protein that specifically binds VEGF) may be administered in a single daily dose, or the total daily dose may be administered in divided dosages of two, three, or four times daily. The compositions can also be administered less frequently than daily, for example, six times a week, five times a week, four times a week, three times a week, twice a week, once a week, once every two weeks, once every three weeks, once a month, once every two months, once every three months, or once every six months. The compositions may also be administered in a sustained release formulation, such as in an implant which gradually releases the composition for use over a period of time, and which allows for the composition to be administered less frequently, such as once a month, once every 2-6 months, once every year, or even a single administration. The sustained release devices (such as pellets, nanoparticles, microparticles, nanospheres, microspheres, and the like) may be administered by injection or surgically implanted in various locations.

(260) Pharmaceutical Formulations

(261) The non-naturally occurring chagasin scaffold proteins disclosed herein (such as those that specifically bind LRP6 or those that specifically bind VEGF) can be formulated with suitable carriers or excipients so that they are suitable for administration. Suitable formulations of the non-naturally occurring chagasin scaffold proteins disclosed herein are obtained by mixing non-naturally occurring chagasin scaffold proteins disclosed herein having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as olyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN, PLURONICS or polyethylene glycol (PEG). Exemplary antibody formulations, which can be applied to the non-naturally chagasin scaffold proteins provided herein, are described in WO98/56418, expressly incorporated herein by reference. Lyophilized formulations adapted for subcutaneous administration are described in W097/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the mammal to be treated herein.

(262) The formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide an anti-neoplastic agent, a growth inhibitory agent, a cytotoxic agent, or a chemotherapeutic agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended. The effective amount of such other agents depends on the amount of non-naturally occurring chagasin scaffold protein present in the formulation, the type of disease or disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein or about from 1 to 99% of the heretofore employed dosages. The active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Sustained-release preparations may be prepared. Suitable examples of sustained release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antagonist, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and. ethyl-L-glutamate, non-degradable ethylene-vinyl, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-()-3-hydroxybutyric acid.

(263) Lipofectins or liposomes can be used to deliver the non-naturally occurring chagasin scaffold proteins disclosed herein (such as those that specifically bind LRP6 or those that specifically bind VEGF) or compositions provided herein into cells.

(264) The active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's PHARMACEUTICAL SCIENCES, supra.

(265) Sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing a non-naturally occurring chagasin scaffold protein disclosed herein, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-()-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydro gels release proteins for shorter time periods. When encapsulated chagasin scaffold proteins remain in the body for a long time, they can denature or aggregate as a result of exposure to moisture at 37 C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular SS bond formation through thio-disulfide interchange, stabilization can be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.

(266) The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.

(267) Diagnosis and Imaging Using Non-Naturally Occurring Chagasin Scaffold Proteins

(268) Non-naturally occurring chagasin scaffold proteins described herein (such as those that specifically bind LRP6 and/or those that specifically bind VEGF) can be used to detect, e.g., LRP6 protein or VEGF protein, in patient samples (e.g., via FACS, immunohistochemistry (IHC), ELISA assays) or in patients. Labeled non-naturally occurring chagasin scaffold proteins (such as those that that specifically bind human LRP6 or that specifically bind human VEGF) can be used for diagnostic purposes to detect, diagnose, or monitor diseases and/or disorders associated with the expression, aberrant expression and/or activity a target ligand (such as LRP6 or VEGF). For example, the non-naturally occurring chagasin scaffold proteins provided herein can be used in in situ, in vivo, ex vivo, and in vitro diagnostic assays or imaging assays.

(269) Provided are methods for detecting expression of a human LRP6 comprising (a) assaying the expression of the polypeptide in cells (e.g., tissue) or body fluid of an individual using one or more non-naturally occurring chagasin scaffold proteins that specifically bind human LRP6 and (b) comparing the level of LRP6 expression with a standard LRP6 expression level, whereby an increase or decrease in the assayed LRP6 expression level compared to the standard expression level is indicative of aberrant expression. Also provided are methods for detecting expression of a human VEGF comprising (a) assaying the expression of the polypeptide in cells (e.g., tissue) or body fluid of an individual using one or more non-naturally occurring chagasin scaffold proteins that specifically bind human VEGF and (b) comparing the level of VEGF expression with a standard VEGF expression level, whereby an increase or decrease in the assayed VEGF expression level compared to the standard expression level is indicative of aberrant expression.

(270) Additional embodiments include methods of diagnosing a disease or disorder associated with expression or aberrant expression of LRP6 in an animal (e.g., a mammal such as a human). The methods comprise detecting LRP6 molecules in the mammal. In certain embodiments, diagnosis comprises: (a) administering an effective amount of a labeled non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 to a mammal (b) waiting for a time interval following the administering for permitting the labeled chagasin scaffold protein to preferentially concentrate at sites in the subject where the LRP6 molecule is expressed (and for unbound labeled molecule to be cleared to background level); (c) determining background level; and (d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with expression or aberrant expression of LRP6. In certain embodiments, diagnosis comprises: (a) administering an effective amount of a labeled non-naturally occurring chagasin scaffold protein that specifically binds human VEGF to a mammal (b) waiting for a time interval following the administering for permitting the labeled chagasin scaffold protein to preferentially concentrate at sites in the subject where the VEGF molecule is expressed (and for unbound labeled molecule to be cleared to background level); (c) determining background level; and (d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with expression or aberrant expression of VEGF. Background level can be determined by various methods including, comparing the amount of labeled molecule detected to a standard value previously determined for a particular system.

(271) Labeled chagasin scaffold proteins described herein (such as labeled chagasin scaffold proteins that specifically bind human LRP6 or labeled chagasin scaffold proteins described herein that specifically bind human VEGF) can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, et al., J. Cell. Biol. 105:3087-3096 (1987)). Other methods useful for detecting protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable protein assay labels are known in the art and include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine (.sup.131I, .sup.125I, .sup.123I, .sup.121I) carbon (.sup.14C), sulfur .sup.35S), tritium (.sup.3H), indium (.sup.115mIn, .sup.113mIn, .sup.112In, .sup.111In), and technetium (.sup.99Tc, .sup.99mTc), thallium .sup.201Ti), gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Pd) molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.153Sm, .sup.177Lu, .sup.159Gd, .sup.149Pm, .sup.140La, .sup.175Yb, .sup.166Ho, .sup.90Y, .sup.47Sc, .sup.186Re, .sup.188Re, .sup.142Pr, .sup.105Rh, .sup.97Ru; luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin.

(272) Techniques known in the art may be applied to labeled non-naturally occurring chagasin scaffold proteins provided herein (e.g., such as labeled non-naturally occurring chagasin scaffold proteins that specifically bind human LRP6 or labeled non-naturally occurring chagasin scaffold proteins that specifically bind human VEGF). Such techniques include, but are not limited to, the use of bifunctional conjugating agents (see e.g., U.S. Pat. Nos. 5,756,065; 5,714,631; 5,696,239; 5,652,361; 5,505,931; 5,489,425; 5,435,990; 5,428,139; 5,342,604; 5,274,119; 4,994,560; and 5,808,003). One can also study LRP6 or VEGF overexpression by measuring shed antigen in a biological fluid such as serum, e.g., using labeled chagasin scaffold-based assays (see also, e.g., U.S. Pat. No. 4,933,294 issued Jun. 12, 1990; WO91/05264 published Apr. 18, 1991; U.S. Pat. No. 5,401,638 issued Mar. 28, 1995; and Sias et al., J. Immunol. Methods 132:73-80 (1990)). Aside from the above assays, various in vivo and ex vivo assays are available to the skilled practitioner. For example, one can expose cells within the body of the mammal to an chagasin scaffold protein which is optionally labeled with a detectable label, e.g., a radioactive isotope, and binding of the chagasin scaffold protein to the target ligand (e.g., LRP6 or VEGF) can be evaluated, e.g., by external scanning for radioactivity or by analyzing a sample (e.g., a biopsy or other biological sample) taken from a mammal previously exposed to the chagasin scaffold protein.

(273) Articles of Manufacture and Kits

(274) In certain embodiments, provided herein is an article of manufacture containing a non-naturally occurring chagasin scaffold protein described herein that specifically binds LRP6 and materials useful for the treatment of, e.g., cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease. In certain embodiments, provided herein is an article of manufacture containing a non-naturally occurring chagasin scaffold protein described herein that specifically binds VEGF and materials useful for the treatment of a disease or disorder characterized by abnormal angiogenesis and/or abnormal vascular permeability, or any other disease characterized by abnormal VEGF activity or expression (such as those described elsewhere herein).

(275) The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. Generally, the container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is a non-naturally occurring chagasin scaffold protein described herein that specifically binds LRP6 or a non-naturally occurring chagasin scaffold protein described herein that specifically binds VEGF. The label or package insert indicates that the composition is used for treating the particular condition. The label or package insert will further comprise instructions for administering the chagasin scaffold composition to the patient. Articles of manufacture and kits comprising combinatorial therapies described herein are also contemplated.

(276) Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products. In certain embodiments, the package insert indicates that the composition comprising the non-naturally occurring chagasin scaffold protein that specifically binds LRP6 is used for treating cancer and metastatic disease, osteoporosis and other bone metabolism and disease, neuronal and neurodegenerative disease, rheumatoid arthritis and other inflammatory disease. In certain embodiments, the package insert indicates that the composition comprising the non-naturally occurring chagasin scaffold protein that specifically binds VEGF is used for treating a disease or disorder characterized by abnormal angiogenesis and/or abnormal vascular permeability, or any other disease characterized by abnormal VEGF activity or expression (such as those described elsewhere herein). Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.

(277) Kits are also provided that are useful for various purposes, e.g., for isolation or detection of LRP6 or VEGF in patients, optionally in combination with the articles of manufacture. For isolation and purification of LRP6, the kit can contain a non-naturally occurring chagasin scaffold protein that specifically binds LRP6 described herein coupled to beads (e.g., sepharose beads). For isolation and purification of VEGF, the kit can contain a non-naturally occurring chagasin scaffold protein that specifically binds VEGF described herein coupled to beads. Kits can be provided which contain the non-naturally occurring chagasin scaffold proteins described herein for detection and quantitation of LRP6 or VEGF in vitro, e.g. in an ELISA or blot. As with the article of manufacture, the kit comprises a container and a label or package insert on or associated with the container. For example, the container holds a composition comprising at least one non-naturally occurring chagasin scaffold protein described herein that specifically binds LRP6 or at least one non-naturally occurring chagasin scaffold protein described herein that specifically binds VEGF. Additional containers may be included that contain, e.g., diluents and buffers, control antibodies, etc. The label or package insert may provide a description of the composition as well as instructions for the intended in vitro or diagnostic use.

EXAMPLES

Example 1: Materials and Methods

(278) Chagasin Cloning and Phagemid Construct Design

(279) The chagasin gene was synthesized with an optimized codon usage with the following sequence:

(280) TABLE-US-00013 (SEQIDNO:91) ATGTCCCACAAGGTGACGAAAGCCCATAACGGTGCGACCTTGACGGTGG CCGTCGGCGAGCTGGTGGAGATTCAGCTTCCGAGCAATCCGACCACTGG GTTCGCGTGGTATTTTGAAGGTGGTACCAAAGAAAGTCCGAATGAATCC ATGTTCACCGTCGAGAATAAGTACTTTCCGCCGGACAGTAAACTGTTGG GTGCTGGCGGGACGGAGCACTTTCATGTGACAGTGAAGGCGGCGGGTAC GCACGCAGTAAATCTCACTTACATGCGCCCGTGGACAGGCCCGTCGCAC GATTCCGAGCGTTTCACTGTATATCTCAAGGCAAAC

(281) The chagasin gene was amplified by PCR with an N-terminal epitope tag (gD-tag) MADPNRFRGKDLGSLE (SEQ ID NO: 92) (N J Skelton et al., J Biol Chem 278, 7645-7654, 2003) and cloned into the phagemid vector (S S Sidhu et al., Methods Enzymol 328, 333-363, 2000; R Tonikian et al., Nat Protoc 2, 1368-1386, 2007) between a MalE signal peptide and phage coat proteins g3 or g8 including a (GGS).sub.3 linker before the coat protein. Chagasin containing phagemid vectors were modified using Kunkel mutagenesis (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007) by replacing the three loop regions of chagasin with two stop codons. Alternatively, a TAG amber stop codon was introduced after the chagasin gene for some libraries to reduce the display level. These constructs were used as Kunkel templates for library production using oligonucleotides synthesized with either NNK codons or from trinucleotide at positions selected for randomization (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007).

(282) Determination of Chagasin Display on Phage

(283) Phage displaying gD-tagged chagasin fused to either coat protein p3 or p8 were produced as described (SS Sidhu et al., Methods Enzymol 328, 333-363, 2000; R Tonikian et al., Nat Protoc 2, 1368-1386, 2007). Binding of purified phage against an anti-gD antibody (Genentech, Inc.) or papain was measured by phage ELISA with serial 2-fold dilution of phage solution starting at 2.510.sup.12 phage per ml and detected using an anti-M13 HRP-conjugated antibody (NEB).

(284) Alanine Scanning of Chagasin Loops

(285) Three alanine scanning libraries were made each containing two randomized loops simultaneously (L2 and L4, L2 and L6, L4 and L6) for analysis. The following positions in loops 2, 4 and 6 (Ser28 to Phe34, Pro59 to Gly69 and Arg91 to Ser100, respectively) were randomized using alanine shotgun scanning codons (GA Weiss et al., Proc Natl Acad Sci USA 97, 8950-8954, 2000). Two rounds of affinity selection were performed using anti-gD antibody coated MAXISPORP immunoplates (Nunc) and selected phage clones were analyzed by phage spot ELISA and DNA sequencing using methods previously described (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007).

(286) Naive Chagasin Phage Library Design

(287) Chagasin libraries were made using methods essentially as described (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007). Chagasin phagemid constructs, in which DNA encoding for residue positions in L2, L4 and L6 (28-34, 59-69 and 91-100, respectively) were replaced with two stop codons, served as Kunkel templates.

(288) TABLE-US-00014 TABLE5 ResiduePositionsChosenForRandomization L2: SNPX.sub.2GF SEQIDNO:93 L2: SNX.sub.4GF SEQIDNO:94 L4: PX.sub.6-14GAGG SEQIDNO:95 L6: RPWTGPSHDS SEQIDNO:84

(289) Amino acid residue positions in bold type were chosen for randomization in chagasin loops L2, L4, and L6 based on alanine scanning results (Example 2) and extra residue insertions in L2 (Example 3). The underlined positions were fixed in conservative libraries. Seven oligonucleotides were designed based on selected positions for randomization (X) shown in Table 5 above using NNK codons:

(290) TABLE-US-00015 L2-X2: (SEQIDNO:96) GGAGATTCAGCTTCCGAGCAATCCGNNKNNKGGGTT CGCGTGGTATTTTGAAGG L2-X4: (SEQIDNO:97) GGAGATTCAGCTTCCGAGCAATNNKNNKNNKNNKGG GTTCGCGTGGTATTTTGAAGG L4-X6: (SEQIDNO:98) GTCGAGAATAAGTACTTTCCGNNKNNKNNKNNKNNK NNKGGTGCTGGCGGGACGGAGCACTTTCATGTG L4-X8: (SEQIDNO:99) GTCGAGAATAAGTACTTTCCGNNKNNKNNKNNKNNK NNKNNKNNKGGTGCTGGCGGGACGGAGCACTTTCAT GTG L4-X10: (SEQIDNO:100) GTCGAGAATAAGTACTTTCCGNNKNNKNNKNNKNNK NNKNNKNNKNNKNNKGGTGCTGGCGGGACGGAGCAC TTTCATGTG L6-X4GX5: (SEQIDNO:101) GTAAATCTCACTTACATGNNKNNKNNKNNKGGTNNK NNKNNKNNKNNKGAGCGTTTCACTGTATATC L6-XPX2GPX4: (SEQIDNO:102) GTAAATCTCACTTACATGNNKCCANNKNNKGGTCCG NNKNNKNNKNNKGAGCGTTTCACTGTATATC

(291) A total of 8 naive individual libraries were made with these oligonucleotides where either L4 alone, L4 and L2 or all 3 loops contained randomized positions. (See Table 6 below.) Between 8 and 21 residues were randomized simultaneously.

(292) TABLE-US-00016 TABLE 6 Nave Chagasin Libraries Chagasin Library L2 Loop L4 Loop L6 Loop Pool g3-display X.sub.2 X.sub.6 WT B (SEQ ID NO: 104) g3-display X.sub.4 X.sub.8 WT (SEQ ID (SEQ ID NO: 105) NO: 103) g3-display X.sub.2 X.sub.6 X.sub.4GX.sub.5 C (SEQ ID NO: 104) (SEQ ID NO: 107) g3-display X.sub.2 X.sub.8 XPX.sub.2GPX.sub.4 (SEQ ID NO: 105) (SEQ ID NO: 108) g3-display X.sub.4 X.sub.8 X.sub.4GX.sub.5 (SEQ ID (SEQ ID NO: 105) (SEQ ID NO: 107) NO: 103) g3-display X.sub.4 X.sub.8 X.sub.4GX.sub.5 (SEQ ID (SEQ ID NO: 105) (SEQ ID NO: 107) NO: 103) g8-display WT X.sub.8 WT A (SEQ ID NO: 105) g8-display WT X.sub.10 WT (SEQ ID NO: 106)

(293) Phage Panning

(294) Phage panning in solution or on coated plates was carried out essentially as described (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007; Y Zhang et al., J Biol Chem 289, 942-955, 2014). Four rounds of phage panning were performed to enrich for target specific binders. Library panning for LRP6 was always done in solution, while initial naive library panning against VEGF109 was done on plates and then switched to solution sorting during affinity maturation. After the fourth round of panning, 96 clones from each library or library pool were individually produced and analyzed by phage ELISA and DNA sequencing. During solution phage panning, the target protein concentration was adjusted from round to round (ranging from 500 nM to 0.5 nM).

(295) Affinity Maturation of Target Specific Chagasin Binders

(296) Target specific chagasin binders to LRP6 or VEGF109 were affinity matured by soft randomization of the selected new sequences in the loops. Soft randomized libraries were constructed using degenerate oligonucleotides synthesized with 70-10-10-10 mixtures of nucleotide bases, in which the wild-type base is in excess. This results in the wild-type amino acids occurring at approximately 50% in frequency at the targeted position and approximately 50% for all other amino acids. Phage panning of these new libraries was carried out as described above, and WebLogo plots were generated using the online software WebLogo 3.3.

(297) Expression and Purification of LRP6

(298) LRP6 E1E2 with a C-terminal Avi-tag and His.sub.6-tag was produced as previously described (E Bourhis et al., J Biol Chem 285, 9172-9179, 2010). Biotinylation was carried out using a kit (GeneCopoeia) according to manufacturer's protocol.

(299) Expression and Purification of Chagasin Variants

(300) Chagasin variants were cloned into pET52b vector backbone with N-terminal His.sub.6-GST-tag, separating the chagasin variant by a TEV cleavage site. Constructs were transformed into BL21 STAR E. coli cells (Invitrogen) and expressed in TB auto media at 16 C. for 72 hours at 200 rpm. Cell pellet was harvested by centrifugation and lysed in PBS buffer with a microfluidizer. After centrifugation at 50,000 g, cell lysate was subjected to Ni-NTA SUPERFLOW affinity purification (Qiagen) according to manufacturer's protocol followed by size exclusion chromatography on a SUPERDEX 200 column (GE Healthcare Life Sciences) in 20 mM Tris pH 8 and 150 mM NaCl at 30 cm/h flow rate. Fractions containing GST-fused chagasin variants were concentrated and cleaved with TEV protease (25 g TEV per mg GST-chagasin) overnight at room temperature, supplemented with 1 mM DTT. Cleaved chagasin variants were isolated using SUPERDEX 75 size exclusion chromatography (GE Healthcare Life Sciences) in 20 mM Tris pH 8 and 150 mM NaCl at 30 cm/h flow rate and concentrated.

(301) Small scale expression of chagasin variants with STREP-TAG II (IBA GmbH). We introduced DNA sequence encoding for a STREP-TAG II (SAWSHPQFEK) at the C-terminus of chagasin in phagemid containing chagasin variants. The Ser-Ala residues incorporated improve the affinity for STREPMAB-IMMO. Transformed E. coli strain 33D3 (Genentech, Inc.) containing these phagemid variants were grown to log-phase and induced with 0.5 mM IPTG and grown at 30 C. overnight. Cells were removed by centrifugation at 10,000 g and supernatant medium contained secreted chagasin variants with STREP-TAG II that were then used for binding studies on the OCTET RED384 kinetic analysis system.

(302) Small Scale Expression of Chagasin Variants Using the EXIPROGEN Automated Protein Synthesis System

(303) DNA encoding chagasin variants were amplified with C-terminal His.sub.6-tag and Avi-tag using the EXIPROGEN ProXpress template kit according to manufacturer's protocol (Bioneer). Proteins were produced using the EXIPROGEN EC1 protein synthesis kit (Bioneer) on the EXIPROGEN instrument (Bioneer) with the addition of BirA and d-biotin (Avidity, LLC) to obtain 20-40 g of purified biotinylated protein from Ni-affinity chromatography.

(304) Wnt1 Cell-Based Assay

(305) The luciferase reporter assay in HEK293S cells transfected by WNT1 was performed as described (Y Zhang et al., Nat Chem Biol 5, 217-219, 2009; Y Gong et al., PLoS One 5, e12682, 2010). Purified chagasin LRP6 variants and inhibitors were serially diluted 2-fold and added as indicated.

(306) VEGFR1-VEGF Competition Binding ELISA

(307) This assay was conducted as described previously (J Bostrom et al., Science 323, 1610-1614, 2009). MAXISORP immunoplates were coated with VEGFR1-Fc (5 pg/ml) in PBS overnight. 0.4 nM of biotinylated VEGF165 (labeling performed with NHS-PEG4-biotin from PIERCE according to their protocol) was mixed 1:1 with serial titration of VEGF binders for 2 hours prior to incubating it with VEGFR1-Fc coated plates for 15 min. After washing with PBS containing 0.05% TWEEN 20, binding was detected with HRP-conjugated NEUTRAVIDIN and TMB substrate (PIERCE) with a spectrophotometer at 450 nm. VEGF109, 165 and VEGFR1-Fc were generously provided by Germaine Fuh (Genentech, Inc.).

(308) Cellular VEGF Receptor Inhibition Assay

(309) Inhibition of VEGF signaling on cells through the receptor KDR was measured essentially as described (MD Sadick et al., J Pharm Biomed Anal 19, 883-891, 1999; H Gille et al., J Biol Chem 276, 3222-3230, 2001). A constant amount of either 25 or 50 ng/mL of human, mouse or rat VEGF were mixed with various concentrations of chagasin variants or inhibitors prior to stimulating KDR-expressing CHO cells.

(310) Kinetic Binding Measurements Using the OCTET RED384 Kinetic Analysis System

(311) Binding affinities of chagasin variants for the targets LRP6 and VEGF109 were measured using the OCTET RED384 kinetic analysis system (FORTEBIO). All washes, dilutions and measurements were performed in PBS-based kinetics buffer (FORTEBIO) with the plate shaking at 1000 rpm. Streptavidin biosensors (FORTEBIO) were equilibrated in kinetics buffer for 5 min and then loaded with either biotinylated LRP6-E1E2 or biotinylated VEGF109 (20 g/ml) to a density of 2 nm signal difference, followed by a 3 min washing step. For the association phase, the ligand coated streptavidin biosensors were in chagasin variant containing solutions (7 serial 2-fold dilutions, starting at 1000 or 250 nM). Dissociation of the chagasin variant-target complex was measured in wells containing kinetics buffer alone for up to 30 min. Sensorgrams with ligand-loaded streptavidin biosensors going through wells containing only buffer in both association and dissociation measurement were used as reference for background subtraction. Kd, k.sub.a and k.sub.d were determined using the OCTET evaluation software v7.0.1.3. using a 1:1 binding model with global fitting. Alternatively, AMC-biosensors (Fortebio) were loaded with STREPMAB-IMMO (IBA GmbH) to saturation and subsequently used to capture STREP-TAG II containing chagasin variants to saturation. After 5 min of washing in kinetics buffer, binding kinetics to unlabeled LRP6-E1E2 fragment was determined essentially as described above.

Example 2: Determination of Amino Acid Positions for Randomization in Chagasin Loops

(312) In order verify compatibility of chagasin with phage, the chagasin wild-type (wt) gene was fused with an N-terminal epitope-tag (gD-tag) (NJ Skelton et al., J Biol Chem 278, 7645-7654, 2003) to the N-terminus of either g3 or g8 in a phagemid vector (SS Sidhu et al., Methods Enzymol 328, 333-363, 2000; R Tonikian et al., Nat Protoc 2, 1368-1386, 2007) and tested for its display and binding against papain or an anti-gD antibody. In both p3- and p8-fusion display modes, chagasin showed specific binding to papain in a phage titration ELISA and had no detectable binding to BSA (see FIG. 2). Phage concentration was determined by the OD at 268 nm and titrated against either anti-gD antibody or papain. Both binding events were specific when compared to binding to BSA as a control.

(313) The positions in Loops 2, 4 and 6 that could be randomized for generating a naive chagasin protein library were then determined. Conformation-specific antibodies to chagasin to capture displayed chagasin variants are currently not available. Thus, in order to determine the tolerability of a given position, alanine scanning was performed to identify the amino acid position(s) at which either the wild-type residue or alanine was allowed to occur. In some case, due to the degeneration of the genetic code, two other amino acids were also possible instead of either wild-type or alanine (GA Weiss et al., Proc Natl Acad Sci USA 97, 8950-8954, 2000). Phage libraries displaying chagasin variants were captured via the N-terminal gD-tag on MAXI SORP immunoplates coated with anti-gD antibody, where only chagasin variants that were properly folded would be well displayed for capture. If a wild-type residue was essential for stability, it would be expected to dominate in this position over alanine, whereas a position with equal occurrence of alanine and wild-type residue would indicate tolerance for alanine and likely other residues. Positions with equal occurrence of alanine and wild-type residues were thus chosen as positions for randomization.

(314) Three alanine scanning libraries with two loops scanned in pairs simultaneously (L2+L4, L2+L6, L4+L6) were made and subjected to two rounds of panning using a standard procedure (R Tonikian et al., Nat Protoc 2, 1368-1386, 2007). The DNA sequences of 96 individually picked clones from each library were obtained and the frequency/probability of the residues appearing at each randomized position was analyzed using a logo plot using WebLogo 3.3. Loop 2 contains the sequence SNPTT (SEQ ID NO: 4) and allowed for alanine substitution for the two threonines (positions 31 and 32) with some co-dependency of Thr32 with variations in L4. Either Asn or Asp was preferred at position 29, but all other positions showed high preference for wild-type residues. Loop 4 contains the wild-type sequence PPDSKLLGAGG (SEQ ID NO: 149) and showed some preference for Pro59 and Ser62, but not as significant to exclude these positions from randomization. Gly66 and Gly69 were highly preferred residues in Loop 4. Loop 6 contains the sequence RPWTGPSHDS (SEQ ID NO: 84) and showed no strong preference for wild-type residues in any of the positions.

Example 3: Investigation of L2 Loop Elongation for Library Design

(315) Next, tests were performed to determine whether Loop 2 could be extended without significantly affecting protein stability. Five libraries containing 1, 2, 3, 5 or 7 extra random residues in L2 between Asn30 and Gly33 were constructed and subjected them to two rounds of anti-gD antibody sorting to select for displayed chagasin variants. A total of 96 phage clones from each library were analyzed for chagasin display level by phage spot ELISA. Insertion of up to 3 residues in L2 resulted in clones with a very homogeneous display level binding to anti-gD antibody and a very low level of binding to BSA. Insertions of more than 3 residues showed reduced display level of chagasin variants with increased nonspecific binding, as measured by binding to BSA.

Example 4: Chagasin Library Design

(316) Based on the positional alanine scanning of each loop as well as the loop length selection for L2, specific positions shown in Table 4 above were chosen for randomization. Eight naive chagasin protein libraries were designed and displayed on phage, i.e., 6 libraries on g3 and 2 libraries on g8 (Table 6 above). Since L4 can vary in length between 10-21 residues amongst chagasin homologs (D Salmon et al., J Mol Biol 357, 1511-1521, 2006), different length variations in this loop were not tested for their stability and sequence composition by panning a library against the anti-gD antibody.

Example 5: Generation of Chagasin Variants that Bind Target Proteins

(317) In order to verify the utility of chagasin as a scaffold and its ability to yield variants that bind with high affinity, specificity and activity against other proteins than cysteine proteases, Wnt signaling co-receptor LRP6 (K I Pinson et al., Nature 407, 535-538, 2000; K Tamai et al., Nature 407, 530-535, 2000) and the growth factor VEGF (D W Leung et al., Science 246, 1306-1309, 1989) were chosen as target proteins for phage panning. Both LRP6 (V E Ahn et al., Dev Cell 21, 862-873, 2011; E Bourhis et al., Structure 19, 1433-1442, 2011; Z Cheng et al., Nat Struct Mol Biol 18, 1204-1210, 2011) and VEGF (Y A Muller et al., Proc Natl Acad Sci USA 94, 7192-7197, 1997; C Wiesmann et al., Cell 91, 695-704, 1997) and are structurally and functionally well characterized. VEGF used herein refers to VEGF-A, which has various forms (B A Keyt et al., J Biol Chem 271, 7788-7795, 1996). VEGF109 refers to the protein containing residues 8-109 (also referred to as VEGF109; VEGF8-109; VEGF.sub.8-109) and VEGF165 refers the protein containing residues 1-165 (also referred to as VEGF165; VEGF1-165; VEGF.sub.1-165; VEGF.sub.165.

(318) Generation of Chagasin Variants that Bind LRP6

(319) The 8 naive chagasin libraries were first subjected individually to 4 rounds of solution phage panning (Y Zhang et al., J Biol Chem 289, 942-955, 2014) against the C-terminally Avi-tagged LRP6 receptor fragment E1E2 (E Bourhis et al., Structure 19, 1433-1442, 2011). All libraries generated chagasin variants that specifically bound to LRP6-E1E2 as determined by phage spot ELISA with phage titer enrichments for target binding ranging from 0 to 100-fold in the last round of panning.

(320) A functional protein-protein interaction site in the first -propeller domain (E1) of LRP6 that selectively binds to a linear NXIK peptide motif has been described (E Bourhis et al., Structure 19, 1433-1442, 2011). The crystal structures of LRP6-E1 in complex with either the anti-LRP6 inhibitory antibody (YW210.09) or peptides from the natural inhibitor Dkk1, SOST or peptides derived phage display reveal a consistent interaction of these binding partners, exemplified by the Dkk1 peptide Ac-NSNAIKN-NH.sub.2 (SEQ ID NO: 109), with the receptor fragment (FIG. 3).

(321) Sequence analysis of chagasin LRP6 variants (chagasin variants that specifically bound to LRP6) exhibited a strong preference for the NXIK sequence motif primarily in the randomized loop L4. Twenty-one variants that exhibited strong target binding and specificity in the phage spot ELISA were selected from libraries that were randomized in either L4 only, L2 and L4 or in all 3 loops. The variants were expressed in small scale as secreted proteins from E. coli with a C-terminal STREP-TAG II (TG Schmidt and A Skerra, Nat Protoc 2, 1528-1535, 2007). Their binding kinetics were profiled and ranked by biolayer interferometry (BLI) measurements on an OCTET RED384 kinetic analysis system, where AMC tips were loaded with STREPMAB-IMMO capture antibody to immobilize chagasin LRP6 variants and the LRP6-E1E2 receptor fragment was in solution. Three LRP6 binders, variants H, P and S, had slow off-rate kinetics and binding affinities in the nanomolar range (Kd=6, 150, 70 nM, respectively) (FIG. 4). Variant S contained 2 cysteines that can form an intramolecular disulfide bond, but also forms homodimers with itself as detected by SDS-PAGE under nonreducing conditions. Variant H and variant S were both subjected to affinity maturation by making libraries where all 3 loops were soft randomized simultaneously. The resulting libraries were subjected to 3 rounds of stringent solution phage panning with 3 different target concentrations (0.5, 0.1, 0.05 nM) in last step. 384 phage clones were expressed individually and analyzed by phage spot ELISA for specificity and improved affinity. From the many good binders, the top 16 clones with the highest target binding specificity from library H and from library S (i.e., 32 clones in total) were chosen for small scale expression with C-terminal Avi-tag using the Bioneer EXIPROGEN system and their kinetic binding profiles to LRP6-E1E2 were characterized by BLI measurements. The top 4 clones with best binding kinetic profiles (fast on-rate, slow off-rate) were chosen for large-scale expression as GST-fused proteins (see Table 7 below).

(322) TABLE-US-00017 TABLE7 Top4Variantsoutof32Screenedon OctetRED384forHighAffinityBasedon TheirBindingKinetics Library Variant L2 L4 L6 H H2 SNPQT SNKVKGVPGF GPWTGASQEP (SEQID (SEQID (SEQID NO:3) NO:7) NO:11) H15 SNPTT SNKIKGIPGF RPSTGPSDDS (SEQID (SEQID (SEQID NO:4) NO:8) NO:12) S S11 SNVD SNSTKR PRVKGAYLVM (SEQID (SEQID (SEQID NO:5) NO:9) NO:13) S15 SNAD SNSTKR RREKGSTLVV (SEQID (SEQID (SEQID NOL:146) NO:9) NO:147)

(323) Clones H2, H15 and S11 all expressed well and resulted in monomeric chagasin LRP6 variants. Clone H2 and H15 had binding affinities (Kd) of 400 pM and 250 pM to LRP6-E1E2, respectively, whereas variant S11 had a binding affinity of 74 nM (FIG. 5).

(324) High Affinity Chagasin LRP6 Variants Inhibit Wnt-Dependent Cellular Signaling

(325) All three chagasin LRP6 variants were further characterization in a cell-based assay for their ability to block Wnt signaling (Y Zhang et al., Nat Chem Biol 5, 217-219, 2009; Y Gong et al., PLoS One 5, e12682, 2010). Different Wnt ligands bind to different parts of the LRP6 receptor (E Bourhis et al., J Biol Chem 285, 9172-9179, 2010). Wnt3a interacts with the E3 domain of LRP6, whereas Wnt1 interacts with the E1 domain, presumably at an overlapping site where the inhibitory antibody YW210.09 and Dkk1 bind (Y Gong et al., PLoS One 5, e12682, 2010). The monomeric chagasin LRP6 variants H2, H15 and S11 showed dose-dependent inhibition of Wnt1 signaling in this cell-based assay with IC.sub.50 values of 31, 26 and 400 nM, respectively (FIG. 6). In comparison, the bivalent inhibitory antibody YW210.09 had an IC.sub.50 of 28 nM, demonstrating that the monomeric variants H2 and H15 were equally potent reagents. All chagasin LRP6 variants resulted in complete inhibition at saturating concentrations in this assay. Wild-type chagasin does not inhibit Wnt1 signaling in this assay, nor does it interfere with normal cell growth. The high affinity chagasin LRP6 variants overlap with the YW210.09 binding epitope and utilize the same NXIK peptide binding site on E1 of LRP6.

(326) Generation of Chagasin Variants that Bind VEGF

(327) For generating chagasin VEGF variants (i.e., chagasin variants that specifically bind to VEGF), the 8 individual naive chagasin phage libraries were pooled into 3 groups (A, B, C), where pool A contained only libraries with different lengths of randomized Loop L4, pool B contained libraries with randomized L2 and L4 loops and pool C consisted of libraries where all 3 loops were randomized simultaneously (Table 6). These 3 library pools were subjected to 4 rounds of conventional plate sorting where VEGF was immobilized onto MAXISORP immunoplates (Y Chen et al., J Mol Biol 293, 865-881, 1999; R Tonikian et al., Nat Protoc 2, 1368-1386, 2007). A total of 96 individual phage clones from each library pool were grown and analyzed by phage spot ELISA for specific target binding. Only library pool C resulted in individual variants with high target binding and specificity, which was confirmed by phage titration against VEGF and BSA in an ELISA (FIG. 7). All 5 variants were produced as GST-fusion proteins and tested for their ability to block VEGF binding to VEGFR1-ECD Fc fusion in a competition binding ELISA (FIG. 8) (J Bostrom et al., Science 323, 1610-1614, 2009). Only variant 4 as a GST-fusion protein along with the G6 anti-VEGF antibody (G Fuh et al., J Biol Chem 281, 6625-6631, 2006; W C Liang et al., J Biol Chem 281, 951-961, 2006) were able to block VEGF binding to VEGFR1-ECD with IC.sub.50 values of 13 nM and 0.25 nM, respectively. Variant 3 showed fairly weak inhibition at higher concentrations, but none of the other binders had inhibitory activity. Monomeric chagasin VEGF variant 4 did not block VEGF binding in the same assay (FIG. 9). Without being bound by theory, this may be due to the fact that GST forms dimers and could lead to increased avidity for chagasin variants binding to VEGF that enhance potency in this assay. In this assay, both binding sites of the homodimeric VEGF need to be blocked in this assay to abrogate the signal effectively.

(328) Chagasin VEGF Variants Inhibit VEGF-Dependent Cellular Signaling

(329) We tested variant 4 as a GST-fusion as well as monomeric chagasin VEGF variant 4 in cell-based assays to see whether they are capable of blocking VEGF-dependent cellular signaling through its receptor KDR, where intracellular receptor phosphorylation is the readout (FIGS. 10A-10C and 11 and Tables 7 and 8 below) (H Gille et al., J Biol Chem 276, 3222-3230, 2001). In this assay, both GST-fused and monomeric variant 4 had inhibitory activity with IC.sub.50 values of 72 and 908 nM, respectively; none of the other GST-fused chagasin VEGF variants inhibited activity. Interestingly, variant 4 was specific to human VEGF, as it did not inhibit murine or rat VEGF-dependent signaling.

(330) TABLE-US-00018 TABLE 8 Inhibitory activity (IC.sub.50, nM) of VEGF-binding GST-chagasin variants against VEGF in cell-based assays Anti- Inhibitor VEGF (G6) GST-Variant 3 GST-Variant 4 GST-WT hVEGF 0.21 No blocking 28 No blocking (25 ng/ml) mVEGF 0.12 No blocking No blocking No blocking (50 ng/ml) rVEGF 0.13 No blocking No blocking No blocking (50 ng/ml)

(331) TABLE-US-00019 TABLE 9 Inhibitory activity (IC.sub.50, nM) of VEGF-binding GST-variant 4, variant 4, and anti-VEGF antibodies against VEGF in cell-based assays GST- Inhibitor Anti-VEGF (G6) Lucentis Variant 4 Variant 4 hVEGF 0.21 0.63 73 910 (25 ng/ml) mVEGF 0.19 No blocking No blocking No blocking (50 ng/ml) rVEGF 0.078 No blocking No blocking No blocking (50 ng/ml)

(332) Affinity Maturation of Chagasin VEGF Variant 4

(333) In order to improve the affinity and potency of monomeric VEGF variant 4, we designed 4 new libraries where the sequence of L2 and L6 of this variant were soft randomized and L4 contained either 6, 8 or 10 randomized position with a YSGX composition (excluding cysteine) (F A Fellouse et al., J Mol Biol 373, 924-940, 2007) or a soft randomized parental sequence. All libraries were subjected to 4 rounds of stringent solution phage panning (Y Zhang et al., J Biol Chem 289, 942-955, 2014). A total of 96 clones from each library were expressed as individual clones and analyzed by phage ELISA. From the 384 phage clones analyzed, 34 individual clones with high target specificity were identified (FIG. 12) and 23 clones were expressed in small scale using the EXIPROGEN protein synthesis system from Bioneer. FIG. 12 shows partial sequence of 33 phage clones with high target affinity and specificity to VEGF determined by phage spot ELISA. Randomized positions in loops 2, 4, 6 are in bold type. 23 variants produced in small scale using the EXIPROGEN protein synthesis system are marked with asterisks. The six variants produced for tests in cell-based assays are E4B-10, E4B-5, E4B-7, 37, L4X6-3, L4X8-9, and L4X6-7, as noted on the right side of FIG. 12. Cysteines are underlined.

(334) The binding kinetics of these 23 variants were profiled by BLI on an OCTET RED384 kinetic analysis system and the 6 best from these were expressed as GST-fusions in larger scale and purified as monomeric chagasin VEGF variants after cleavage by TEV protease. These 6 variants were tested for their ability to inhibit VEGF-dependent signaling through the KDR receptor on cells (H Gille et al., J Biol Chem 276, 3222-3230, 2001). Most of the variants showed relatively minor improvements in inhibition, but variants L4X6-7 and L4X8-9 had IC.sub.50 values of 65 and 301 nM, respectively, which represent 13- and 2-fold improvements over the parental chagasin variant 4 (FIG. 13 and Table 9 below). The affinity of L4X6-7 binding to VEGF was Kd=150 nM based on kinetic binding measurements (FIG. 14), which is a 2.5-fold improvement over the parental variant 4.

(335) TABLE-US-00020 TABLE 10 Inhibitory Activity (IC.sub.50, nM) of affinity matured VEGF-binding variants derived from variant 4 against hVEGF in cell-based assays Anti- VEGF Inhibitor (G6) Lucentis Variant 4 E4B-5 E4B-7 E4B-10 L4X6-3 L4X6-7 L4X8-7 hVEGF 0.14 0.68 840 800 550 610 710 65 300 (25 ng/ml)

(336) Identification of a Chagasin Homodimer Variant that Binds VEGF with Higher Affinity.

(337) Nine out of the 34 individual clones that showed a high degree of target specificity detected by phage ELISA contained a single cysteine at the same position in L2 (YFCD). Since the L4 loop still carried a lot of sequence variability after affinity maturation of the parental sequence and loops L2 and L6 showed only very minor changes and mostly preferred the parental sequence, L4 is likely not significantly involved in VEGF binding. Clone 37 that was displayed on g3 with an amber stop containing a single cysteine in L2 (YFCD) was selected and expressed as a GST-fusion. After GST removal by TEV cleavage and SUPERDEX 75 size exclusion chromatography, variant 37 started to spontaneously form homodimers under oxidizing conditions (FIG. 15). FIG. 15 shows SDS-PAGE analysis and binding kinetics of chagasin VEGF variants 37 and 66. Chagasin variant 37 forms dimers under oxidizing conditions that can be separated into monomers under reducing conditions. Binding kinetics of both binders were measured with biotinylated VEGF109 loaded on streptavidin biosensors on an OCTET RED384 kinetic analysis system. Both binders showed slow dissociation rates, with dimeric chagasin variant 37 being biphasic.

(338) Only a single clone (clone 66) that was displayed on g3 with an amber stop codon was found that did not contain any cysteines in any of the randomized loops. Chagasin variant 66 was produced on a small scale using the EXIPROGEN protein synthesis system and evaluated for binding to VEGF by BLI. This clone showed binding kinetic curves indicative of a double digit nanomolar binder (FIG. 15).

(339) After a large-scale protein expression and purification, it was noticed that chagasin variant 66 had limited solubility and would precipitate at concentrations needed for cell-based experiments and affinity measurements. Two new phage libraries based on the sequence of clone 66 were designed, where each variant contained only a single randomized position in loops L2 and L4 at the time, allowing to incorporate any of the 20 amino acid (NNK walk). The libraries were panned for 2 rounds as previously described in the affinity maturation procedure and 200 random clones from the last sort were selected for DNA sequencing and analysis. Based on the sequence analysis, two Tyrosine residues in L2 and L4 were replaced individually with other residues that were chosen as second tier based on their abundance in the sequenced clones. Four new clones (66-L2-K, 66-L4-Q, 66-L4-T, 66-L4-S) were expressed and purified as GST-fusion and individual chagasin variants were obtained by TEV cleavage as described above. Their affinity to VEGF109 was measured using an OCTET RED384 kinetic analysis system by Octet and their inhibitory activity was tested in the cell-based assay, as described above. The measured data of these variants is listed in Table 11, below:

(340) TABLE-US-00021 TABLE11 Chagasin IC.sub.50 VEGF K.sub.d Cell binder L2 L4 L6 (nM) assay Variant SNYYYD HYYNLGGRYT GPWLGPSRVL n.a. n.a. 66 (SEQID (SEQID (SEQID NO:48) NO:57) NO:66) Variant SNYYKD HYYNLGGRYT GPWLGPSRVL 61 186 66-L2-K (SEQID (SEQID (SEQID NO:110) NO:57) NO:66) Variant SNYYYD HYQNLGGRYT GPWLGPSRVL 80 95 66-L4-Q (SEQID (SEQID (SEQID NO:48) NO:111) NO:66) Variant SNYYYD HYSNLGGRYT GPWLGPSRVL 50 216 66-L4-S (SEQID (SEQID (SEQID NO:48) NO:112) NO:66) Variant SNYYYD HYTNLGGRYT GPWLGPSRVL 51 190 66-L4-T (SEQID (SEQID (SEQID NO:48) NO:113) NO:66)

(341) The preceding Examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.

List of Embodiments

(342) 1. A non-naturally occurring chagasin scaffold protein comprising at least one amino acid alteration in Loop 2 (L2), Loop 4 (L4), and/or Loop 6 (L6), with reference to a wild-type chagasin-like cysteine protease inhibitor.

(343) 2. The non-naturally occurring chagasin scaffold protein of embodiment 1, wherein the wild type chagasin-like cysteine protease inhibitor is from T. cruzi (Dm28c clone), T. cruzi (CL Brenner strain, isoform 1), T. cruzi (CL Brenner strain, isoform 2), T. brucei, L. mexicana, L. major, E. hystolytica, or P. aeruginosa.
3. The non-naturally occurring chagasin scaffold protein of embodiment 1, wherein the wild type chagasin-like cysteine protease inhibitor is from human CD8 T-cell surface glycoprotein, human interleukine-1 type 1 receptor (IL-1 R1), or human vascular cell adhesion molecule-1 (Vcam-1).
4. The non-naturally occurring chagasin scaffold protein of embodiment 2 or 3, wherein the wild type chagasin-like cysteine protease inhibitor is T. cruzi (CL Brenner strain, isoform 1) having the amino acid sequence set forth in SEQ ID NO: 1.
5. The non-naturally occurring chagasin scaffold protein of embodiment 4, wherein L2 comprises the amino acid sequence X.sub.5-8-GF (SEQ ID NO: 151), wherein X represents any amino acid.
6. The non-naturally occurring chagasin scaffold protein of embodiment 5, wherein L2 comprises the amino acid sequence SNX.sub.3-6-GF (SEQ ID NO: 152), wherein X represents any amino acid.
7. The non-naturally occurring chagasin scaffold protein of any one of embodiments 4-6, wherein L4 comprises the amino acid sequence X.sub.7-15-GAGG (SEQ ID NO: 153) wherein X represents any amino acid.
8. The non-naturally occurring chagasin scaffold protein of any one of embodiments 4-7, wherein L6 comprises the amino acid sequence X.sub.3-12 (SEQ ID NO: 154), wherein X represents any amino acid.
9. The non-naturally occurring chagasin scaffold protein of embodiment 8, wherein L6 comprises the amino acid sequence X.sub.10 (SEQ ID NO: 106) wherein X represents any amino acid.
10. The non-naturally occurring chagasin scaffold protein of any one of embodiments 4-9, comprising the amino acid sequence set forth in SEQ ID NO: 2.
11. The non-naturally occurring chagasin scaffold protein of any one of embodiments 1-10, wherein the non-naturally occurring chagasin scaffold protein specifically binds a target ligand.
12. The non-naturally occurring chagasin scaffold protein of embodiment 11, wherein the target ligand is a protein, a nucleic acid, a polysaccharide, a lipopolysaccharide, a lipid, or a phospholipid.
13. The non-naturally occurring chagasin scaffold protein of embodiment 12, wherein the target ligand is a protein.
14. The non-naturally occurring chagasin scaffold protein of embodiment 13, wherein the protein is a cell surface protein, a soluble protein, a viral protein, a bacterial protein, a protein associated with ocular disease, a protein associated with cancer, a protein associated with bone disease, a protein associated with inflammation, or a therapeutic protein.
15. The non-naturally occurring chagasin scaffold protein of embodiment 13, wherein the protein is LRP6.
16. The non-naturally occurring chagasin scaffold protein of embodiment 13, wherein the protein is VEGF.
17. The non-naturally occurring chagasin scaffold protein of any one of embodiments 1-16 conjugated to a therapeutic agent.
18. The non-naturally occurring chagasin scaffold protein of any one of embodiments 1-16 conjugated to a label.
19. The non-naturally occurring chagasin scaffold protein according to embodiment 18, wherein the label is selected from the group consisting of a radioisotope, a fluorescent dye, and an enzyme.
20. An isolated nucleic acid encoding the non-naturally occurring chagasin scaffold protein according to any one of embodiments 1-16.
21. An expression vector encoding the nucleic acid molecule of embodiment 20.
22. A cell comprising the expression vector of embodiment 21.
23. A method of producing the non-naturally occurring chagasin scaffold protein of any one of embodiments 1-16 comprising culturing the cell of embodiment 22 and recovering the non-naturally occurring chagasin scaffold protein from the cell culture.
24. A method of producing the non-naturally occurring chagasin scaffold protein of any one of embodiments 1-16 comprising chemically synthesizing the non-naturally occurring chagasin scaffold protein.
25. A composition comprising the non-naturally occurring chagasin scaffold protein of any one of embodiments 1-16 and a pharmaceutically acceptable carrier.
26. A polypeptide display library comprising a plurality of the non-naturally occurring chagasin scaffold proteins of any one of embodiments 1-16.
27. The polypeptide display library of embodiment 26, wherein the non-naturally occurring chagasin scaffold proteins are displayed on the surfaces of ribosomes, bacteriophage, viruses, bacteria, or yeast cells.
28. The polypeptide display library of embodiment 27, wherein the non-naturally occurring chagasin scaffold proteins are displayed on bacteriophage.
29. The polypeptide display library of embodiment 28, wherein the bacteriophage is a filamentous bacteriophage.
30. The polypeptide display library of embodiment 29, wherein the filamentous bacteriophage are M13 phage.
31. The polypeptide display library of any one of embodiments 26-30, wherein the polypeptide library has a sequence diversity of between about 10.sup.8 and about 10.sup.14.
32. Nucleic acid molecules encoding the polypeptide display library of any one of embodiments 26-31.
33. An expression vector operably linked to the nucleic acid molecules of embodiment 32.
34. A method of obtaining a non-naturally occurring chagasin scaffold protein that specifically binds to a target ligand, comprising: (a) contacting a target ligand with the library of any one of embodiments 26-31 under conditions that allow a non-naturally occurring chagasin scaffold protein: target ligand complex to form; (b) detecting the formation of the non-naturally occurring chagasin scaffold protein: target ligand complex; and, (c) obtaining from the complex the non-naturally occurring chagasin scaffold protein that specifically binds the target ligand.
35. The method of embodiment 34, further comprising randomizing L2, L4, and/or L6 of the non-naturally occurring chagasin scaffold protein obtained in step (c) to generate a further randomized non-naturally occurring chagasin scaffold protein and repeating steps (a) and (b) using said further randomized non-naturally occurring chagasin scaffold protein.
36. A non-naturally occurring chagasin scaffold protein that specifically binds to the same epitope as a second non-naturally occurring chagasin scaffold protein that binds human low density lipoprotein receptor-related protein 6 (LRP6), wherein the second non-naturally occurring chagasin scaffold protein that binds human LRP6 comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.
37. A non-naturally occurring chagasin scaffold protein that specifically binds human low density lipoprotein receptor-related protein 6 (LRP6), wherein the non-naturally occurring chagasin scaffold protein competes for binding with a second non-naturally occurring chagasin scaffold protein that binds human LRP6, wherein the second non-naturally occurring chagasin scaffold protein that binds human LRP6 comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.
38. The non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 of any one of embodiments 36 or 37, wherein the non-naturally occurring chagasin scaffold protein that specifically binds human LRP6 comprises an L2 that comprises the amino acid sequence SNP-T/S/A/Q-T/C/D (SEQ ID NO: 150) or SN-V/A-D (155), an L4 that comprises the amino acid sequence Y/S-N-N/K-I/V-R/K-G-L/V/I-PGF (SEQ ID NO: 156) or SN-Y/S-TK-H/R (SEQ ID NO: 157), or DSNEIWYC (SEQ ID NO: 77); and an L6 that comprises the amino acid sequence R/S/P/G-P/R-W/Y/E/S/V-T/Y/K/T-G-P/S/A-S/T/Y-H/K/L/Q/D-D/V/E-S/E/M/P/V (SEQ ID NO: 148), with reference to SEQ ID NO: 2.
39. The non-naturally occurring chagasin scaffold protein of embodiment 38, wherein L2 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 3-5, 78-80, and 146, L4 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 7-9, 77, and 81-83; and L6 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 11-13, 84-86, and 147, with reference to SEQ ID NO: 2.
40. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNPQT (SEQ ID NO: 3), wherein L4 comprises the amino acid sequence SNKVKGVPGF (SEQ ID NO: 7); and wherein L6 comprises the amino acid sequence GPWTGASQEP (SEQ ID NO: 11).
41. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNPTT (SEQ ID NO: 4), wherein L4 comprises the amino acid sequence SNKIKGIPGF (SEQ ID NO: 8); and wherein L6 comprises the amino acid sequence RPSTGPSDDS (SEQ ID NO: 12).
42. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNVD (SEQ ID NO: 5), wherein L4 comprises the amino acid sequence SNSTKR (SEQ ID NO: 9); and wherein L6 comprises the amino acid sequence PRVKGAYLVM (SEQ ID NO: 13).
43. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNPTT (SEQ ID NO: 4), L4 comprises the amino acid sequence YNNIRGLPGF (SEQ ID NO: 81); and L6 comprises the amino acid sequence RPWTGPSHDS (SEQ ID NO: 84), with reference to SEQ ID NO: 2.
44. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNPSC (SEQ ID NO: 79), L4 comprises the amino acid sequence DSNEIWYC (SEQ ID NO: 82); and L6 comprises the amino acid sequence SPYYGPTKVE (SEQ ID NO: 85), with reference to SEQ ID NO: 2.
45. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNPAD (SEQ ID NO: 80), L4 comprises the amino acid sequence SNYTKH (SEQ ID NO: 83); and L6 comprises the amino acid sequence PREKGSSLVM (SEQ ID NO: 86), with reference to SEQ ID NO: 2.
46. The non-naturally occurring chagasin scaffold protein of embodiment 39, wherein L2 comprises the amino acid sequence SNAD (SEQ ID NO: 146), L4 comprises the amino acid sequence SNSTKR (SEQ ID NO: 9); and an L6 that comprises the amino acid sequence RREKGSTLVV (SEQ ID NO: 147), with reference to SEQ ID NO: 2.
47. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 15.
48. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 16.
49. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 17.
50. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 87.
51. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 88.
52. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 89.
53. The non-naturally occurring chagasin scaffold protein of embodiment 39, comprising the amino acid sequence set forth in SEQ ID NO: 149.
54. The non-naturally occurring chagasin scaffold protein of any one of embodiments 36-53, wherein the non-naturally occurring chagasin scaffold protein binds a human LRP6 with a Kd between 500 nM and 1 pM.
55. The non-naturally occurring chagasin scaffold protein of any one of embodiments 36-54, wherein the chagasin-derived protein that specifically binds LRP6 inhibits Wnt1 signaling.
56. A non-naturally occurring chagasin scaffold protein that specifically binds to the same as a second non-naturally occurring chagasin scaffold protein that binds human vascular endothelial growth factor (VEGF), wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35), with reference to SEQ ID NO: 2.
57. A non-naturally occurring chagasin scaffold protein that specifically binds human vascular endothelial growth factor (VEGF), wherein the non-naturally occurring chagasin scaffold protein competes for binding with a second non-naturally occurring chagasin scaffold protein that binds human VEGF, wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35), with reference to SEQ ID NO: 2.
58. The non-naturally occurring chagasin scaffold protein embodiment 56 or 57, wherein the non-naturally occurring chagasin scaffold protein comprises an L2 that comprises the amino acid sequence SN-L/Y-R/F/Q-S/Y/N/D-M/D/A/S (SEQ ID NO: 23), an L4 that comprises the amino acid sequence A/N/L/S/V-G/D/S/R-P/L/T/A-S/G/Y/T-A/S/G/Q-V/R/S/K/A-P/L/E/S/N-L/S/T/N/E (SEQ ID NO: 29); and an L6 that comprises the amino acid sequence A/N/F/S-P/K-W/N/S/V-R/L/W-G-P/L-A/S/D/M/R-N/R/Y/V/F-V/W/P-I/L (SEQ ID NO: 35).
59. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 18-22, wherein L4 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 24-28; and wherein L6 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 30-34.
60. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises the amino acid sequence SNLRSM (SEQ ID NO: 18), wherein L4 comprises the amino acid sequence AGPSAVPL (SEQ ID NO: 24) and wherein L6 comprises the amino acid sequence APWRGPANVI (SEQ ID NO: 30).
61. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), wherein L4 comprises the amino acid sequence NDPGSRLS (SEQ ID NO: 25) and wherein L6 comprises the amino acid sequence APWLGPSRVL (SEQ ID NO: 31).
62. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises the amino acid sequence SNLQNA (SEQ ID NO: 20), wherein L4 comprises the amino acid sequence LSLYASET (SEQ ID NO: 26) and wherein L6 comprises the amino acid sequence NPNWGPDYWI (SEQ ID NO: 32).
63. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises the amino acid sequence SNLQDS (SEQ ID NO: 21), wherein L4 comprises the amino acid sequence SGTTGKSN (SEQ ID NO: 27) and wherein L6 comprises the amino acid sequence FKSRGLMVPL (SEQ ID NO: 33).
64. The non-naturally occurring chagasin scaffold protein of embodiment 58, wherein L2 comprises the amino acid sequence SNYRDS (SEQ ID NO: 22), wherein L4 comprises the amino acid sequence VRAGQANE (SEQ ID NO: 28) and wherein L6 comprises the amino acid sequence SPVLGPRFWL (SEQ ID NO: 34).
65. The non-naturally occurring chagasin scaffold protein of embodiment 58, comprising the amino acid sequence set forth in SEQ ID NO: 36.
66. The non-naturally occurring chagasin scaffold protein of embodiment 58, comprising the amino acid sequence set forth in SEQ ID NO: 37.
67. The non-naturally occurring chagasin scaffold protein of embodiment 58, comprising the amino acid sequence set forth in SEQ ID NO: 38.
68. The non-naturally occurring chagasin scaffold protein of embodiment 58, comprising the amino acid sequence set forth in SEQ ID NO: 39.
69. The non-naturally occurring chagasin scaffold protein of embodiment 58, comprising the amino acid sequence set forth in SEQ ID NO: 40.
70. A non-naturally occurring chagasin scaffold protein that specifically binds to the same epitope as a second non-naturally occurring chagasin scaffold protein that binds human vascular endothelial growth factor (VEGF), wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SNY-F/Y-Y/C/N/R-D/E (SEQ ID NO: 49), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57), D/N/S-D/G/V/Y-P/N/S-G/Y-S/L/M-G/H/S-L/V/A/Y-W/Y/L/S (SEQ ID NO: 58), or G/H-S/V-S/Q-Y/W-W/G-G/W (SEQ ID NO: 68), and an L6 that comprises the amino acid sequence A/G-PW-S/Q/F/A/L/V-GPSR-Y/E/F/V/D-L (SEQ ID NO: 67), with reference to SEQ ID NO: 2.
71. A non-naturally occurring chagasin scaffold protein that specifically binds human vascular endothelial growth factor (VEGF), wherein the non-naturally occurring chagasin scaffold protein competes for binding with a second non-naturally occurring chagasin scaffold protein that binds human VEGF, wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SNY-F/Y-Y/C/N/R-D/E (SEQ ID NO: 49), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57), D/N/S-D/G/V/Y-P/N/S-G/Y-S/L/M-G/H/S-L/V/A/Y-W/Y/L/S (SEQ ID NO: 58), or G/H-S/V-S/Q-Y/W-W/G-G/W (SEQ ID NO: 68), and an L6 that comprises the amino acid sequence A/G-PW-S/Q/F/A/L/V-GPSR-Y/E/F/V/D-L (SEQ ID NO: 67), with reference to SEQ ID NO: 2.
72. The non-naturally occurring chagasin scaffold protein embodiment 70 or 71, wherein the non-naturally occurring chagasin scaffold protein comprises an L2 that comprises the amino acid sequence SNY-F/Y-Y/C/N/R-D/E (SEQ ID NO: 49), an L4 that comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57), D/N/S-D/G/V/Y-P/N/S-G/Y-S/L/M-G/H/S-L/V/A/Y-W/Y/L/S (SEQ ID NO: 58), or G/H-S/V-S/Q-Y/W-W/G-G/W (SEQ ID NO: 68), and an L6 that comprises the amino acid sequence A/G-PW-S/Q/F/A/L/V-GPSR-Y/E/F/V/D-L (SEQ ID NO: 67), with reference to SEQ ID NO: 2.
73. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 19 and 42-48, wherein L4 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 50-57; and wherein L6 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 59-66.
74. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), wherein L4 comprises the amino acid sequence DDPGSGLW (SEQ ID NO: 50) and wherein L6 comprises the amino acid sequence APWSGPSRYL (SEQ ID NO: 59).
75. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFYE (SEQ ID NO: 42), wherein L4 comprises the amino acid sequence NGPGLGVY (SEQ ID NO: 51) and wherein L6 comprises the amino acid sequence APWQGPSREL (SEQ ID NO: 60).
76. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), wherein L4 comprises the amino acid sequence NVNGSHAW (SEQ ID NO: 52) and wherein L6 comprises the amino acid sequence APWSGPSRFL (SEQ ID NO: 61).
77. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFCD (SEQ ID NO: 44), wherein L4 comprises the amino acid sequence NYPGSGVL (SEQ ID NO: 53) and wherein L6 comprises the amino acid sequence APWFGPSRVL (SEQ ID NO: 62).
78. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFND (SEQ ID NO: 45), wherein L4 comprises the amino acid sequence GSSYWG (SEQ ID NO: 54) and wherein L6 comprises the amino acid sequence APWAGPSRVL (SEQ ID NO: 63).
79. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFYD (SEQ ID NO: 19), wherein L4 comprises the amino acid sequence SGSYMSYS (SEQ ID NO: 55) and wherein L6 comprises the amino acid sequence APWLGPSRDL (SEQ ID NO: 64).
80. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYFRE (SEQ ID NO: 47), wherein L4 comprises the amino acid sequence HVQWGW (SEQ ID NO: 56) and wherein L6 comprises the amino acid sequence APWVGPSREL (SEQ ID NO: 65).
81. The non-naturally occurring chagasin scaffold protein of embodiment 72, wherein L2 comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), wherein L4 comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57) and wherein L6 comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66).
82. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 69.
83. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 70.
84. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 71.
85. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 72.
86. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 73.
87. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 74.
88. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 75.
89. The non-naturally occurring chagasin scaffold protein of embodiment 72, comprising the amino acid sequence set forth in SEQ ID NO: 76.
90. A non-naturally occurring chagasin scaffold protein that specifically binds to the same epitope as a second non-naturally occurring chagasin scaffold protein that binds human vascular endothelial growth factor (VEGF), wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
91. A non-naturally occurring chagasin scaffold protein that specifically binds human vascular endothelial growth factor (VEGF), wherein the non-naturally occurring chagasin scaffold protein competes for binding with a second non-naturally occurring chagasin scaffold protein that binds human VEGF, wherein the second non-naturally occurring chagasin scaffold protein that binds human VEGF comprises an L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
92. The non-naturally occurring chagasin scaffold protein embodiment 90 or 91, wherein the non-naturally occurring chagasin scaffold protein comprises an L2 that comprises the amino acid sequence SNYY-Y/K-D (SEQ ID NO: 114), an L4 that comprises the amino acid sequence HY-Y/Q/S/T-NLGGRYT (SEQ ID NO: 115); and an L6 that comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
93. The non-naturally occurring chagasin scaffold protein of embodiment 92, wherein L2 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 48 and 110, L4 comprises an amino acid sequence set forth in any one of SEQ ID NOs: 57 and 111-113; and L6 that comprises an amino acid sequence set forth in SEQ ID NO: 66, with reference to SEQ ID NO: 2.
94. The non-naturally occurring chagasin scaffold protein of embodiment 92, wherein L2 comprises the amino acid sequence SNYYKD (SEQ ID NO: 110), L4 comprises the amino acid sequence HYYNLGGRYT (SEQ ID NO: 57); and L6 comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
95. The non-naturally occurring chagasin scaffold protein of embodiment 92, wherein L2 comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), L4 comprises the amino acid sequence HYQNLGGRYT (SEQ ID NO: 111); and L6 comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
96. The non-naturally occurring chagasin scaffold protein of embodiment 92, wherein L2 comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), L4 comprises the amino acid sequence HYSNLGGRYT (SEQ ID NO: 112); and L6 comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
97. The non-naturally occurring chagasin scaffold protein of embodiment 92, wherein L2 comprises the amino acid sequence SNYYYD (SEQ ID NO: 48), L4 comprises the amino acid sequence HYTNLGGRYT (SEQ ID NO: 113); and L6 comprises the amino acid sequence GPWLGPSRVL (SEQ ID NO: 66), with reference to SEQ ID NO: 2.
98. The non-naturally occurring chagasin scaffold protein of embodiment 92, comprising the amino acid sequence set forth in SEQ ID NO: 116.
99. The non-naturally occurring chagasin scaffold protein of embodiment 92, comprising the amino acid sequence set forth in SEQ ID NO: 117.
100. The non-naturally occurring chagasin scaffold protein of embodiment 92, comprising the amino acid sequence set forth in SEQ ID NO: 118.
101. The non-naturally occurring chagasin scaffold protein of embodiment 92, comprising the amino acid sequence set forth in SEQ ID NO: 119.
102. The non-naturally occurring chagasin scaffold protein of any one of embodiments 56-101, wherein the non-naturally occurring chagasin scaffold protein binds a human VEGF with a Kd between 500 nM and 1 pM.
103. The non-naturally occurring chagasin scaffold protein of embodiment 77 or 85, wherein the non-naturally occurring chagasin scaffold protein forms a homodimer.
104. The non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 or the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-103 conjugated to a therapeutic agent.
105. The non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 or the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-103 conjugated to a label.
106. The non-naturally occurring chagasin scaffold protein that binds LRP6 or the non-naturally occurring chagasin scaffold protein that binds VEGF of embodiment 105, wherein the label is selected from the group consisting of a radioisotope, a fluorescent dye, and an enzyme.
107. An isolated nucleic acid molecule that encodes the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 or the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-103.
108. An expression vector encoding the nucleic acid molecule of embodiment 107.
109. A cell comprising the expression vector of embodiment 108.
110. A method of producing the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 or the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-103, comprising culturing the cell of embodiment 109 and recovering the non-naturally occurring chagasin scaffold protein from the cell culture.
111. A method of producing the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 or the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-103 comprising chemically synthesizing the non-naturally occurring chagasin scaffold protein that binds LRP6 or the non-naturally occurring chagasin scaffold protein that binds VEGF.
112. A method of detecting an LRP6 protein in sample from a patient by contacting the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55, 105, and 106 to the sample and detecting the non-naturally occurring chagasin scaffold protein bound to the LRP6 protein.
113. A method of detecting a VEGF protein in sample from a patient by contacting the non-naturally occurring chagasin scaffold protein that binds VEGF of any one of embodiments 56-95, 105, and 105 to the sample and detecting the non-naturally occurring chagasin scaffold protein bound to the VEGF protein.
114. The method according to embodiment 112 or 113, wherein the non-naturally occurring chagasin scaffold protein is used an immunohistochemistry assay (IHC) or in an ELISA assay.
115. A composition comprising the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 and 104 and a pharmaceutically acceptable carrier.
116. A composition comprising non-naturally occurring chagasin scaffold protein that binds VEGF according to any one of embodiments 56-95 and 104 and a pharmaceutically acceptable carrier.
117. A method of treating cancer, metastatic disease, osteoporosis, bone metabolism disease, neuronal disease, neurodegenerative disease, rheumatoid arthritis, or other inflammatory disease in a subject, comprising administering an effective amount of the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 and 104 or the composition of embodiment 115 to the subject.
118. A composition comprising the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 and 104 for use in treating cancer, metastatic disease, osteoporosis, bone metabolism disease, neuronal disease, neurodegenerative disease, rheumatoid arthritis, or other inflammatory disease.
119. The composition of embodiment 115 for use in treating cancer, metastatic disease, osteoporosis, bone metabolism disease, neuronal disease, neurodegenerative disease, rheumatoid arthritis, or other inflammatory disease.
120. Use of the non-naturally occurring chagasin scaffold protein that binds LRP6 of any one of embodiments 36-55 and 104 or the composition of embodiment 115 in the manufacture of a medicament for treating cancer, metastatic disease, osteoporosis, bone metabolism disease, neuronal disease, neurodegenerative disease, rheumatoid arthritis, or other inflammatory disease.
121. A method of inhibiting angiogenesis and/or vascular permeability or leakage in a subject, comprising administering an effective amount of the non-naturally occurring chagasin scaffold protein that binds VEGF according to any one of embodiments 56-95 and 116 or the composition of embodiment 108 to the subject.
122. A method of treating a disease characterized by angiogenesis and/or vascular permeability or leakage in a subject, comprising administering an effective amount of the non-naturally occurring chagasin scaffold protein that binds VEGF according to any one of embodiments 56-95 and 104 or the composition of embodiment 116 to the subject.
123. The method of embodiment 122, wherein the disease is cancer, ocular disease, or an inflammatory disease.
124. A composition comprising the non-naturally occurring chagasin scaffold protein that binds VEGF according to any one of embodiments 56-95 and 104 for use in treating a disease characterized by angiogenesis and/or vascular permeability or leakage in a subject.
125. The composition of embodiment 116 for use in treating a disease characterized by angiogenesis and/or vascular permeability or leakage in a subject.
126. Use of the non-naturally occurring chagasin scaffold protein that binds VEGF according to any one of embodiments 56-95 and 104 or the composition of embodiment 116 in the manufacture of a medicament for treating a disease characterized by angiogenesis and/or vascular permeability or leakage in a subject.