METHODS AND COMPOSITIONS FOR MODULATING FGF23 LEVELS
20200046811 ยท 2020-02-13
Inventors
- Douglas E. Vaughan (Chicago, IL, US)
- Mesut Eren (Harwood Heights, IL, US)
- Aaron T. Place (Chicago, IL, US)
- Toshio Miyata (Evanston, IL, US)
Cpc classification
C12Y304/21068
CHEMISTRY; METALLURGY
A61K31/495
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K31/495
HUMAN NECESSITIES
G01N2800/52
PHYSICS
C12Y304/21073
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/341
HUMAN NECESSITIES
International classification
A61K31/495
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
The present invention provides compositions, systems, and methods for treating a condition characterized by elevated Fibroblast Growth Factor 23 (FGF23) with a composition comprising: i) an agent that causes an increase in expression of urokinase plasminogen activator (uPA) and/or tissue plasminogen activator (tPA), ii) purified uPA, and/or purified tPA.
Claims
1. A method of treating a condition characterized by elevated Fibroblast Growth Factor 23 (FGF23) comprising: administering and/or prescribing at least one of the following to a subject with a condition characterized by elevated FGF23: i) a first composition comprising an agent that causes an increase in expression of a serine protease selected from urokinase plasminogen activator (uPA) and tissue plasminogen activator (tPA); and ii) a second composition comprising purified uPA, uPA derivative, tPA, and/or a tPA derivative.
2. The method of claim 1, wherein said condition is selected from the group consisting of: chronic kidney disease, left ventricular hypertrophy and congestive heart failure, autosomal dominant hypophosphatemic ricketts, osteomalacia, Vitamin D deficiency, fibrous dysplasia, and aging.
3. The method of claim 1, further comprising receiving a report or generating a report characterizing a biological sample from said subject as having elevated FGF23 levels compared to normal control population levels.
4. The method of claim 1, further comprising: testing a sample from said subject to determine the level of FGF23 present in said sample.
5. The method of claim 1, wherein said agent comprises TM5441, TM5275, or TM5007.
6. The method of claim 1, wherein said subject is administered said first composition, wherein said agent comprises TM5441, TM5275, or TM5007, and wherein said TM5441, TM5275, or TM5007 is administered at a dose of 25-250 mg per kg of subject for at least 10 days.
7. The method of claim 6, wherein said at least 10 days is at least 100 days.
8. The method of claim 1, wherein said subject is a human.
9. The method of claim 1, wherein said subject is administered said first composition.
10. The method of claim 1, wherein said subject is administered said second composition.
11. A system comprising: a) a first component selected from: i) a first composition comprising an agent that causes an increase in expression of a serine protease selected from urokinase plasminogen activator (uPA) and tissue plasminogen activator (tPA); and ii) a second composition comprising purified uPA, uPA derivative, tPA, and/or tPA derivative; and b) a second component comprising a report characterizing a subject as having elevated levels of FGF23 and/or having a condition characterized by elevated Fibroblast Growth Factor 23 (FGF23).
12. The system of claim 11, wherein said report is electronic or on paper.
13. The system of claim 11, wherein said condition is selected from the group consisting of: chronic kidney disease, left ventricular hypertrophy and congestive heart failure, autosomal dominant hypophosphatemic ricketts, osteomalacia, Vitamin D deficiency, fibrous dysplasia, and aging.
14. The system of claim 11, wherein said report characterizes a biological sample from a subject as having elevated FGF23 levels compared to normal control population levels.
15. The system of claim 11, wherein said subject is a human.
16. The system of claim 11, wherein said first component comprises said first composition.
17. The system of claim 16, wherein said first composition comprises TM5441.
18. The system of claim 11, wherein said first component comprises said second composition.
19. A system comprising: a) a first component selected from: i) a first composition comprising an agent that causes an increase in expression of a serine protease selected from urokinase plasminogen activator (uPA) and tissue plasminogen activator (tPA); and ii) a second composition comprising purified uPA, uPA derivative, tPA, and/or tPA derivative; and b) a second component comprising components for testing a sample from a subject to detect FGF23 levels.
20. The system of claim 19, wherein said first component comprises said first composition, and wherein said first composition comprises TM5411, TM5275, or TM5007.
Description
DESCRIPTION OF THE FIGURES
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION
[0024] The present invention provides compositions, systems, and methods for treating a condition characterized by elevated Fibroblast Growth Factor 23 (FGF23) with a composition comprising: i) an agent that causes an increase in expression of urokinase (uPA) and/or tissue plasminogen activator (tPA), ii) purified uPA, and/or purified tPA.
[0025] Elevated plasma levels of Fibroblast Growth Factor 23 (FGF23) are present in a variety of human diseases and conditions including chronic kidney disease, left ventricular hypertrophy and congestive heart failure, autosomal dominant hypophosphatemic ricketts, osteomalacia, Vitamin D deficiency, fibrous dysplasia, and aging. FGF23 is synthesized in bone by osteogenic cells, and is secreted into the circulation where it primarily functions in the kidneys to control phosphate homeostasis and active Vitamin D levels. In plasma, FGF23 can be cleaved between R179 and S180, yielding inactive N- and C-terminal fragments. It is speculated that a subtilisin-like proprotein convertase mediates the inactivating proteolysis of FGF23, but the specific protease(s) involved have not been identified until the present disclosure. The present disclosure reveals that two previously described proteases (uPA and tPA) can cleave FGF23, and methods that increase the activity of one or both of these proteases can reduce or normalize FGF23 levels in plasma.
[0026] Therefore, increasing the activity or molar amount of these serine proteases by any method in a subject will reduce the levels of FGF23. This strategy is attractive for the therapy of diseases that display elevated FGF23 levels since dosing can be modulated, for example, to maintain physiological levels of FGF23. In general, complete neutralization of FGF23 is not desirable since phosphate homeostasis and active Vitamin D levels need to be maintained.
[0027] In certain embodiments, urokinase plasminogen activator (uPA) sequence that is employed is human uPA, such as in SEQ ID NO:1 (Genback Accession No. CA26268) below, or a derivative (e.g., truncation or mutation thereof).
TABLE-US-00001 (SEQIDNO:1) 1 mrallarlllcvlvvsdskgsnelhqvpsncdclnggtcvsnkyfsnihwcncpkkfggq 61 hceidksktcyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhn 121 ycrnpdnrrrpwcyvqvglkplvqecmvhdcadgkkpssppeelkfqcgqktlrprfkii 181 ggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivylg 241 rsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqticl 301 psmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttkml 361 caadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpwir 421 shtkeenglal
[0028] In some embodiments, a derivative of SEQ ID NO:1 is employed that shares at least 70% sequence identify with SEQ ID NO:1 (e.g., at least 70% . . . 80% . . . 90% . . . 95% . . . or 99% sequence identity). In certain embodiments, a truncated version of SEQ ID NO:1 is employed that is missing the N-terminal or C-terminal 10 . . . 20 . . . or 30 amino acids. In some embodiments, one, two, or three amino acids are mutated (e.g., conservative mutation) in SEQ ID NO:1, where the activity of the protein (e.g., cleaving FGF23) is not destroyed.
[0029] In other embodiments, the urokinase plasminogen activator (uPA) sequence that is employed is human uPA, such as in SEQ ID NO:2 (Genback Accession No. AAV70488) below, or a derivative (e.g., truncation or mutation thereof).
TABLE-US-00002 (SEQIDNO:2) 1 snelhqvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrg 61 kastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglk 121 plvqecmvhdcadgkkpssppeelkfqcgqktlrprfkiiggefttienqpwfaaiyrrh 181 rggsvtyvcggslispcwvisathcfidypkkedyivylgrsrlnsntqgemkfevenli 241 lhkdysadtlahhndiallkirskegrcaqpsrtiqticlpsmyndpqfgtsceitgfgk 301 enstdylypeqlkmtvvklishrecqqphyygsevttkmlcaadpqwktdscqgdsggpl 361 vcslqgrmtltgivswgrgcalkdkpgvytrvshflpwirshtkeenglal.
[0030] In some embodiments, a derivative of SEQ ID NO:2 is employed that shares at least 70% sequence identify with SEQ ID NO:2 (e.g., at least 70% . . . 80% . . . 90% . . . 95% . . . or 99% sequence identity). In certain embodiments, a truncated version of SEQ ID NO:2 is employed that is missing the N-terminal or C-terminal 10 . . . 20 . . . or 30 amino acids. In some embodiments, one, two, or three amino acids are mutated (e.g., conservative mutation) in SEQ ID NO:2, where the activity of the protein (e.g., cleaving FGF23) is not destroyed.
[0031] In certain embodiments, the tissue plasminogen activator (tPA) sequence that is employed is human tPA, such as in SEQ ID NO:3 (Genback Accession No. CAA00299) below, or a derivative (e.g., truncation or mutation thereof).
TABLE-US-00003 (SEQIDNO:3) 1 mdamkrglccvlllcgavfvspsqeiharfrrgarsyqvicrdektqmiyqqhqswlrpv 61 lrsnrveycwcnsgraqchsvpvkscseprcfnggtcqqalyfsdfvcqcpegfagkcce 121 idtratcyedqgisyrgtwstaesgaectnwnssalaqkpysgrrpdairlglgnhnycr 181 npdrdskpwcyvfkagkyssefcstpacsegnsdcyfgngsayrgthsltesgasclpwn 241 smiligkvytaqnpsaqalglgkhnycrnpdgdakpwchvlknrrltweycdvpscstcg 301 lrqysqpqfrikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaahcfq 361 erfpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrca 421 qessvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqh 481 llnrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgcgqk 541 dvpgvytkvtnyldwirdnmrp.
[0032] In some embodiments, a derivative of SEQ ID NO:3 is employed that shares at least 70% sequence identify with SEQ ID NO:3 (e.g., at least 70% . . . 80% . . . 90% . . . 95% . . . or 99% sequence identity). In certain embodiments, a truncated version of SEQ ID NO:3 is employed that is missing the N-terminal or C-terminal 10 . . . 20 . . . or 30 amino acids. In some embodiments, one, two, or three amino acids are mutated (e.g., conservative mutation) in SEQ ID NO:3, where the activity of the protein (e.g., cleaving FGF23) is not destroyed.
[0033] In certain embodiments, the tissue plasminogen activator (tPA) sequence that is employed is human tPA, such as in SEQ ID NO:4 (Genback Accession No. BAA00881) below, or a derivative (e.g., truncation or mutation thereof).
TABLE-US-00004 1 rrgarsyqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvkscsepr 61 cfnggtcqqalyfsdfvcqcpegfagkcceidtratcyedqgisyrgtwstaesgaectn 121 wnssalaqkpysgrrpdairlglgnhnycrnpdrdskpwcyvfkagkyssefcstpacse 181 gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp 241 dgdakpwchvlknrrltweycdvpscstcglrqysqpqfrikgglfadiashpwqaaifa 301 khrrspgerflcggilisscwilsaahcfqerfpphhltvilgrtyrvvpgeeeqkfeve 361 kyivhkefdddtydndiallqlksdssrcaqessvvrtvclppadlqlpdwtecelsgyg 421 khealspfyserlkeahvrlypssrctsqhllnrtvtdnmlcagdtrsggpqanlhdacq 481 gdsggplyclndgrmtlvgiiswglgcgqkdvpgvytkvtnyldwirdnmrp
[0034] In some embodiments, a derivative of SEQ ID NO:4 is employed that shares at least 70% sequence identify with SEQ ID NO:4 (e.g., at least 70% . . . 80% . . . 90% . . . 95% . . . or 99% sequence identity). In certain embodiments, a truncated version of SEQ ID NO:4 is employed that is missing the N-terminal or C-terminal 10 . . . 20 . . . or 30 amino acids. In some embodiments, one, two, or three amino acids are mutated (e.g., conservative mutation) in SEQ ID NO:4, where the activity of the protein (e.g., cleaving FGF23) is not destroyed.
[0035] In particular embodiments, the tissue plasminogen activator (tPA) sequence that is employed is human tPA, such as shown in Genbank Accession numbers AA034406, CAX11668, or CAA00642 (all of which are herein incorporated by reference). In some embodiments, a derivative of one of these three sequences is employed that shares at least 70% sequence identify with one of these sequences (e.g., at least 70% . . . 80% . . . 90% . . . 95% . . . or 99% sequence identity). In certain embodiments, a truncated version of one of these sequences is employed that is missing the N-terminal or C-terminal 10 . . . 20 . . . or 30 amino acids. In some embodiments, one, two, or three amino acids are mutated (e.g., conservative mutation) in one of these sequences, where the activity of the protein (e.g., cleaving FGF23) is not destroyed.
EXAMPLES
Example 1
Serine Proteases Urokinase (uPA) and Tissue Plasminogen Activator (tPA) Cleave FGF23
[0036] This Example describes the ability of uPA and tPA to cleave FGF23.
Materials and Methods
Recombinant Proteins:
[0037] Recombinant human t-PA, uPA, and stable PAI-1 were obtained from Molecular Innovations Inc., Novi, Mich. Recombinant Human FGF23 was obtained from R and D Systems Inc., Minneapolis Minn.
Tm5441:
[0038] TM5441 was obtained from Toshio Miyata, M. D., Ph.D. and Renascience, Inc. A stock solution of 2.5 mM was prepared in DMSO.
Western Blotting:
[0039] The 6His tag antibody was obtained from Abcam Inc., Cambridge Mass., and the FGF23 antibody was obtained from Santa Cruz Biotechnology Inc., Dallas Tex. Secondary HRP conjugated donkey anti goat (cross-adsorbed) and goat anti-rabbit antibodies were obtained from Bethyl Laboratories Inc., Montgomery, Tex., and Molecular Innovations Inc. respectively. 4-12% NuPAGE Bis-Tris Gels, PVDF iblot gel transfer stacks, 4NuPAGE LDS sample buffer and 10NuPAGE sample reducing agent were from Life Technologies Inc., Carlsbad, Calif. Luminata Forte Western HRP Substrate detection reagent was from EMD Millipore Inc., Billerica, Mass.
Silver Staining of SDS-PAGE Gels:
[0040] Gels were silver stained using the Pierce Silver Stain Kit from Thermo Fisher Scientific Inc. Waltham, Mass., according to the manufacturer's protocol.
In Vitro Protease Reactions:
[0041] Recombinant human FGF23 (1-1.5 g) was incubated at 37 C. for 4 hours (or other time point indicated) with either recombinant human t-PA (1.1 g) or uPA (1.1 g), (in addition to 1.70 g of recombinant human stable PAI-1 where indicated) in reaction buffer (25 l final volume) containing: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 200 mM CHAPS, 0.1% PEG-8000, and 1% DMSO. To terminate the reaction, samples were incubated at 95 C. for 5 minutes in the presence of 1NuPAGE LDS sample buffer and 1 NuPAGE sample reducing agent.
TM5441 Treatment of Klotho Mice:
[0042] Four week old Klotho (kl/kl) mice (n=11) were administered TM5441 at the dose of 100 mg/kg/day for 120 days. The chow diet containing the inhibitor was prepared by mixing a homogenous suspension of TM5441 made in 0.5% Carboxy Methyl Cellulose into the powder chow diet (Harland Teklad LM-485 number 7012). The plasma levels of FGF23 was measured using an ELISA kit (Immutopics, Inc. Mouse/Rat FGF-23 (C-Term) ELISA Kit, Cat. #60-6300) by following the manufacturer's protocol.
Results:
[0043] In a mouse model with extremely elevated FGF23 levels (Klotho mice), FGF23 levels are markedly reduced by treatment with TM5441, a small orally-active molecule that increases t-PA and uPA activity.
[0044] When recombinant purified human FGF23 is exposed to recombinant purified human t-PA or uPA serine proteases, smaller fragments are generated on a silver stained SDS-PAGE gel indicating proteolytic cleavage. These results are shown in
[0045] The smaller fragments are confirmed to be of FGF23 origin by western blot as well. This is shown in
[0046] These data indicate that FGF23 proteolytic metabolism yielding inactive fragments is mediated, at least in part, by uPA and t-PA in vitro and in vivo. Thus increasing uPA or t-PA activity or molar amount, will result in reduced or normalized active FGF23 levels in vivo.
[0047] All publications and patents mentioned in the present application are herein incorporated by reference. Various modification and variation of the described methods and compositions of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the relevant fields are intended to be within the scope of the following claims.