IMMUNOREGULATORY STRUCTURES FROM NORMALLY OCCURING PROTEINS
20200048331 · 2020-02-13
Inventors
Cpc classification
G01N33/57484
PHYSICS
C07K2317/34
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to isolated protein sequences that correspond to cell binding peptides, fragments, neo-structures and/or neo-epitopes of a normally occurring serum protein present in human tissue, wherein the peptide, fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and is the result of either an enhanced proteolytic activity and/or conformational changes in a tissue, or a malignant tumour. In the present patent application, a common structure of several of these peptides, fragments, neo-structures and/or neo-epitopes, having immunoregulatory activity by binding to receptors on immune cells, has been identified. The present invention further also relates to monoclonal and/or polyclonal antibodies directed to a cell binding fragment of a normally occurring serum protein present in human tissue, as described above.
Claims
1.-26. (canceled)
27. A method of using an isolated neo-epitope of albumin as an immunoinhibitor in an inflammatory condition or disease, the isolated neo-epitope comprising an amino acid sequence selected from the group consisting of: LVNEVTEFAK (SEQ ID NO:104), SLHTLFGDK (SEQ ID NO:84), LCTVATLR (SEQ ID NO:85), ETYGEMADCCAK (SEQ ID NO:86), YLYEIAR (SEQ ID NO:87), LDELRDEGK (SEQ ID NO:88), YICENQDSISSK (SEQ ID NO:89), LKECCEKPLLEK (SEQ ID NO:90), HPDYSVVLLLR (SEQ ID NO:91), CCAAADPHECYAK (SEQ ID NO:92), QNCELFEQLGEYK (SEQ ID NO:93), FQNALLVR (SEQ ID NO:94), CCTESLVNR (SEQ ID NO:95), and AVMDDFAAFVEK (SEQ ID NO:96), the method comprising administering the isolated neo-epitope to a subject having an inflammatory condition or disease.
28. The method of claim 27, wherein the isolated neo-epitope of albumin comprises the amino acid sequence of YLYEIAR (SEQ ID NO: 87)
29. The method of claim 27, wherein the isolated neo-epitope of albumin comprises the amino acid sequence of KYLYEIAR (SEQ ID NO: 115).
30. The method of claim 27, wherein the isolated neo-epitope of albumin comprises the amino acid sequence of KLVNEVTEFAKT (SEQ ID NO: 106).
31. The method of claim 27, wherein the isolated neo-epitope of albumin comprises the amino acid sequence of KLDELRDEGKAS (SEQ ID NO: 112).
32. The method of claim 27, wherein the isolated neo-epitope of albumin comprises the amino acid sequence of ELFEQLGEYKFQNALLVR (SEQ ID NO: 147).
33. The method of claim 27, wherein the isolated neo-epitope of albumin binds to an immune cell.
34. The method of claim 27, wherein the inflammatory condition or disease is selected from the group consisting of: psoriasis, T-cell lymphoma, allograft rejection, GVH, ischemia-reperfusion injury, chronic inflammatory diseases, and an autoimmune disease.
35. A method of using an isolated neo-epitope of albumin as an immunoinhibitor in an inflammatory condition or disease, the isolated immune cell binding peptide comprising the amino acid sequence NEETFLKKYLYE (SEQ ID NO: 110), the method comprising administering the isolated neo-epitope of albumin to a subject having an inflammatory condition or disease.
36. The method of claim 35, wherein the inflammatory condition or disease is selected from the group consisting of psoriasis, T-cell lymphoma, allograft rejection, GVH, ischemia-reperfusion injury, chronic inflammatory diseases and an autoimmune disease.
37. A monoclonal antibody directed to an immune cell binding neo-epitope of albumin, the isolated immune cell binding neo-epitope comprising an amino acid sequence selected from the group consisting of: LVNEVTEFAK (SEQ ID NO: 104), SLHTLFGDK (SEQ ID NO:84), LCTVATLR (SEQ ID NO:85), ETYGEMADCCAK (SEQ ID NO:86), YLYEIAR (SEQ ID NO:87), LDELRDEGK (SEQ ID NO:88), YICENQDSISSK (SEQ ID NO:89), LKECCEKPLLEK (SEQ ID NO:90), HPDYSVVLLLR (SEQ ID NO:91), CCAAADPHECYAK (SEQ ID NO:92), QNCELFEQLGEYK (SEQ ID NO:93), FQNALLVR (SEQ ID NO:94), CCTESLVNR (SEQ ID NO:95), and AVMDDFAAFVEK (SEQ ID NO:96).
38. The monoclonal antibody of claim 37, wherein the immune cell binding neo-epitope of albumin comprises the amino acid sequence YLYEIAR (SEQ ID NO: 87).
Description
DETAILED DESCRIPTION OF THE PRESENT INVENTION
[0014] The present invention relates to an immune cell binding protein sequence of a protein normally occurring in serum, such as to an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope of a protein normally occurring in serum, which is present in a human tissue, wherein said peptide, peptide fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and said peptide, peptide fragment, neo-structure and/or neo-epitope is the result of an enhanced proteolytic activity and/or denaturing in an inflammatory tissue and/or a malignant tumour. Specific examples of such immune cell binding protein sequences are selected from the amino acid sequences listed e.g. as SEQ.ID.NO(s). 1-81, such as in particular from the sequences corresponding to SEQ.ID.NO(s). 26, 80, and 81.
[0015] Consequently, the present invention also relates to the use as a medicine of an immune cell binding protein sequence of a protein normally occurring in serum, such as an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope, which is present in a human tissue, wherein said peptide, peptide fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and said peptide, peptide fragment, neo-structure and/or neo-epitope is the result of an enhanced proteolytic activity and/or denaturing in an inflammatory tissue and/or a malignant tumour, selected from the amino acid sequences listed as SEQ.ID.NO(s). 1-81, such as in particular selected from the sequences corresponding to SEQ.ID.NO(s). 26, 80, and 81.
[0016] In particular, the present invention relates to the use of an immune cell binding protein sequence of a protein normally occurring in serum, according to the present invention, selected from the amino acid sequences listed as SEQ.ID.NO(s). 1-81, such as in particular selected from the sequences corresponding to SEQ.ID.NO(s). 26, 80, and 81, for diagnosing, treating and/or preventing cancer in a patient in need thereof.
[0017] A preferred embodiment thereof is a monoclonal antibody directed to an immune cell binding protein sequence of a protein normally occurring in serum, such as an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope, which is present in a human tissue, wherein said peptide, peptide fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and said peptide, peptide fragment, neo-structure and/or neo-epitope is the result of an enhanced proteolytic activity and/or denaturing in an inflammatory tissue and/or a malignant tumour. In a presently preferred embodiment, such a monoclonal antibody is directed against at least one of the protein sequences corresponding to a sequence selected from the amino acid sequences listed as SEQ.ID.NO(s). 1-81, such as in particular selected from the sequences corresponding to SEQ.ID.NO(s). 26, 80, and 81. Another, equally preferred embodiment of the present invention is a polyclonal rabbit anti-3028 antibody, which is herein demonstrated, as well as a polyclonal rabbit anti-3218 or anti-3315 antibody, i.e. a polyclonal rabbit antibody that is directed against at least one of the protein sequences corresponding to SEQ.ID.NO(s). 26, 80 or 81. Such an antibody is typically used for different diagnose and/or research methods.
[0018] A further aspect of the invention relates to a method for diagnosing the presence of a malignant tumour by determining the response to an antibody as described above.
[0019] A still further aspect of the invention relates to a compound inhibiting the activity of an immune cell binding protein sequence of a protein normally occurring in serum, such as an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope, which is present in a human tissue, wherein said peptide, peptide fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and said peptide, peptide fragment, neo-structure and/or neo-epitope is the result of an enhanced proteolytic activity and/or denaturing in an inflammatory tissue and/or a malignant tumour.
[0020] A further aspect of the invention relates to a method for treating any malignant tumour by administering a compound inhibiting the occurrence of an immune cell binding protein sequence of a protein normally occurring in serum, such as an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope, according to the present invention, which said peptide, peptide fragment, neo-structure and/or neo-epitope has an immunoregulatory activity and is the result of a cancer or malign tumour.
[0021] A preferred embodiment of the method consists in that an antibody raised against said cell binding peptide, peptide fragment, neo-structure and/or neo-epitope is administered in an amount sufficient to raise an immune response to any malignant tumour.
[0022] A further aspect of the invention relates to a method for treating a malignant tumour by inhibiting the activity of said immunoregulatory peptide, peptide fragment, neo-structure and/or neo-epitope by using standard drug developing pharmacological principles producing receptor blocking drugs or drugs inhibiting signal transduction from the receptors of said peptide, peptide fragment, neo-structure and/or neo-epitope.
[0023] In particular again, the present invention for the first time discloses that an immune cell binding protein sequence of a protein normally occurring in serum, according to the present invention, such as an isolated cell binding peptide, peptide fragment, neo-structure and/or neo-epitope, being the result of an enhanced proteolytic activity and/or denaturing in an inflammatory tissue and/or a malignant tumour, has immunoregulatory, inhibitory activity, i.e. that it is a physiological immunoinhibitor. The present invention thus further relates to the use of an isolated immune cell binding peptide, peptide fragment, neo-structure and/or neo-epitope of a protein normally occurring in serum, according to the present invention, for immunoregulation not only in cancer, but also in interleukin-2 dependent and/or inflammatory conditions and/or diseases, such as psoriasis, T-cell lymphoma, allograft rejection, GVH, ischemia-reperfusion injury, chronic inflammatory diseases and/or autoimmune diseases.
[0024] A still further aspect of the invention relates to a method for treating interleukin-2 dependent and/or inflammatory conditions and/or diseases by administering a therapeutically effective amount of the immunosuppressive peptide, peptide fragment, neo-structure and/or neo-epitope of a protein normally occurring in serum, according to the present invention.
[0025] One presently preferred embodiment of the present invention relates to a protein sequence, such as a peptide, peptide fragment, neo-structure and/or neo-epitope of normal serum albumin having a first glutamic acid at a distance of 3 to 7 amino acids from any lysine present in said sequence, preferably 4 to 6 amino acids from any lysine present in said sequence, more preferably 5 to 6 amino acids from any lysine present in said sequence, and having immunoregulatory activity.
[0026] In a preferred embodiment of the present invention said sequence contains a further glutamic acid at a distance of from 2 to 3 amino acids from said first glutamic acid.
[0027] In a preferred embodiment of the present invention the peptide, peptide fragment, neo-structure and/or neo-epitope of normal serum albumin has a peptide sequence selected from the amino acid sequences listed as SEQ.ID.NO(s). 1-81.
[0028] In a preferred embodiment of the present invention said sequence further contains an acidic amino acid at a distance of 121 amino acids from the first glutamic acid, and at a distance of +31 amino acids from the lysine.
[0029] A further aspect of the invention relates to a monoclonal antibody directed against one or more of a protein sequence, such as a peptide, peptide fragment, neo-structure and/or neo-epitope of normal serum albumin having a first glutamic acid at a distance of 3 to 7 amino acids from any lysine present in said sequence, preferably 4 to 6 amino acids from any lysine present in said sequence, more preferably 5 to 6 amino acids from any lysine present in said sequence, and having immunoregulatory activity.
[0030] In a preferred embodiment of the present invention the antibody is directed against a peptide, peptide fragment, neo-structure and/or neo-epitope of normal serum albumin corresponding to one or more of the peptide sequences selected from the amino acid sequences listed as SEQ.ID.NO(s). 1-81.
[0031] Another aspect of the invention relates to a method for diagnosing the optional presence of an immunosuppressing cancer or malignant tumour, by determining the presence of a peptide, peptide fragment, neo-structure and/or neo-epitope of normal human serum albumin having a first glutamic acid at a distance of 3 to 7 amino acids from any lysine present in said peptide, peptide fragment, neo-structure and/or neo-epitope, preferably 4 to 6 amino acids from any lysine present in said peptide, peptide fragment, neo-structure and/or neo-epitope, more preferably 5 to 6 amino acids from any lysine present in said peptide, peptide fragment, neo-structure and/or neo-epitope, and having immunoregulatory activity, as shown in one or more standard immune tests/standard tests on immune function, such as cytokine production, lymphocyte proliferation, blocking binding of anti-integrin antibody to its receptor.
[0032] Presently preferred sequences of a peptide, peptide fragment, neo-structure and/or neo-epitope according to the present invention are listed as follows:
TABLE-US-00001 SEQ.ID.NO.1 EENFK SEQ.ID.NO.2 EDHVK SEQ.ID.NO.3 ENCDK SEQ.ID.NO.4 ETFLK SEQ.ID.NO.5 ERAFK SEQ.ID.NO.6 ECCEK SEQ.ID.NO.7 ECYAK SEQ.ID.NO.8 ERQIK SEQ.ID.NO.9 EKCCK SEQ.ID.NO.10 EEGKK SEQ.ID.NO.11 EETFLK SEQ.ID.NO.12 ETFLKK SEQ.ID.NO.13 ETTLEK SEQ.ID.NO.14 ETYVPK SEQ.ID.NO.15 ERQIKK SEQ.ID.NO.16 ELVKHK SEQ.ID.NO.17 EVAHRFK SEQ.ID.NO.18 EVTEFAK SEQ.ID.NO.19 ECFLQHK SEQ.ID.NO.20 EETFLKK SEQ.ID.NO.21 ELLFFAK SEQ.ID.NO.22 ELRDEGK SEQ.ID.NO.23 EFAEVSK SEQ.ID.NO.24 EKPLLEK SEQ.ID.NO.25 ESKDVCK SEQ.ID.NO.26 EPQNLIK SEQ.ID.NO.27 EQLGEYK SEQ.ID.NO.28 EKERQIK SEQ.ID.NO.29 ESAENCDK SEQ.ID.NO.30 EMADCCAK SEQ.ID.NO.31 ECCQAADK SEQ.ID.NO.32 EGKASSAK SEQ.ID.NO.33 EEPQNLIK SEQ.ID.NO.34 EVSRNLGK SEQ.ID.NO.35 EKERQIKK SEQ.ID.NO.36 ELVKHKPK SEQ.ID.NO.37 ENQDSISSK SEQ.ID.NO.38 EKCCKADDK SEQ.ID.NO.39 ETCFAEEGK SEQ.ID.NO.40 KDLGE SEQ.ID.NO.41 KLVNE SEQ.ID.NO.42 KQEPE SEQ.ID.NO.43 KYLYE SEQ.ID.NO.44 KVHTE SEQ.ID.NO.45 KYICE SEQ.ID.NO.46 KECCE SEQ.ID.NO.47 KPLLE SEQ.ID.NO.48 KNYAE SEQ.ID.NO.49 KVFDE SEQ.ID.NO.50 KPLVE SEQ.ID.NO.51 KQNCE SEQ.ID.NO.52 KCCTE SEQ.ID.NO.53 KATKE SEQ.ID.NO.54 KDLGEE SEQ.ID.NO.55 KKYLYE SEQ.ID.NO.56 KAAFTE SEQ.ID.NO.57 KAEFAE SEQ.ID.NO.58 KPLVEE SEQ.ID.NO.59 KEFNAE SEQ.ID.NO.60 KADDKE SEQ.ID.NO.61 KTCVADE SEQ.ID.NO.62 KLKECCE SEQ.ID.NO.63 KSHCIAE SEQ.ID.NO.64 KCCKHPE SEQ.ID.NO.65 KRMPCAE SEQ.ID.NO.66 KQTALVE SEQ.ID.NO.67 KPKATKE SEQ.ID.NO.68 KETCFAE SEQ.ID.NO.69 KLVNEVTE SEQ.ID.NO.70 KQEPERNE SEQ.ID.NO.71 KLDELRDE SEQ.ID.NO.72 KTYETTLE SEQ.ID.NO.73 KQNCELFE SEQ.ID.NO.74 KKQTALVE SEQ.ID.NO.75 KETCFAEE SEQ.ID.NO.76 KRYKAAFTE SEQ.ID.NO.77 KDVCKNYAE SEQ.ID.NO.78 KHKPKATKE SEQ.ID.NO.79 EKDDAKCCK SEQ.ID.NO.80 VFDEFKPLVEEPQNLIK SEQ.ID.NO.81 VFDEFKPLVE
[0033] In the following the term tissue as used herein shall mean whole blood, serum, plasma, lymphatic fluid, saliva, urine, faeces, ascites, pleural effusion, pus, as well as any tissue, including muscle, fat, and connective tissue, including inflammatory cells.
[0034] In the present context, the term protein sequence is used to describe one or more of a protein, polypeptide, peptide, peptide fragment, neo-structure and/or neo-epitope that is generated as a result of proteolytic fragmentation, denaturation and/or conformational change(s) of a protein normally occurring in serum. As is easily understood by the person skilled in the art, a conformational change of a protein will of course not necessarily always lead to its fragmentation, but might as well simply result in the formation and/or presentation of a new structure and/or epitope. In the present context several new structures and/or epitopes are disclosed that are still attached to and presented by the original protein normally occurring in serum.
[0035] A fragment of a protein normally occurring in serum is in the present context defined as including fragments of proteins, polypeptides and or peptides, without reference to a specific length of said protein sequence.
[0036] In the present context, denaturation means any change of a protein's structure from the normal, natural structure, such as for example brought on by oxidative stress.
[0037] Proteins are biological macromolecules constituted by amino acid residues linked together by peptide bonds. Proteins, as linear polymers of amino acids, are also called polypeptides. Typically, proteins have 50-800 amino acid residues and hence have molecular weights in the range of from about 6,000 to about several hundred thousand Dalton or more. Small proteins are called peptides, oligopeptides or polypeptides. In the context of the present invention, a peptide or peptide fragment for use in accordance with the present invention, refers to a polypeptide which may be, but is not limited to, being 5-50 amino acids in length, such as 5, 10, 15, 20, 25, 30, 35, 40, 41, 42, 43, 44, 45, 46, 47, 47, 48, 49 or 50 amino acids. Such peptides may also be longer than 50 amino acids.
[0038] Furthermore, any amino acid sequence being at least 70% identical, such as being at least 72%, 75%, 77%, 80%, 82%, 85%. 87%, 90%, 91%, 92%, 93%. 94%, 95%, 96%, 97%, 98%, or 99% identical with the amino acid sequence of a peptide and/or peptide fragment of a sequence as listed in SEQ.ID.NO: 1-81, according to the invention, is also considered to be inside the scope of the present invention.
[0039] By a peptide, peptide fragment, neo-structure and/or neo-epitope having an amino acid sequence at least, for example 95% identical to a reference amino acid sequence, is intended that the amino acid sequence of e.g. the peptide is identical to the reference sequence, except that the amino acid sequence may include up to 5 point mutations per each 100 amino acids of the reference amino acid sequence. In other words, to obtain a peptide having an amino acid sequence at least 95% identical to a reference amino acid sequence: up to 5% of the amino acids in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acids in the reference sequence may be inserted into the reference sequence. These mutations of the reference sequence may occur at the amino and/or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among amino acids in the reference sequence or in one or more contiguous groups within the reference sequence.
[0040] In the present invention, a local algorithm program is best suited to determine identity. Local algorithm programs, (such as Smith Waterman) compare a subsequence in one sequence with a subsequence in a second sequence, and find the combination of subsequences and the alignment of those subsequences, which yields the highest overall similarity score. Internal gaps, if allowed, are penalized. Local algorithms work well for comparing two multidomain proteins, which have a single domain or just a binding site in common.
[0041] Methods to determine identity and similarity are codified in publicly available programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J et al (1994)) BLASTP, BLASTN, and FASTA (Altschul, S. F. et al (1990)). The BLASTX program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S. F. et al, Altschul, S. F. et al (1990)). Each sequence analysis program has a default scoring matrix and default gap penalties. In general, a molecular biologist would be expected to use the default settings established by the software program used.
[0042] Results
[0043] Epitope Mapping with Mass Spectrometry of a Monoclonal Mouse Antibody Specific for Denatured Human Serum Albumin (dHSA) Two monoclonal antibodies directed against denatured HSA were shown to have immunomodulatory activity. The structure of the epitope of one of these mAbs was further investigated.
[0044] Two similar approaches for epitope mapping with Matrix-Assisted Laser Desorption/Ionisation Time-of-Flight mass spectrometry (MALDI-TOF ms) were used in order to define the possible site/s on human serum albumin to which a mouse monoclonal antibody specific for denatured albumin binds. One approach takes advantage of the fact that tryptic peptides to which an antibody is bound will not generate characteristic mass spectra in MALDI as they are hidden from the analysis (3). Another approach takes advantage of the fact that sites on a protein where an antibody has bound are protected from proteolysis (1, 2).
[0045] Binding of Peptides Generated by Trypsination of dHSA by Monoclonal Antibody A (mAb A)
[0046] Purified human serum albumin (HSA) was denatured with urea, reduced with DTT and alkylated as described (4). The denatured HSA was then subjected to trypsin treatment with a low concentration (0.02-2 ng/ml) of trypsin. However, the spectra obtained with MALDI were unsatisfactory, as the peptides masses typical for albumin were not found. Based on gel electrophoresis this preparation (digested by 0.02 ng/ml of trypsin) was found to contain substantial amounts of undigested albumin. Therefore, trypsin digestion was continued, at a higher concentration (5 g/ml) in order to obtain the mass spectra usually used for identification of proteins by MALDI.
[0047] Some of the now completely cleaved albumin solution was incubated with the mAb A. MALDI-TOF ms was performed and spectra of enzyme-treated denatured albumin obtained in the presence or absence of mAb A were compared. Fourteen albumin massed were absent or reduced after incubation with mAb A (Table 1 A, Column D). The amino acid sequence of these peptides is shown in Table 1B. The spectra represent multiple areas encompassing residues 66 to 508 of the albumin molecule.
TABLE-US-00002 TABLE 1A Peptide residues of HSA binding to mAb A. Column C: Peak area of peptides before adsorption with mAb A. Column D: Peak area of peptides after adsorption with mAb A. Column E: Peak area of peptides when digestion of dHSA was protected by binding to mAb A C Peak area before D E A Antibody Peak area after Peak area tryps. MH+ B incub. antibody incub. Albumin + antib. (m/z) Residue 2 spectra 5 spectra 6 spectra 1149.67 066-075 1970, 4092 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1017.59 089-097 1695, 5089 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 933.56 098-105 1862, 4869 0, 0, 132, 0, 0 0, 0, 0, 0, 0, 0, 1434.65 106-117 809, 1010 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 927.55 162-168 6036, 13066 504, 118, 473, 448, 895, 216, 281, 288 724, 2346, 1571 1074.63 206-214 3064, 7917 0, 0, 0, 0, 0 0, 0, 0, 0, 0, 0 1443.74 287-298 583, 1394 0, 0, 0, 0, 0, 0, 0, 53, 0, 0, 0, 1546.91 299-310 2283, 4675 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1311.84 362-372 1036, 1482 0, 0, 0, 0, 0, 0, 0, 51, 0, 407 (1312), 226 (1312) 1552.71 384-396 2186, 0027 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1657.87 414-426 2519, 2978 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 212 (1656.64) 960.62 427-434 15276, 32846 267, 315, 931, 591, 1284, 199, 494, 309 1015, 2963, 1998 1138.56 500-508 1360, 4659 0, 0, 0, 0, 0, 0, 258, 0, 0, 0, 204 (1139) 1342.72 570-581 2720, 3758 0, 0, 0, 0, 0 0, 0, 0, 0, 0, 0
TABLE-US-00003 TABLE1B Aminoacidsequenceofthepeptideresiduesof HSAboundbymAbA. MH+(m/z) Residue Sequence 1149.67 066-075 LVNEVTEFAK(SEQIDNO:104) 1017.59 089-097 SLHTLFGDK(SEQIDNO:84) 933.56 098-105 LCTVATLR(SEQIDNO:85) 1434.65 106-117 ETYGEMADCCAK(SEQIDNO:86) 927.55 162-168 YLYEIAR(SEQIDNO:87) 1074.63 206-214 LDELRDEGK(SEQIDNO:88) 1443.74 287-298 YICENQDSISSK(SEQIDNO:89) 1546.91 299-310 LKECCEKPLLEK(SEQIDNO:90) 1311.84 362-372 HPDYSVVLLLR(SEQIDNO:91) 1552.71 384-396 CCAAADPHECYAK(SEQIDNO:92) 1657.87 414-426 QNCELFEQLGEYK(SEQIDNO:93) 960.62 427-434 FQNALLVR(SEQIDNO:94) 1138.56 500-508 CCTESLVNR(SEQIDNO:95) 1342.72 570-581 AVMDDFAAFVEK(SEQIDNO:96)
[0048] In order to further confirm these results the monoclonal antibody mAb A was allowed to bind to the denatured albumin (previously digested by trypsin at a concentration of 0.02 ng/ml) in order to protect the peptide sequences of the epitope. The complex was then again treated with trypsin. MALDI-TOF ms was then performed and the peptide mass spectra generated from albumin were compared with spectra generated from denatured albumin trypsin-treated in the absence of antibody. The same fourteen masses out of 39 albumin masses disappeared completely or were significantly reduced in the sample were the mAb was present during trypsin treatment (Table 1 A, Column E). Multiple readings were taken to verify the results.
[0049] Important peptide fragments might not be identified because of the possibility that the mAb binding epitope of albumin is cleaved by trypsin, resulting in fragments of the epitope with too low binding affinity to bind to the mAb. Therefore, an alternative method was also used.
[0050] MALDI epitope mapping of mAb A based on antibody protection of proteolysis was repeated. This time a slightly different approach was used. Denatured HSA was incubated with mAb A. Albumin not bound by the antibody, was removed from the sample by size exclusion on an ultra filter. The remaining free mabs and the complexes of mab-albumin was then digested with trypsin (sequences of the albumin molecule to which mab is bound should resist the trypsin digestion). Small cleaved fragments of mab and unprotected albumin was then removed from the sample by ultrafiltration (30 kD). The complexes of mAb and bound albumin fragments were dissociated by lowering the pH to 2.7. Again ultrafiltration at 30 kD was performed to separate whole mAb from albumin fragments smaller than 30 kD. MALDI TOF analysis of these fragments did not identify spectra typical for albumin. Reasonably, because the fragments containing the epitope of mAb A were still too large. This filtrate (<30 kD) was then further digested with trypsin (for cleavage of sites previously protected by the mAb) in order to generate peptide masses suitable for analysis with MALDI TOF ms.
[0051] After this second trypsin treatment, eight of 32 masses detected by MALDI TOF ms matched to albumin (Table 2). Thus, these now identified amino acid sequences comprise a part of the epitope, which also contains sequences on the other side of the trypsin cleavage point.
TABLE-US-00004 TABLE2 Albuminpeptidesgeneratedbytrypsinationoflarger fragmentselutedfrommAbA. Albumin Mass residue Peakarea Databasesequence 875.49 243-249 481 LSQRFPK(SEQIDNO:97) 927.47* 162-168 1035 LYLEIAR(SEQIDNO:98) 933.51* 98-105 744 LCTVATLR(SEQIDNO:99) 940.41 131-138 534 DDNPNLPR(SEQIDNO:100) 960.55* 427-434 1345 FQNALLVR(SEQIDNO:101) 1074.52* 206-214 644 LDELRDEGK(SEQIDNO:102) 1138.47* 500-508 119 CCTESLVNR(SEQIDNO:103) 1149.53 66-75 1918 LVNEVTEFAK(SEQIDNO:104) (1149.61)*
[0052] Six of the eight peptide masses (marked with* in Table 2) were peptide masses that also disappeared when analysed previously when completely cleaved albumin was incubated with the mAb A before the MALDI-TOF analysis (Tables 1A and B).
[0053] The epitope/s of this antibody was thus established. It is important to note that multiple such structures are present in the albumin molecule, which can then cause cross-linking of the receptors to which they are bound. A previous study into the antigenicity of albumin, based on 13 different monoclonal antibodies, has shown that intramolecular cross-reactivity exists between different domains in human albumin (5), thus multiple epitope sites for mAb A on albumin may be expected.
[0054] Based on these consistent results, a common pattern was found. Glutamic acid was found at a distance of 5 or 6 amino acids from lysine, either in the peptide sequences identified by MALDI-TOF or in the sequence adjacent to the peptide sequence identified by this technique (that is on the other side of the trypsin cleavage point, at K (lysine), (Table 3)). It is interesting to note that in 4 of these sequences an additional glutamic acid was found at a distance of 2 or 3 amino acids from the first glutamic acid residue. These additional glutamic acid residues might be of importance for the affinity or signal transduction of these peptides. The biological activity of these peptides might also be influenced by the occurrence of acidic amino acids both at a distance of 121 amino acids (position 12) from the first glutamic acid residue E (in the E5K structure) and at a distance of 31 amino acids (position +3) from the lysine residue K (in the E5K structure. Due to the length of the two important amino acids, glutamic acid (E) and lysine (K), in the epitope of mAb A, the exact fixed distance between these amino acids is not necessary for the immunoregulatory activity of these fragments. Thus, a sequence of E3-7K can have immunoregulatory activity similar to that of the E5K sequence (Table 4 A and B).
TABLE-US-00005 TABLE3 PeptidesequencessurroundingtheE5KandE6Kstructuresselectedfor synthesisofpeptidesfortestingofimmunologicalactivity.Onepeptide withtheE6Kstructureisincludedinthetable(sequence2). Sequence1 Residue D H V K L V N E V T E F A K T C V A (SEQID 062-078 NO:105) MassMH+ (m/z) 1149.67 L V N E V T E F A K (SEQID NO:104) E5Kmotif E V T E F A K (SEQID NO:18) Synthesized 2604 K L V N E V T E F A K T peptide (SEQID NO:106) Sequence2 Residue T L R E T Y G E M A D C C A K Q E P E R N E (SEQID 103-124 NO:107) MassMH+ (m/z) 1434.65 E T Y G E M A D C C A K (SEQID NO:139) E5Kmotif E M A D C C A K (SEQID NO:30) Synthesized 2607 E M A D C C A K Q E P E peptide (SEQID NO:108) Sequence3 Residue F H D N E E T F L K K Y L Y E I A R R H P (SEQID 151-171 NO:109) MassMH+ (m/z) 927.55 Y L Y E I A R (SEQID NO:98) E5Kmotif E E T F L K K (SEQID NO:20) Synthesized 2605 N E E T F L K K Y L Y E peptide (SEQID NO:110) Sequence4 Residue L L P K L D E L R D E G K A S (SEQID 202-219 NO:111) MassMH+ (m/z) 1074.63 L D E L R D E G K (SEQID NO:136) E5Kmotif E L R D E G K (SEQID NO:22) Synthesized 2606 K L D E L R D E G K A S peptide (SEQID NO:112) Sequence5 Residue Q N C E L F E Q L G E Y K F Q N A L L V R Y T K (SEQID 414-437 NO:113) MassMH+ (m/z) 960.62 F Q N A L L V R (SEQID NO:101) E5Kmotif E Q L G E Y K (SEQID NO:27) Synthesized 2608 E L F E Q L G E Y K F peptide (SEQID NO:114)
[0055] Five of these peptides were synthesized (Table 3) and their immunoregulatory functions have been investigated. Based on these studies it was postulated that both stimulatory and inhibitory peptide sequences are present in serum albumin.
[0056] ConclusionEpitope Mapping by MALDI-TOF MS
[0057] The Epitope of mAb A has been Identified as the E5-6K Structure
[0058] The biologically relevant structure is thus E3-7K, possibly with additional acidic amino acid residues at positions 12 and +3. Taken together, these results indicate that mAb A can bind to multiple regions of the albumin molecule. Since the experiments were performed with denatured albumin, these epitopes are probably not sites generated by combining residues when the molecule is folded.
[0059] Binding Activity of E5K PeptidesInhibition of mAb A Binding to dHSA
[0060] In order to test the specificity of the synthesized peptides, they were tested in an ELISA where inhibition of the binding of mAb A to plates coated with dHSA was analysed. A high binding of the antibody to the plate is thus consistent with no inhibitory activity and this binding is reduced when an inhibitory substance is added to the system. As shown in
[0061] Expression of the E5K Epitope in Tumour CellsCorrelation to Survival
[0062] It has previously been demonstrated, by using immunohistochemical staining with mAb A, that the E5K epitope/structure is expressed by several types of cancer cells (WO 06/043891). A series of 20 biopsies from melanoma patients were stained using this technique and the staining intensity was scored from + to +++ using a light microscope. A considerable variation in staining intensity was observed. Based on the most intensely stained areas of the sections the patients were ranked from high to low expressors of E5K. The number of patients was then divided into two equal groups, high and low expressors, and a possible difference in survival between these groups was analysed according to Kaplan Meyer and a log rank analyses. As is shown in
[0063] Immunomodulatory Activity of E5K Peptides
[0064] Effect of Peptides on PHA Induced Proliferation of PBMCs
[0065] The effect of two albumin peptides, 2605 and 2608, on PHA induced proliferation of PBMCs from one healthy control and two cancer patients was tested. As shown in
[0066] To further analyse the inter individual differences in the effect of these peptides PBMCs from healthy controls and 4 patients were analysed (
[0067] Effect of dHSA on PHA Induced Proliferation of Peripheral Blood Mononuclear Cells (PBMCs)
[0068] The effect of dHSA on PHA induced proliferation of PBMCs from healthy controls and cancer patients is quite variable (
[0069] Effect of Peptides on dHSA Modulated PHA Induced Proliferation of PBMCs
[0070] Next the effect of different peptides, 2605 or 2608, on dHSA enhanced PHA induced proliferation was analysed. As shown in
[0071] Effect of Peptides on Monokine Production by PBMCs
[0072] The effect of albumin peptides, 2604-2608, on LPS induced IL-6 production is shown in
[0073] Thus all five peptides have immunomodulatory activity, but the effect varies depending the immune status of the investigated individual.
[0074] Effect Albumin Peptides on Immunohistochemical Staining of PBMC Using an Anti-Integrin Antibody
[0075] The immunobiological importance of albumin amino acid sequences was further studied by analysing their influence on the binding of a monoclonal antibody to the f-integrin LFA-1 (CD11a) on immune cells (
[0076] Cytospin preparations of mononuclear blood cells from healthy controls, cancer patients and a monocytic cell line, THP-1, were prepared (as described under materials and methods), dried and stored at 70 C. In the immunocytological staining, unspecific staining was blocked by incubation with 10% human AB serum. Some of the slides were preincubated for 60 minutes with albumin peptides at a concentration of 40 g/ml, added to this 10% AB serum, as indicated in the
[0077] As shown in
[0078] Binding of Peptides Generated by Trypsination of dHSA by Cell Surface Receptors
[0079] Based on the observation that immunoregulatory peptide sequences are present in serum albumin, there is the possibility that other sequences than the epitope of mAb A have immunoregulatory function. Therefore an artificial cell surface (ACS) was prepared as described in materials and methods. The mixture of peptides obtained after trypsination was adsorbed by ACS and the binding peptides were identified by comparing adsorbed and unadsorbed peptide solutions using the MALDI TOF ms technique. These peptides are shown in Table 5 A.
TABLE-US-00006 TABLE5A PeptidesgeneratedbytrypsindegradationofdHSAandthedegreeof adsorptiontothereceptorsofACS.Theaminoacidswithinbracketsshowthe proteasecleavagepointandarenotincludedintheidentifiedmasses. ACSadsorbedpeptides SynthesizedE5Kpeptides Percent Start E5K Start adsorbed Sequence End Peptide Sequence End 0.71 (K)KYLYEIAR(R)(SEQID 161-168 2605 153-168 NO:115) 0.64 (K)KVPQVSTPLVEVSR(N) 438-452 (SEQIDNO:116) 0.60 (K)VFDEFKPLVEEPQNLIK 397-413 (Q)(SEQIDNO:193) 0.59 (K)VPQVSTPTLVEVSR(N) 439-452 EMADCCAKQEPE (SEQIDNO:142) (SEQIDNO:108) 0.42 (R)RPCFSALEVDETYVPK 509-524 (E)(SEQIDNO:119) 0.41 (K)FQNALLVR(Y)(SEQID 427-434 NO:101) 0.36 (K)SLHTLFGDK(L)(SEQID 89-97 ELFEQLGEYKF NO:84) (SEQIDNO:114) 0.36 (K)LKECCEKPLLEK(S) 299-310 EMADCCAKQEPE (SEQIDNO:122) (SEQIDNO:108) 0.35 (K)LCTVATLR(E)(SEQID 98-105 NO:85) 0.34 (K)YLYEIAR(R)(SEQID 162-168 2605 153-168 NO:115) 0.32 (K)CCAAADPHECYAK(V) 384-396 (SEQIDNO:125) 0.29 (K)AAFTECCQAADK(A) 187198 KLDELRDEGKAS (SEQIDNO:126) (SEQIDNO:112) 0.26 (K)CCTESLVNR(R)(SEQ 500-508 IDNO:127) 0.26 (K)QEPERNECFLQHK(D) 118-130 2607 KLVNEVTEFAKT 110-122 (SEQIDNO:132) (SEQIDNO:106) 0.23 (K)AVMDDFAAFVEK(C) 570-581 (SEQIDNO:129) 0.22 (R)NECFLQHK(D)(SEQID 123-130 NO:130) 0.20 (K)QNCELFEQLGEYK(F) 414-426 2608 417-427 (SEQIDNO:144) 0.18 (K)QEPERNECFLQHK(D) 118-130 2607 110-122 (SEQIDNO:132) 0.13 (K)VHTECCHGDLLECADDR 265-281 (A)(SEQIDNO:133) 0.08 (R)FKDLGEENFK(A)(SEQ 35-44 EMADCCAKQEPE IDNO:134) (SEQIDNO:108) 0.03 (K)YICENQDSISSK(L)(SEQ IDNO:135) 287-298 0.02 (K)LDELRDEGK(A)(SEQID 206-214 2606 205-217 NO:136) 0.01 (K)DDNPNLPR(L)(SEQID 131-138 ELFEQLGEYKF NO:137) (SEQIDNO:114) -0.02 (K)LVNEVTEFAK(T)(SEQ 66-75 2604 EMADCCAKQEPE 65-76 IDNO:138) (SEQIDNO:108) -0.08 (R)ETYGEMADCCAK(Q) 106-117 (SEQIDNO:139) -0.37 (R)YKAAFTECCQAADK(A) 185-198 (SEQIDNO:140)
[0080] Based on their degree of binding and their spatial relation to the E5K structures of albumin, four new peptides were selected to be synthesized and investigated for their immunoregulatory activity (Table 5 B).
TABLE-US-00007 TABLE5B ACSadsorbedpeptides Synthesizedalbuminpeptides Perent Start Adsorbed Sequence Start End Peptide Sequence End 0.71 (K)KYLYEIAR(R)(SEQ 161 168 3026 NEETFLKKYLYEIARRHPYFYA 153-176 IDNO:115) P(SEQIDNO:145) 0.64 (K)KVPQVSTPTLVEVSR 438 452 3029 KVPQVSTPTLVEVSR(SEQID 438-452 (N)(SEQIDNO:116) NO:146) 0.60 (K)VFDEFKPLVEEPQNLI 397 413 3028 VFDEFKPLVEEPQNLIK(SEQ 397-413 K(Q)(SEQIDNO:117) IDNO:117) 0.20 (K)QNCELFEQLGEYK(F) 414 426 3027 ELFEQLGEYKFQNALLVR 417-434 (SEQIDNO:144) (SEQIDNO:147) RelatedE5Kpeptide2605(3026) NEETFLKKYLYE(SEQID 153-168 NO:110) RelatedE5Kpeptide2608(3027) ELFEQLGEYKF 417-427 (SEQIDNO:114)
[0081] Immunomodulatory Activity of Peptides Generated by Trypsin
[0082] Effect of peptides on dHSA modulated PHA induced proliferation of PBMCs Two of the peptides in the new series, 3026 and 3028, were tested and compared to peptide 2605 in an analysis for their effect on dHSA modulated PHA stimulated proliferation (
[0083] Effect of Peptides on Interleukin-2 Induced Proliferation of PBMCs
[0084] The peptides of the new series, 3026-3029, were also tested for their effect on IL-2 induced proliferation. As shown in
[0085] Effect of the New Series of Peptides on Monokine Production by PBMCs
[0086] The effect of the new series of peptides showed a considerable difference in effect even between healthy control individuals (
[0087] Similar to the effect of the new series of peptides on PBMC from healthy controls, also PBMC from cancer patients showed considerable inter-individual differences (
[0088] Binding of Peptides Generated by Asparaginase Degradation of dHSA by Cell Surface Receptors
[0089] The full peptide sequence of albumin is not recovered using the MALDI-TOF technique after trypsin degradation. In addition, some sequences with the capacity to bind to cell surface receptors of immune cells, might have been degraded by trypsin treatment. Therefore, the same experimental procedure as described above was used also for a peptide mixture obtained by degradation using asparaginase. The resulting ACS binding peptides are shown in Table 6 A and B.
[0090] In addition to the peptides generated by trypsin degradation another six peptides with a molecular weight of 700-3600 Da were found to be efficiently adsorbed (65%) by the cell surface structures on the ACS column (Table 6A)
TABLE-US-00008 TABLE6A Perent Start Adsorbed Sequence End 1.00 DHVKLVNEVTEFAKTCVA(SEQIDNO:105) 62-79 1.00 DDKETCFAEEGKKLVAASQAALGL(SEQIDNO:151) 586-609 0.87 DRVTKCCTESLVNRRPCFSALEV(SEQIDNO:152) 495-517 0.86 DETYVPKEFNAETFTHA(SEQIDNO:153) 518-535 0.65 DSISSKLKECCEKPLLEKSHCIAEVEN(SEQIDNO:154) 293-319 0.65 DKLCTVATLRETYGEM(SEQIDNO:155) 96-112
[0091] Seven peptides of a molecular weight between 3200 and 9000 Da were found to be completely adsorbed by ACS and for one of the peptides of this group, 37% was bound. In this analysis another 9 peptides were not at all bound by ACS.
TABLE-US-00009 TABLE6B ACSAdsorbedASP-DHSA Percent adsorbed Sequence StartEnd 1.00 YSVVLLLRLAKTYETTLEKCCAAADPHECYAKVF(SEQID 364-398 NO:156) 1.00 KLCTVATLRETYGEMADCCAKQEPERNECFLQHK(SEQID 96-130 NO:157) 1.00 ICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVM(SEQID 536-572 NO:158) 1.00 LAKYICENQDSISSKLKECCEKPLLEKSHCIAEVEN(SEQID 283-319 NO:159) 1.00 VFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAA 348-388 (SEQIDNO:160) 1.00 LGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVA 37-79 (SEQIDNO:161) 1.00 RVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA 495-535 (SEQIDNO:162) 0.37 YLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEV 475-517 (SEQIDNO:163)
[0092] Two peptides in this group did not bind at all and for one peptide (SISSKLKECCEKPLLEK SHCIAEVEN DEMPA) (SEQ ID NO:195) contradictory results were obtained regarding adsorption by ACS.
[0093] Thus, asparaginase treatment generates peptide sequences other than those generated by trypsin, which efficiently bind to cell surface structures of immune cells. Based on results described above these structures will most likely have an immunomodulating activity.
[0094] Occurrence of ACS Binding Fragments of IgG in Cancer Patients
[0095] In order to further identify the occurrence of immune cell binding structures in vivo, blood plasma was prepared and affinitiy chromatography was performed as described above. The substances bound by the ACS column were eluted, fractionated on 2D gel-electrophoresis and identified using the MALDI TOF technique. As expected the areas of the 2D gel corresponding to albumin and immunoglobulins were identified. In addition, other immune cell binding substances were also identified (
TABLE-US-00010 TABLE 7 Proteins identified by MALDI-TOF ms. 1. IgA heavy chain variable region Acc. #: 3004672 2. Immunoglobulin heavy chain variable and Acc. #: 2198477 joining regions 3. Immunoglobulin heavy chain Acc. #: 1669777 Ig heavy chain V region (clone LUNm03) Acc. #: 484974 4 SERTA domain-containing protein 2 Acc. #: Q14140 (TRIP-Br2) 5. Immunoglobulin heavy chain variable region Acc. #: 42632530
[0096] Thus, besides serum albumin also other normally occurring proteins are substrates for generation of immunoregulatory fragments.
[0097] Thus it can be concluded and as it is clearly shown in the present patent application that sequences of normally occurring proteins such as serum albumin and IgG bind to cell surface receptors of immune cells and have immunoregulatory activity. Both stimulatory and inhibitory sequences have been identified. In addition, cross-linking of receptors on immune cells was found to be one mechanism whereby the function of these cells can be modulated.
[0098] Human Ex Vivo Model for Evaluation of Immunosuppression in Cancer Patients
[0099] IL-2 is of fundamental importance for initiation and stimulation of an immune response and the activity of this cytokine is often inhibited in cancer related immunosuppression. Therefore, a human ex vivo model for immunosuppression in cancer patients (
[0100] The response to IL-2 in this model was demonstrated to correlate to over-all survival of the patients (
[0101] Identification of Additional Immunoregulatory Peptides
[0102] Artificiell cell surface columns (ACS) were used in order to identify peptide sequences from albumin binding to immune cell surface receptors. After biotinylation, such receptors were bound to streptavidin beads. Peptides binding to such columns were after elution identified by the MALDI-TOF technique. Based on these results and their relation to previously identified albumin peptides, five peptides were synthesized. Their immunoregulatory activity was primarily tested on the response to IL-2.
[0103] The effect of different peptides on IL-2 induced proliferation was analysed in the human ex vivo model. The 3028 peptide regularly inhibits IL-2 induced proliferation, but none of the other peptides identified by their binding to the artificial cell surface had any inhibitory activity (
[0104] The inhibitory activity of peptide 3028 on IL-2 induced proliferation can be demonstrated also in cultures with cancer patient PBMCs, even if the response to IL-2 was already suppressed (
[0105] Further Characterization of the Effect of Peptide 3028 on IL-Induced Proliferation
[0106] As certain albumin neo-structures have previously been found to have immunomodulatory activity and the C-terminal part of peptide 3028 has a similar structure, the C- and N-terminal parts of peptide 3028 were synthesized and analyzed separately and in combination. Obviously the inhibitory activity of the two parts of peptide 3028 is much weaker (
[0107] Characterization of a Rabbit Antiserum and Affinity Purified Rabbit Antibodies Directed Against the 3028 Peptide
[0108] Rabbit antisera directed against the albumin peptide 3028 Binds to dHSA and to a lesser extent to kHSA. Two antisera, R and L, from two different rabbits were tested. These serum antibodies bind preferentially to the 3325 but not to the 3218 fragment of 3028. Similar results are also obtained with the affinity purified antibodies (see
[0109] Immunomodulatory Effect of Affinity Purified Rabbit Antibodies Directed Against the 3028 Peptide
[0110] As shown in
[0111] Polyclonal rabbit IgG was added to control cultures in order to make sure that the effect of the affinity purified antibodies was not due to an unspecific activity of rabbit IgG in this model. Rabbit IgG had only minimal activity. The specificity of the anti-3028 antibodies was further demonstrated as the stimulatory effect of these antibodies was neutralized by a small amount of peptide 3028 having no inhibitory activity per se. In addition adsorption of inhibitory sera by gel to which anti-3028 antibodies were bound reduced the inhibitory activity of such sera.
[0112] Similar to the results in the autologous ex vivo model the immunosuppressor activity of sera from persons with a low proliferative response to IL-2 was over-come by addition of the anti-3028 antibodies to the cultures.
[0113] Binding of Anti-3028 Antibodies to/Expression of the 3028 Epitope in/Malignant Tumours
[0114] Structures to which anti-3028 antibodies bind are widely expressed in human malignant tumours, e.g. malignant melanoma, renal cell carcinoma and colorectal cancer (see
[0115] The Receptor of Peptide 3028:
[0116] Binding of 3028 to LFA-1
[0117] Similar to the results described above for cancer patients sera and the previously identified immunoregulatory peptides the 3028 peptide have the capacity to modulate the binding of the LFA-1 antibody (HI 111) to LFA-1 of mononuclear blood cells. Both inhibition (
[0118] In agreement with these results and the effect of the 3028 peptide on IL-2 induced proliferation, it is of quite some interest to note that the anti-LFA-1 antibody used in these experiments is a potent inhibitor of IL-2 induced proliferation. Similar results have previously been published by Vyth-Dreese et al. (1993).
[0119] Binding of 3028 to the -Chain (CD25) of the IL-2 Receptor
[0120] As peptide 3028 significantly inhibits the proliferative response to IL-2, the amino acid sequence of this peptide was compared to that of IL-2 and certain similarities were found at the receptor binding site of IL-2 (Table 8).
TABLE-US-00011 TABLE8 Homologiesinaminoacidsequenceofalbumin peptide3028andasegmentofhumaninterleukin- 2,whichparticipateintheinteractionof interleukin-2withinterleukin-2receptoralpha (CD25). Peptide3028 V F D E F K P L V E E P Q N L K (SEQID NO:117): HumanIL-2 E L K P L E E (SEQID NO:194): (a.a.61-72)
[0121] Based on this observation, the effect of peptide 3028 on the binding of IL-2 to CD25 was studied. The fusion protein of CD25 and the Fc-part of IgG was bound to protein G coated micro-plates/ELISA plates and the plates were incubated with biotinylated IL-2 with or without peptide 3028 present. Amazingly, the binding of IL-2 to CD25 was enhanced by peptide 3028, indicating a three-part interaction between IL-2, CD25 and 3028. Even if the binding of IL-2 to CD25 is enhanced the proper assembly of the high affinity receptor and/or signal transduction is blocked as peptide 3028 is a potent inhibitor of IL-2 induced proliferation (see above).
[0122] Next, it was demonstrated using computer assisted molecular modeling that peptide 3028 binds to CD25 at the IL-2 binding site (
[0123] Peptide 3028, Optimal Immunosuppressive Structure:
[0124] The Physiological Inhibitory Peptide
[0125] Based on the results described above (difference in anti-proliferative activity of peptides 3218 an 3325, specificity of the affinity purified antibodies directed to peptide 3325 and not to peptide 3218, immunomodulatory activity these antibodies, and the effect of these peptides on the binding of the anti-LFA-1 mAb to immune cells) it can be concluded that neither of the minor peptides, 3218 or 3325, are as efficient as the complete peptide, 3028 (
[0126] In order to maintain the physiological nature of this inhibitory peptide, the only relevant modifications of its structure is to change its length as discussed above.
[0127] This program will thus clarify the optimal structure of peptide 3028 to be used as an immunosuppressive drug for treatment of IL-2 related/dependent pathological conditions/diseases such as T-cell malignancies, allograft rejection of organ transplants, graft versus host disease (GVH), chronic inflammatory diseases such as psoriasis and some autoimmune diseases. The rational for the therapeutic use the immunoinhibitory peptide 3028 in these conditions is demonstrated by the therapeutic activity of monoclonal antibodies directed against CD25 (the Tac-recptor)
TABLE-US-00012 TABLE9 3028 3325 3218 PHEC VFDEFKPLVE(SEQ
LIK(SEQID
ELFEQ IDNO:81) NO:172) Someantiproliferative Someantiproliferative activity activity WeakbindingtoLFA-1 WeakbindingtoLFA-1 Bindstoaffinity Doesnotbindtoaffinity purifiedantibodies purifiedantibodies
[0128] Comments on the Present Immunoregulatory Mechanism
[0129] As immunosuppression in cancer is characterized by a poor response to IL-2, inhibition of the activity of this albumin neo-structure in cancer patients have a great capacity to overcome cancer related immunosuppression. This peptide inhibits one of the fundamental mechanisms in initiation and up-regulation of an immune response, it will therefore most likely be of great value in down-regulation of the immune reactivity in chronic inflammatory and auto-immune diseases.
[0130] The immunoregulatory 3028-structure described in the present patent application is generated by a physiological mechanism present in inflammation and cancer. Therapeutic strategies based on these targets will therefore be generally applicable.
[0131] Based on current data the mechanism of action is species specific therefore analogous animal models are not applicable. Proof of concept is obtained in a human ex vivo model where the results correlates to over-all survival of cancer patients
[0132] Antibodies Specific for Albumin Peptide 3028 for Therapeutic Use
[0133] Antibodies, full-length or fragments, with specificity for 3028, as well as for any of the fragments disclosed in SEQ.ID.NO(s). 1-81, should preferably be either humanized or fully human for therapeutic applications. Such antibodies can be produced utilizing a number of established technologies.
[0134] To humanize an animal (e.g. mouse) monoclonal antibody, recombinant approaches are used to graft the complementary determining regions (CDRs) from an animal-derived hybridoma immunoglobulin cDNA to the corresponding regions of a matched human immunoglobulin cDNA. The resulting recombinant antibody can then be expressed and produced in a variety of organisms, f.ex. bacteria or mammalian cell lines.
[0135] Fully human antibodies can be obtained primarily through three different approaches; 1) by rescuing naturally occurring antibodies from immune human donors through Epstein Barr virus (EBV) transformation of B cells or through PCR-cloning and phage display. 2) by immunizing and producing hybridomas from transgenic mice, which have been created with a repertoire of human immunoglobulin germline gene sequences. 3) by screening synthetic phage libraries containing human antibody variable (V) region genes and selecting antigen-binding V-regions through phage display. The selected antibody is then cloned.
[0136] There are now multiple commercial companies that develop human antibodies towards a defined protein/peptide on a for-fee basis. In addition, new antibody-like molecules (f.ex. anticalins, affilin, affibodies) are rapidly being developed and produced as potential drug candidates. (For a review, see for example: Peterson N C. Advances in monoclonal antibody technology: Genetic engineering of mice, cells and immunoglobulins. ILAR Journal, 2005, 46:314-9.)
[0137] Effect of Albumin Peptides on Cytotoxic Activity of Natural Killer (NK) Cells from Healthy Blood Donors
[0138] Results
[0139] The NK cytotoxic activity of blood mononuclear cells from four healthy donors were tested. As seen in figure XX, the presence of peptide 3028 and, to a lesser degree, peptide 3026 reduced the percent specific lysis of K562 target cells by all four donors. Inhibition was not seen in the presence of peptide 3027, however.
[0140] Materials and Methods
[0141] Preparation of Denatured Human Serum Albumin (dHSA)
[0142] Human serum albumin (HSA) infusion solution (Pharmacia, Uppsala, Sweden) was denatured and reduced by resuspending it at a final concentration of 10 mg/ml in 8 M urea and 10 mM dithiothretiol (both from Sigma Chemical Co, St. Louis, Mo.) in 50 mM Tris-HCL (pH 7.9) for 2 h at 25 C. The HSA was then alkylated by the addition of 60 mM iodoacetamide (Sigma) and further incubated for 2 h at 25 C. in the dark. The HSA solution was diluted to a concentration of 100 ug/ml with phosphate buffered saline (PBS, Gibco BRL) and dialyzed extensively against PBS using Spectrapore 4 dialysis tubing with a cut-off of mw 12000 (Spectrum Europe, Breda, The Netherlands). Control HSA was prepared in parallel by incubating HSA at 10 mg/m in Tris-HCL (pH 7.9) followed by dialysis. Before use in tissue culture experiments the dHSA was sterile filtered through a 0.22 m syringe filter (Millipore Co, MA, USA). DHSA was either stored at 4 C. or freeze dried and stored at 20 C.
[0143] Enzymatic Cleavage of dHSA with Low-Dose of Trypsin
[0144] Buffer exchange to 25 mM NH.sub.4HCO.sub.3, pH 8, was performed on denatured HSA with Sephadex-G25 gel filtration (PD-10 desalting columns, Amersham Biosciences Europe. Uppsala, Sweden). Protein exchange was determined with Bio-Rad protein assay based on the Bradford dye-binding procedure following the manufacturer's recommendations (Bio-Rad Laboratories AB, Sundbyberg, Sweden). Sequencing grade modified trypsin (Promega, Madison, concentration after buffer WI) was added at a final concentration of 2, 0.2 or 0.02 ng/ml to denatured HSA (49 ug/ml). Alternatively, as a control, the equivalent amount of trypsin dilution buffer (50 mM C.sub.2H.sub.4O.sub.2) was added. The mixture was incubated at 37 C. for 18 hours. Trypsin activity was stopped by passage of the sample over a column with soy bean trypsin inhibitor cross-linked to CNBr activated agarose (Sigma).
[0145] Complete Enzymatic Cleavage of dHSA with High Dose Trypsin Followed by Incubation with mAb A for Epitope Mapping
[0146] Eight g of low-dose trypsin-treated dHSA was freeze dried and then dissolved in 16 l of sequencing grade modified trypsin (at 5 g/ml) (Promega) and incubated at 37 C. for 18 hours. A portion (10 l) of the tryptic digested peptides was reacted with the monoclonal antibody (mAb A) at a final concentration of 0.3 mg/ml for 2 hours at room temperature. The samples were stored at 4 C. over night and then analysed by MALDI TOF MS (see below).
[0147] Incubation of dHSA with mab Followed by Complete Enzymatic Cleavage with Trypsin for Epitope Mapping
[0148] Denatured, low-dose trypsin-treated HSA (8 g) in 25 mM NH.sub.4HCO.sub.3, pH 8, was incubated with 8 g of the monoclonal antibody (mAb A) or with a PBS control for 2 hours at 4 C. A separate control consisting of 8 g monoclonal antibody in 25 mM NH.sub.4HCO.sub.3 alone was also incubated in parallel. The samples were vortexed briefly every 10 min. The samples were then immediately dried over night in a SpeedVac vacuum concentrator (Savant, Farmingdale, N.Y.). The samples were then dissolved in 16 l of sequencing grade, modified trypsin at 5 g/ml (Promega) and incubated at 37 C. for 18 hours. The samples were stored at 4 C. over night and then analysed by MALDI TOF MS (see below).
[0149] Incubation of dHSA with mab Followed by Enzymatic Cleavage with Trypsin with Ultrafiltration Under Acidic Conditions for Epitope Mapping
[0150] Denatured HSA (80 g) was incubated with mAb A (10 g) in PBS for 18 h at room temperature. To remove free dHSA. the dHSA-mAb A reaction mixture was centrifuged for 5 min at 3000 rpm in an Amicon Ultra-15 ultrafilter with a molecular weight cut-off at 100 000 Da (Millipore Co., Billerica, Mass.). The retentate was diluted in 25 mM NH.sub.4HCO.sub.3 and again centrifuged as described above. The retentate was transferred to a sterile eppendorf microcentrifuge tube in 0.4 ml 25 mM NH.sub.4HCO.sub.3 and 0.4 g sequencing grade modified trypsin (Promega) was added. Digestion was carried out at 37 C. over night with gentle agitation. Trypsin and free (not antibody-bound) albumin fragments were removed by ultrafiltration on a Amicon Ultra-4 filter (mw cut-off 30 000 Da, Millipore Co.) for 5 min at 3000 rpm. This was repeated three times. The retentate was then transferred to a new ultra filter where the mAb A was disassociated from bound albumin by the addition of 600 l 0.1 M glycine-HCl, pH 2.7, for 30 min at room temperature after which the ultra filter was centrifuged for 10 min at 3000 rpm. The filtrate was transferred to a sterile Eppendorf microcentrifuge tube and neutralized with Tris-HCl, pH 9. The sample was then immediately dried over night in a SpeedVac vacuum concentrator. The samples were then dissolved in 16 l of sequencing grade modified trypsin (at 5 g/ml) (Promega) and incubated at 37 C. for 18 hours. Zip Tip pipette tips (Millipore) containing C.sub.18 chromatography media were used for desalting before the sample was analysed by MALDI TOF ms (see below).
[0151] MALDI TOF Mass Spectrometry
[0152] 1 l of each sample of the tryptic digestion was mixed with 1 l of a saturated solution of -cyano-4-hydroxycinamic acid (0.02 mg/ml) in 70% acetonitrile/0.3% trifluoro acetic acid. 1 l of that mixture was spotted on a stainless steel target plate and analysed using MALDI-TOF ms (Voyager-DE PRO, Applied Biosystems, CA, US) equipped with a 337 nm N.sub.2 laser. Database searches for masses corresponding to human serum albumin in the resulting spectra were performed in NCBI or SwissProt with MS-Fit as search engine.
[0153] Albumin Peptides
[0154] All synthetic albumin peptides used herein were custom prepared by CSBio Co, Menlo Park, Calif. Peptides were >95% pure as confirmed by HPLC. Peptides were kept freeze dried at minus 20 C. Peptides were reconstituted in sterile H.sub.2O (Sigma) for use in ELISA or in RPMI1640 (GIBCO) for use in cell culture experiments. Peptides were sterile filtered through a 0.22 m syringe filter (Millipore Co) before use in cell culture experiments.
[0155] Anti-dHSA ELISA, co-incubation of anti-dHSA mAb A with synthetic albumin peptides Duplicate wells in Hi-binding microtitre plates (Costar 2592, Corning Inc, NY, USA) were coated with 100 l of dHSA diluted in PBS at 4.5 g/ml and incubated at room temperature overnight. The wells where then washed with wash buffer consisting of 0.05% Tween-20 in PBS (Sigma) followed by blocking for 1 hr at 25 C. with 200 l 0.5% gelatin prepared from bovine skin (Sigma) in PBS followed by washing in wash buffer. The monoclonal antibody mAb A, diluted in ELISA reagent diluent (0.01% gelatin and 0.05% Tween-20 in 20 mM Tris buffered saline (TBS, Sigma)) at 4 ug/ml was pre-incubated for 1 hr at room temperature with the indicated concentrations of the peptides. 100 l of the monoclonal antibody alone, or, alternatively, the monoclonal antibody mixed with peptides, was then added per well and incubated for 1.5 hr at 25 C. followed by washing. Envision-HRP (DakoCytomation Norden A/S. Glostrup, Denmark) diluted 1/10 in ELISA reagent diluent was added and the plates incubated for 15 min at 25 C. followed by washing. Finally, substrate solution consisting of H.sub.2O.sub.2 and tetramethylbenzidine (R&D Systems Europe, Ltd, Abingdon, UK) was added. The reaction was stopped with 1M H.sub.2SO.sub.4 and the optical density measured as absorbance (A) at dual wavelengths, 450 nm and 570 nm, with a Multiscan EX microplate reader (Labsystems).
[0156] Correlation of Immunohistological Staining of Biopsies with an Anti-dHSA mab (mAb A) and Survival in Patients with Malignant Melanoma
[0157] Biopsies from tumours obtained from twenty patients diagnosed with metastatic malignant melanoma were immediately snap frozen in liquid nitrogen and stored at 70 C. until use. Frozen tissue sections, 6-7 m thick, were cut, thawed and fixed with acetone for 5 min at room temperature. The sections were first blocked with 10% normal human AB-serum for 1 h before staining. Primary antibody, consisting of monoclonal mouse anti-human denatured albumin (mAb-A) diluted in Tris buffered saline (TBS, pH 7.6) at 10 g/ml, was then added and the slides incubated for 30 min. The slides were washed in TBS followed by Envision-Alkaline Phosphatase (DakoCytomation) for 30 min. After additional washing in TBS, the slides were incubated in alkaline phoshatase substrate consisting of Fast Red TR salt (Sigma), naphtol AS-MX (Sigma) and 5 mM levamisol (Sigma) to block endogenous alkaline phosphatase activity, for 20 min followed by washing in TBS. They were then counterstained in Mayer's haematoxylin for 1 minute and mounted in Glycergel (Dakopatts). Monoclonal mouse IgG1 against an irrelevant antigen (Aspergillus niger glukosoxidase, DakoCytomation) was used as a negative control. All incubations were performed at room temperature in a moist chamber. Intensity of staining was evaluated in a light microscope and was ranked as low, medium or high. Survival between groups was analysed according to Kaplan Meyer and a log rank analyses.
[0158] Isolation of Peripheral Blood Mononuclear Cells (PBMC)
[0159] Venous blood was drawn from healthy volunteers or from cancer patients in glass vacuum tubes with acid dextrose citrate solution A as anti-coagulant (Vacutainer, Becton Dickinson, Franklin Lakes, N.J.). Erythrocytes were removed by sedimentation on 2% dextran T500 solution (Amersham Pharmacia Biotech AB, Uppsala, Sweden) in 0.9% NaCl (this step was omitted for cultures with PHA-stimulation-see below). PBMC were then isolated by Ficoll-paque Plus (GE Healthcare Bio-Sciences AB, Uppsala, Sweden) density gradient centrifugation after which the cells were washed twice in RPMI 1640 Dutch's modification (Gibco, InVitrogen AB, Stockholm, Sweden) with 2% human serum albumin (HSA) (Pharmacia & Upjohn, Stockholm, Sweden) (RPMI/2% HSA). For cell cultures with PHA-stimulation, PBMC were washed in Hank's Balanced Salt Solution (HBSS) with 10% autologous plasma instead of RPMI/2% HSA. Cell viability was assessed by exclusion of 0.05% Trypan Blue and was always above 95%. The cell suspension was stained with Turk's solution and the number of lymphocytes and monocytes in the PBMC preparation were counted in a hemocytometer. PBMCs were suspended in RPMI/2% HSA and the cell concentration adjusted to 510.sup.5 lymphocytes/ml.
[0160] Serum
[0161] Human serum was collected i serum collection tubes without additives (Vacutainer, Becton Dickinson, Franklin Lakes, N.J.) at the same time as blood samples for isolation of PBMC. The sera were heat-inactivated at 56 C. for 30 minutes.
[0162] PHA-Induced Proliferation of PBMC in the Presence of Albumin Peptides and/or dHSA
[0163] PBMC from healthy volunteers, were resuspended in RPMI1640 with or without the addition of dHSA and/or albumin peptides, as indicated, at a cell concentration of 510.sup.5 lymphocytes/ml. 100 d of the cell suspension were seeded into round-bottomed microtiter plates (Corning, NY, USA) followed by 100 l of culture medium consisting of RPMI 1640 (Flow Laboratories, Irvine, Scotland) supplemented with 200 IU/ml Penicillin, 200 g/ml Streptomycin (Flow laboratories) and 20% heat inactivated autologous serum. Phytohemagglutinin (PHA-P, Sigma Chemical Co, St. Louis, Mo.) at a final concentration of 5 or 10 g/ml was then added. All culture conditions were set up in triplicate wells. Cells were cultured for 3 days in a humidified 5% CO.sub.2 atmosphere at 37 C. Proliferation was assayed by incorporating of 1.6 Ci/well of [.sup.3H]thymidine (Amersham International, U K) during the last 18 hr. Mean values of disintegrations per minute (dpm) of triplicates were used for the calculations.
[0164] LPS-Induced IL-6 Production, Effect of Peptides
[0165] 100 l of culture medium consisting of RPMI1640 supplemented with 200 IU/ml penicillin, 200 g/ml streptomycin, 4 mM L-glutamine (Sigma Chemical, MO. US) and 20% fresh heat-inactivated autologous serum were added to un-coated or -pre-coated microtiter plates followed by 100 l of PBMC suspension (510.sup.4 lymphocytes) in RPMI/2% HSA with peptides at the indicated concentrations. Lipoplysaccharide (LPS, Sigma Chemical Co, MO, US) was added at a final concentration of 0.05 ng/ml. Cells were cultured in a humidified, 5% CO.sub.2 atmosphere at 37 C. All assay conditions were set up in triplicate wells. Supernatants (SNs) were harvested after 24 hrs and residual cells were removed by centrifugation in a refrigerated centrifuge (Beckman) at 2600g for 5 minutes. SNs were frozen and stored at 70 C. IL-6 in cell culture SNs was measured by ELISA using the DuoSet ELISA development kit for human IL-6 (R&D Systems Europe, Ltd., Abingdon, UK) following the manufacturer's recommended procedures. The lower limit of detection was 3.1 g/ml. Samples were analysed as mean of triplicate wells.
[0166] Interleukin-2 (IL-2) Induced Proliferation of PBMC in the Presence of Albumin Peptides in Coated and Uncoated Tissue Culture Plates
[0167] Round-bottomed, 96-well tissue culture plates (Costar, Corning Inc. NY, US) were pre-coated with HSA only or HSA and pooled human IgG for intravenous injection (Gammagard, Baxter AS, DK) as follows; HSA was diluted in RPMI1640 without supplements to a concentration of 10 mg/ml. A mixture of 1 mg/ml IgG in a solution of 9 mg/ml HSA in RPMI (HSA/IgG) was also prepared. 200 l of HSA or HSA/IgG were then added to each well of the plate. The plates were incubated at 4 C. for 30 minutes after which the wells were washed twice with 200 l of RPMI1640. The coated plates were used immediately. 100 l of RPMI1640 supplemented with 200 IU/ml penicillin, 200 l/ml streptomycin, 4 mM L-glutamine (all from Sigma Chemical Co. MO, US) and 20% heat-inactivated human serum (autologous) were added to the HSA or HSA/IgG coated tissue culture microtiter wells. PBMC, isolated from healthy individuals, were diluted in RPMI/2% HSA and peptides were added directly to the cell suspension at a concentration of 10 g/ml. One hundred l of this cell suspension (510.sup.4 lymphocytes) was then added per well providing a final concentration of 5 g/ml peptide per well. IL-2 (Proleukin, Chiron, NL), at a final concentration of 120 IU/well, was added to the wells. Cells were cultured for 7 days in a humidified, 5% CO.sub.2-atmosphere at 37 C. Proliferation was assayed by incorporation of 1.6 Ci/well of [3H]-thymidine (Amersham Int., UK) during the last 18 hrs. Mean values of dpm (disintegrations per minute) of triplicates were used for the calculations.
[0168] Immunocytochemical Staining of PBMC and a Human, Monocytic Cell Line with an Anti-Integrin (CD11a) Antibody in the Presence or Absence of Albumin Peptides
[0169] PBMC were separated as described above. Cultured THP-1 cells (obtained from the American Type Culture Collection through LGL Nordic AB, Sweden) were carefully washed and suspended in RPMI1640. PBMC and THP-1 were immediately spun down on pre-cleaned microscope slides in a Shandon Cytospin (Shandon Scientific Ltd, UK) at 1000 RPM for 7 min at 2.5 or 510.sup.4 cells per slide. The slides were left to dry at room temperature over night, after which they were wrapped in parafilm and stored at 70 C. Immediately before use, the cytospins were thawed and fixed with acetone for 5 min at room temperature. The cytospins were first blocked with 10% normal human AB-serum with and without albumin peptides (40 g/ml) for 1 h before staining. Primary antibody, consisting of a monoclonal mouse anti-human CD11a (clone HI111, BD Biosciences) diluted in Tris buffered saline (TBS, pH 7.6) at 5 g/ml (THP-1) or 1 g/ml (PBMC), was added. The slides were incubated for 30 min and then washed in TBS followed by Envision-Alkaline Phosphatase (Dako Norden A/S, Denmark) for 30 min. After additional washing in TBS, the slides were incubated in alkaline phoshatase substrate consisting of Fast Red TR salt (Sigma), naphtol AS-MX (Sigma) and 5 mM levamisol (Sigma) to block endogenous alkaline phosphatase activity, for 20 min followed by washing in TBS. They were then counterstained in Mayer's haematoxylin for 1 minute and mounted in Glycergel (Dako Norden A/S). Monoclonal mouse IgG1 against an irrelevant antigen (Aspergillus niger glukosoxidase, Dako Norden A/S) was used as a negative control. All incubations were performed at room temperature in a moist chamber.
[0170] Proteolytic Fragmentation of Denatured Human Serum Albumin (dHSA) with Trypsin or Endoproteinase ASP-N
[0171] Freeze dried dHSA (0.5 mg) was reconstituted in 25 mM NH.sub.4HCO.sub.3, pH 8, containing 10 mg sequencing grade modified trypsin (Promega Corporation, WI) or 2 mg Endoproteinase ASP-N (Sigma) and incubated at 37 C. over night. To remove unfragmented albumin and enzyme, the sample was ultra filtered through an Amicon Ultra 4 (mw cut-off of 5000) or a Centriplus (mw cut-off 10000) centrifugal filter (Millipore AB, Solna, Sweden). The filtrate, containing fragmented dHSA without enzymes, was collected and diluted with PBS with Ca and Mg (GIBCO).
[0172] Preparation of Cell Lysate from PBMC with Biotinylated Cell Surface Proteins (ACS)
[0173] Buffy coats generated from 450 ml blood each was collected from 4 healthy donors. Erythrocytes were removed by sedimentation on 2% dextran T500 solution (Amersham Pharmacia Biotech AB, Uppsala Sweden) in 0.9% NaCl. Mononuclear cells (PBMC) were then isolated by Ficoll-Paque Plus (GE Healthcare Bioscience AB Sweden) density gradient centrifugation. The PBMC were then suspended in phosphate buffered saline (PBS) containing Ca and Mg (GIBCO) at a concentration of 1010.sup.6/ml. EZ Link Sulfo-NHS-biotin (Pierce USA) was added at a final concentration of 0.2 mg/ml and the mixture incubated on a shaker at room temperature for 10 min. Excess biotin was then removed by washing the PBMC in PBS. Biotinylated PBMC were then lysed by adding 1.0 ml ice-cold lysing buffer (50 mM Tris-HCL, pH 7.5, with 0.15 M NaCl, 5 mM MgCl.sub.2 containing 100 mM Octyl glucoside and 1 mM Phenylmethylsulfonyl fluoride) per 210.sup.7 pelleted cells with gentle shaking, then incubated for 30 min. on ice. Debris was removed by centrifugation at 5000g at 4 C. for 10 min and the supernatants was collected and pooled from all four donors. The lysate was then stored at 70 C. in polypropylene plastic tubes.
[0174] Preparation of affinity column with biotinylated cell surface proteins from mononuclear cells coupled to streptavidin-sepharose (used for adsorption of trypsin fragmented dHSA) 18 ml biotinylated cell lysate in lysate buffer was diluted 1/10 in binding buffer (20 mM NaH.sub.2PO.sub.4, 0.15 M NaCl, pH 7.5). This amount of lysate corresponds to 3610.sup.7 mononuclear cells. It was added to a 1 ml Hitrap Streptavedin HP affinity column (Amersham Biosciences).
[0175] To block possible remaining free biotin, 5 ml of 0.1 M glycine (Sigma) was added to the column. Unsaturated streptavedin on the column was then reacted with 150 ug biotin (Sigma) in binding buffer. The column was carefully washed with PBS and stored in PBS with 0.1% NaN.sub.3 at 4 C. until use.
[0176] Preparation of affinity column with biotinylated cell surface proteins from mononuclear cells coupled to streptavidin-sepharose (used for adsorption of ASP-N fragmented dHSA) Biotinylated cell lysate in lysate buffer underwent buffer exchange by dialysis with Spectrapore 4 dialysis tubing (Spectrum Europe, Breda, The Netherlands) in binding buffer (20 mM NaH.sub.2PO.sub.4, 0.15 M NaCl pH 7.5). 27 ml biotinylated cell lysate in binding buffer (corresponding to 5410.sup.7 mononuclear cells) was added to 1.5 ml washed Streptavidin Sepharose HP (Amersham Biosciences). To block possible remaining free biotin, 25 ml of 0.1 M glycine (Sigma) was added to the Streptavidin Sepharose. Unsaturated streptavedin was then reacted with 225 g biotin (Sigma) in binding buffer. The Streptaivin Sepharose was carefully washed in PBS. One ml of the biotinylated cell lysate coupled Streptavidin Sepharose was then packed in an empty column (Tricorn Empty High Performance Column, Amersham Bioscience) and washed with phosphate buffered saline (PBS) containing Ca and Mg (GIBCO).
[0177] Adsorption of Enzyme Fragmented dHSA Using an Affinity Column with Biotinylated Cell Surface Proteins (ACS)
[0178] Two ml of enzyme-fragmented dHSA in PBS, corresponding to a total of 0.2 mg protein, was passaged over the ACS column, prepared as described above. The flow-through was collected with consideration taken to void volume and dilution of adsorbed sample by collecting in small portions of 0.2 ml. Thirty ul of each sample, including a control sample that has not been adsorbed, were dried in a Speed-Vac centrifuge.
[0179] Mass Spectrometry
[0180] Dried samples were reconstituted in 10 ul of 0.1% TFA. Zip Tip pipette tips (Millipore, USA) containing C.sub.18 reversed-phase media were used for desalting reconstituted samples. For analysis of samples in the mass range 700-3600 Da, one l of each Zip Tip eluted sample was mixed with 1 l of a saturated solution of -cyano-4-hydroxycinamic acid (0.02 mg/ml) in 70% acetonitrile/0.3% trifluoro acetic acid. For the analysis of samples in the mass range 1500-9000 Da, one l of each Zip Tip eluted sample was mixed with 1 l of sinapinic acid (3-methoxy-4-hydroxycinnamic acid). 1 l of the mixture was spotted on the MALDI plate and analysed using MALDI-TOF MS (Voyager-DE PRO, Applied Biosystems, CA, US). Mass identity search of resulting spectra was performed in the SwissProt or NCBI databases using MS-Fit.
[0181] Identification of Proteins in Human Plasma Binding to ACS
[0182] Affinity chromatography of plasma with ACS
[0183] Plasma was obtained by plasmapheresis from a patient diagnosed with malignant melanoma. The plasma was frozen at 20 C. Upon thawing the plasma was immediately clotted by the addition of CaCl.sub.2 to a final concentration of 13 mM. The gelled plasma clot was removed by centrifugation at 3500 RPM for 7 min at 4 C. The plasma was then dialysed extensively against PBS using Spectrapore 4 dialysis tubing (Spectrum Europe, Breda, The Netherlands). An affinity column with biotinylated cell surface proteins from mononuclear cells coupled to streptavidin-sepharose (ACS-sepharose) was prepared as described above. 45 ml of the plasma was incubated with the ACS-sepharose over night at 4 C. with gentle agitation. The plasma-ACS sepharose was extensively washed with PBS. The washed ACS-sepharose was stored for five days at 4 C. in PBS with 0.1% NaN.sub.3. The ACS-sepharose was packed in an empty column (Tricom Empty High Performance Column, Amersham Bioscience) and bound proteins were eluted with 2 ml of 0.1 M Glycine-HCl, pH 2.7. The eluted fraction was immediately neutralized with 1 M Tris buffer at pH 9 and freeze dried.
[0184] 2-D Gel Electrophoresis
[0185] Freeze dried samples were desalted by reconstituting in H.sub.2O and 10% trichloro acetic acid (TCA) with 20 mM DTT in acetone. The samples were centrifuged at 13000 RPM for 5 min. The resulting pellet was washed twice with 20 mM DTT in acetone to remove TCA and finally dissolved in a rehydration buffer (8 M urea, 4% CHAPS, 10 mM DTT, 0.5% IPG buffer and a trace of orange G). Two-dimensional gel electrophoresis was performed in a horizontal 2-DE set-up (Multiphore/IPGphore, Pharmacia Biotech, SE) based on isoelectric focusing (IEF) in the first dimension and molecular mass in the second dimension. Briefly, samples were applied to IPG gels (Immobiline Dry strip, pH 3-10 NL, (GE Healthcare)) and focused overnight at 38060 Vh. SDS-PAGE was then carried out with Exelgel XL SDS 12-14 polyacrylamide precasted slab gels (Amersham Biosciences). Molecular weight standards were included in each run. Separated proteins were detected by silver stain according to the method of Shevenco. Tryptic digests of proteins spots were excised from the gel and analysed with MALDI-TOF ms as described above.
[0186] Cancer Patients
[0187] Patients, included in the analyses of over-all survival according to proliferative response of peripheral blood mononuclear cells (PBMC) to interleukin-2, were diagnosed with systemic metastatic renal cell carcinoma. They were previously untreated and scheduled for Interelukin-2 treatment (Proleukin, Chiron, NL). Blood samples were taken prior to initiation of treatment. Patients included in other studies in this patent application are briefly described as appropriate in the result section.
[0188] Ex Vivo Model of IL-2 Related Immunosuppression; Interleukin-2 (IL-2) Induced Proliferation of PBMC
[0189] PBMC were isolated from venous blood samples from healthy blood donors (controls) or cancer patients. One hundred l of culture medium (RPMI 1640 Dutch's modification (Gibco, InVitrogen AB, Stockholm, Sweden) supplemented with 200 IU/ml penicillin, 200 l/ml streptomycin, 4 mM L-glutamine (all from Sigma Chemical Co. MO, US) and 20% heat-inactivated human serum) were added to round-bottomed, 96-well tissue culture plates (Costar, Corning Inc. NY, US). One hundred l of PBMCs in RPMI/2% HSA (510.sup.4 lymphocytes) was then added per well followed by IL-2 (Proleukin, Chiron, NL) at a final concentration of 120 IU/well. Control wells without IL-2 was set up in parallel. Cells were cultured for 7 days in a humidified, 5% CO.sub.2-atmosphere at 37 C. Cell proliferation was assayed by incorporation of 1.6 Ci/well of [3H]-thymidine (Amersham Int., UK) during the last 18-24 h hrs. Mean values of dpm (disintegrations per minute) of triplicate wells were used for the calculations. In cultures were serum collected from cancer patients were used instead of autologous serum, PBMCs were from blood type compatible donors.
[0190] Interleukin-2 (IL-2) induced proliferation of PBMC in the presence of albumin peptides Cultures for IL-2 induced proliferation was set up with PBMC from healthy donors and autologous serum as described above with the exception that PBMC were first pre-incubated for 30 min at room temperature with the indicated albumin peptides at a concentration of 10 g/ml.
[0191] Generation of Rabbit Antiserum Specific for Albumin Peptide 3028
[0192] Peptide 3028 was synthesized with a cysteine added to the N-terminus end and then conjugated with keyhole limpet hemocyanin (KLH) as a carrier protein. Polyclonal antisera were generated by repeated immunizations of rabbits with KLH-conjugated peptide 3028 and Freund's adjuvants. For some experiments, the antisera were affinity purified by chromatography on peptide 3028-conjugated Ultralink lodoacetyl gels (Pierce Biotechnology Inc.). For cell culture experiments, buffer exchange to RPMI 1640 Dutch's modification (Gibco, InVitrogen AB, Stockholm, Sweden) was performed by passage over PD-10 sephadex columns (Amersham Biosciences, Uppsala, Sweden) followed by filter sterilization on 0.22 m Millex syringe filters (Millipore Co., MA, USA). Rabbit immunizations and purification of antisera were carried out by Agrisera AB, Sweden.
[0193] ELISA with Rabbit-Anti 3028 Antiserum
[0194] Duplicate wells in Hi-binding microtitre plates (Costar 2592, Corning Inc, NY, USA) were coated with 100 l of peptide 3028 (10 ug/ml), denatured HSA (denHSA. 4.5 ug/ml) or control HSA (4.5 ug/ml). All coating reagent were diluted in PBS and incubated at room temperature overnight. The wells where then washed with wash buffer consisting of 0.05% Tween-20 in PBS (Sigma) followed by blocking for 1 hr at 25 C. with 200 l 0.5% gelatin prepared from bovine skin (Sigma) in PBS followed by washing in wash buffer. Rabbit preimmune sera or anti-3028 sera, diluted 1/1000 000 in ELISA reagent diluent (0.01% gelatin and 0.05% Tween-20 in PBS), were added and incubated for 1 h at 25 C. followed by washing. Biotinylated horse anti-rabbit/mouse IgG (Vectastain ELITE, Vetor Laboratories Inc, CA, USA) diluted 1/5 in ELISA reagent diluent was then added and the plates incubated for 1 h at 25 C. followed by washing. Next, HRP-conjugated strreptavidine (R&D systems Europe, Ltd, UK) was added. Finally, after washing in wash buffer, substrate solution consisting of H.sub.2O.sub.2 and tetramethylbenzidine (R&D Systems) was added. The reaction was stopped with 1M H.sub.2SO.sub.2 and the optical density measured as absorbance (A) at dual wavelengths, 450 nm and 570 nm, with a Multiscan EX microplate reader (Labsystems).
[0195] Inhibition of Rabbit Anti-3028 ELISA by Albumin Peptides
[0196] To test if albumin peptides inhibited the binding of the rabbit anti-3028 to 3028 coated wells, rabbit antisera, diluted 1/1000 000 in ELISA reagent diluent, was pre-incubated for 1 hr at room temperature with the indicated concentrations of the peptides. 100 l of the monoclonal antibody alone, or, alternatively, the monoclonal antibody mixed with peptides, was then added to 3028 coated wells and the ELISA carried out as described.
[0197] Interleukin-2 (IL-2) Induced Proliferation of PBMC in the Presence of Affinity Purified Rabbit Anti-3028
[0198] Cultures to test the immunomodulary effect of affinity purified rabbit antibodies specific for 3028 was performed as described above for IL-2 induced proliferation with the following exceptions; 2% HSA was omitted from the washing medium and from the PBMC suspension medium. Serum containing culture medium (100 ul/well) was pre-incubated with 20 ug/ml of rabbit antibodies for 30 min at room temperature before the addition of 100 ul PBMC suspension to the culture wells.
[0199] Immunohistochemical Staining of Tumor Biopsies with Rabbit Anti-3028
[0200] Tissue sections were prepared from formalin fixed biopsies from cancer patients. Sections were de-paraffinased and blocked with 10% normal, human AB-serum in Hank's balanced salt solution supplemented with 0.01 M Hepes (BSS, GIBCO BRL) for one h prior to staining. Sections were then stained with 10 ug/ml affinity purified rabbit anti-3028 diluted in BSS with 2% AB-serum and 0.1 g/ml saponin for 30 min. After washing in BSS with 0.1 g/ml saponin, Ultravison One alkaline phosphatatase polymer specific for mouse and rabbit Ig (Lab Vision Co., CA, USA) was added. Excess polymer was then washed from the sections with BSS with 0.1 g/ml saponin. Bound polymer complex was the detected by naphthol phosphate substrate and liquid Fast Red chromogen (Lab Vision Corp.) The sections were counter stained in Mayer's haematoxylin and mounted in Glycergel.
[0201] Effect of Albumin Peptides on Cytotoxic Activity of Natural Killer (NK) Cells from Healthy Blood Donors
[0202] Mononuclear cells were separated by standard Ficoll-paque Plus (Pharmacia AB, Sweden) density gradient centrifugation from heparinized blood obtained from healthy donors. NK cell cytotoxic activity of the mononuclear cells was then tested using a commercial kit (NKTEST, Orpegen Pharma GmbH, Heidelberg, Germany) following the manufacturers protocol. Briefly, the kit contains cryopreserved, NK-sensitive target cells (K562) labelled with a lipophilic green fluorescent membrane dye, which enables discrimination of effector and target cells. After incubation with effector cells, killed target cells are identified by a DNA-stain, which penetrates and specifically stain the nuclei of dead target cells. This way the percentage of killed targets can be determined by flow cytometry. The mononuclear cells were pre-incubated for 30 min at 37 C. with the indicated peptides (peptides have been described previously) at 10 ug/ml. Target cells were then added, giving an effector:target ratio of 40:1, and the cell mixture incubated at 37 C. for 3-4 hours. Samples were analysed on a FACSCalibur (BD Biosciences, San Jose, Calif.).
BRIEF DESCRIPTION OF THE DRAWINGS
[0203]
[0204]
TABLE-US-00013 Low expression x - - x High expression
- -
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
[0217]
[0218]
[0219]
[0220]
[0221]
[0222]
[0223]
[0224]
[0225]
[0226]
[0227]
[0228]
[0229]
[0230]
[0231]
[0232]
[0233]
REFERENS LISTING
[0234] 1. Suckau D et al, PNAS, 1990, 87:9848. [0235] 2. Macht M et al, Biochhemistry, 1996, 35:15633. [0236] 3. Kiselar J G and Downard K M, Anal Chem 1999, 71:1792. [0237] 4. Davis G E, Exp. Cell Res, 1992, 200; 242. [0238] 5. Doyen N et al. Mol Immunol, 1985, 22:1-10 [0239] 6. Peterson N C. Advances in monoclonal antibody technology: Genetic engineering of mice, cells and immunoglobulins. ILAR Journal, 2005, 46:314-9.