VIRUS-LIKE PARTICLES AND USES THEREOF
20200048649 · 2020-02-13
Inventors
- Serge Muyldermans (Hoeilaart, BE)
- Gérard Demangeat (Ostheim, FR)
- GHANNAM AHMED (STRASBOURG, FR)
- Léa Ackerer (Vendenheim, FR)
- Caroline Hemmer (Colmar, FR)
- Christophe Ritzenthaler (Sélestat, FR)
- Vianney Poignavent (Strasbourg, FR)
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C12N15/8257
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to GFLV virus-like particles and the uses thereof in various fields, such as the pharmaceutical, agro, or veterinary areas.
Claims
1-16. (canceled)
17. A virus-like particle comprising a Grapevine fanleaf virus (GFLV) coat protein and at least two or three different anti-GFLV coat protein antibodies or antibody derivatives.
18. The particle of claim 17, wherein the different anti-GFLV coat protein antibodies or antibody derivatives do not compete with each other for the binding to the GFLV coat protein.
19. The particle of claim 17, wherein the antibody derivative is a nanobody or a ScFv.
20. The particle of claim 17, wherein the anti-GFLV coat protein antibodies or antibody derivatives comprise the sequences of a set of CDR 1, CDR 2 and CDR 3 from one of the following groups: TABLE-US-00012 CDR1 CDR2 CDR3 SEQ SEQ SEQ Nano- Group ID NO: ID NO: ID NO: body I 34 35 36 23 37 38 39 p75 40 41 42 101 43 44 45 126 46 47 48 p71 II 49 50 51 p59 52 53 54 125 55 56 57 155 58 59 60 37 61 62 63 77 64 65 66 171 67 68 69 159 70 71 72 p25 73 74 75 172 III 76 77 78 122 IV 79 80 81 15 82 83 84 p77 V 85 86 87 34 88 89 90 80 VI 91 92 93 38 VII 94 95 96 137 VIII 97 98 99 139 IX 100 101 102 p12
21. The particle of claim 17, wherein the anti-GFLV coat protein antibodies or antibody derivatives comprise a sequence from one of the following groups: TABLE-US-00013 SEQ Nanobody Group ID NO: (Nb) I 9 23 10 p75 8 101 7 126 11 p71 II 12 p59 13 125 14 155 15 37 16 77 17 171 18 159 19 p25 20 172 III 21 122 IV 22 15 23 p77 V 24 34 25 80 VI 26 38 VII 27 137 VIII 28 139 IX 29 p12
22. The particle of claim 20, wherein the different anti-GFLV coat protein antibodies or antibody derivatives are selected from groups I to IX.
23. The particle of claim 22, wherein: a first anti-GFLV coat protein antibody or antibody derivative is selected from Group I, a second anti-GFLV coat protein antibody or antibody derivative is selected from Group II and optionally a third anti-GFLV coat protein antibody or antibody derivative is selected from Group III; or a first anti-GFLV coat protein antibody or antibody derivative is selected from Group I, a second anti-GFLV coat protein antibody or antibody derivative is selected from Group III and optionally a third anti-GFLV coat protein antibody or antibody derivative is selected from Group II; or a first anti-GFLV coat protein antibody or antibody derivative is selected from Group II, a second anti-GFLV coat protein antibody or antibody derivative is selected from Group III and optionally a third anti-GFLV coat protein antibody or antibody derivative is selected from Group I.
24. The particle of claim 22, wherein: a first anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nb23 and Nbp75, a second anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nbp59, Nb125 and Nb155, and optionally a third anti-GFLV coat protein antibody or antibody derivative is Nb122; or a first anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nb23 and Nbp75, a second anti-GFLV coat protein antibody or antibody derivative is Nb122 and optionally a third anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nbp59, Nb125 and Nb155; or a first anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nbp59, Nb125 and Nb155, a second anti-GFLV coat protein antibody or antibody derivative is Nb122, and optionally a third anti-GFLV coat protein antibody or antibody derivative is selected from the group consisting of Nb23 and Nbp75.
25. The particle of claim 17, wherein: a) the different anti-GFLV coat protein antibodies or antibody derivatives are conjugated to a compound; or b) the different anti-GFLV coat protein antibodies or antibody derivatives are conjugated to a different compound for each anti-GFLV coat protein antibody or antibody derivative.
26. The particle of claim 25, wherein the GFLV coat protein is conjugated to a compound by covalent coupling in N-terminal of the GFLV coat protein.
27. The particle of claim 17, wherein the GFLV coat protein comprises SEQ ID NO: 1, or a sequence having at least 80% identity to SEQ ID NO: 1.
28. The particle of claim 25, wherein the compound is a therapeutic, diagnostic or imaging agent or a tag.
29. A pharmaceutical composition comprising one or more virus-like particles of claim 17.
30. A method of producing virus-like particles, comprising (i) providing a GFLV coat protein, optionally conjugated to a compound, (ii) allowing said GFLV coat protein, alone or in mixture with other proteins, to assemble into virus-like particles, and (iii) coupling the particles of (ii) to at least two different anti-GFLV coat protein antibodies or antibody derivatives.
31. A composition comprising at least two or three different anti-GFLV coat protein antibodies or antibody derivatives.
32. The composition of claim 31, wherein the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives are conjugated to a compound.
33. The composition of claim 32, wherein each anti-GFLV coat protein antibody or antibody derivative is conjugated to a different compound.
Description
LEGEND TO THE FIGURES
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
DETAILED DESCRIPTION OF THE INVENTION
[0055] The present invention relates to VLPs derived from Grapevine fanleaf virus (GFLV) coat proteins, and the uses thereof. The invention particularly provides GFLV coat proteins VLPs conjugated to compounds, and their use to produce nucleic-acid-free virus-like particles that expose compounds and optionally encage compounds. The invention shows that it is possible to produce particles by assembly of a single GFLV coat protein in such a way that (i) encapsidation of native viral RNA is avoided, (ii) at least one compound (e.g., a foreign protein or peptide) is surface exposed and (iii) optionally another compound (e.g., a foreign protein or peptide), which can be the same or different from the other compounds, is encaged/protected inside the particle. These conjugated proteins and VLPs may be used to expose and optionally encage any compound of interest and have utility in various fields such as the pharmaceutical, agrosciences, or veterinary areas.
[0056] An object of the invention thus resides in virus-like particles comprising, or consisting of, or obtainable from GFLV coat proteins and at least two different anti-GFLV coat protein antibodies or antibody derivatives.
[0057] A further object of the invention is a virus-like particle comprising or obtainable from GFLV coat proteins and at least two different anti-GFLV coat protein antibodies or antibody derivatives, said GFLV coat protein and/or anti-GFLV coat protein antibodies or antibody derivatives being conjugated to a compound. Conjugation may be covalent (e.g., through genetic or chemical coupling) and/or non-covalent (e.g., through ligand mediated binding).
VLPs
[0058] The term virus-like-particle or VLP more specifically designates a particle which is essentially made by self-assembly of coat proteins. VLPs are typically devoid of nucleic acids and not infectious. Preferred unmodified VLPs of the invention are icosahedral. Also, in unmodified form, they usually are small particles having a diameter below 50 nm, typically between 20-40 nm, more preferably between 25-35 nm, such as about 30 nm. The invention indeed shows that GFLV coat proteins lead to the production of particles that are small in size, preferably in the nanometer range, and simple in structure and likely non-toxic due to their exclusive protein composition (biomaterial). Such characteristics represent a further advantage of the invention. Of course, the size of the VLPs may be modified when compounds are conjugated to the coat protein and/or anti-GFLV coat protein antibodies or antibody derivatives, as disclosed in the present application.
[0059] In one embodiment, VLPs of the invention are essentially composed of or obtained from several copies of a same GFLV coat protein (homoVLPs), optionally a GFLV coat protein conjugated to a compound.
[0060] In another embodiment, VLPs of the invention are composed of, or comprise, or are obtained from a mixture of distinct GFLV coat proteins (heteroVLPs). Examples of such heteroVLPs include (i) VLPs comprising a mixture of a GFLV coat protein and fragments thereof, or (ii) VLPs comprising a mixture of a conjugated GFLV coat protein and a non-conjugated GFLV coat protein.
[0061] Optionally, VLPs of the invention are composed of, or comprise, or are obtained from a mixture of a GFLV coat protein conjugated to a first compound and a GFLV coat protein conjugated to a second compound (hybridVLPs). Optionally, a mixture of the same GFLV coat protein is used fused to a first and second compound, respectively. A particular hybridVLP comprises or is obtained from a mixture of a GFLV coat protein conjugated in C-ter to a first compound and a GFLV coat protein conjugated in N-ter to a second compound.
[0062] In a particular embodiment, a hybridVLP comprises the GFLV coat protein and at least one exposed compound at the surface of the particle by conjugation of the at least one compound to anti-GFLV coat protein antibodies or antibody derivatives.
[0063] In another particular embodiment, a hybridVLP comprises an encaged compound which is N-terminally conjugated to the GFLV coat protein and at least one exposed compound at the surface of the particle by conjugation of the at least one compound to anti-GFLV coat protein antibodies or antibody derivatives.
[0064] In heteroVLPs or hybridVLPs, the ratio between the various coat proteins may be varied and adjusted by the skilled artisan according to the needs and operating conditions, without affecting the assembly and/or integrity of the VLP.
[0065] VLPs of the invention may be prepared using a GFLV coat protein. In this regard, the term GFLV coat protein designates any coat or capsid protein or polypeptide derived from a GFLV, e.g. obtained from GFLV, or having the sequence of a coat protein of GFLV, or having a sequence designed from a sequence of a coat protein of GFLV. The term coat protein includes recombinant proteins, synthetic proteins, or purified proteins. The coat protein may be a polypeptide having an amino acid sequence identical to that of GFLV or may contain structural modifications such as mutations, deletions and/insertions of one or several amino acid residues, as long as the protein retains the ability to assemble into a particle.
[0066] The amino acid sequence of GFLV coat protein is provided as SEQ ID NO: 1.
[0067] In a particular embodiment, the GFLV coat protein is a polypeptide comprising all or part of SEQ ID NO: 1 and able to assemble into a VLP. Part of a sequence designates preferably a continuous portion of at least 80% of that sequence, more preferably of at least 85%, even more preferably at least 90%, 95%, or more.
[0068] Several strains of GFLV have been described in the art and are available, such as GFLV-F13 (Viry et al. 1993), or GFLV-GHu (Vigne et al., 2004). As a particular example, the invention uses a GFLV coat protein derived from any strain of GFLV such as F13.
[0069] In a most preferred embodiment, the GFLV coat protein for use in the invention is a polypeptide comprising all or part of the amino acid sequence of SEQ ID NO: 1, or a sequence having at least 90% identity to SEQ ID NO: 1. The term identity in relation to an amino acid sequence as used herein refers to the degree of correspondence between two amino-acid sequences (no gaps between the sequences). In other terms, it is the extent, expressed as a percentage, to which two amino acid sequences have the same amino acid at equivalent positions. The percentage identity between two amino acid sequences (A) and (B) is determined by comparing the two sequences aligned in an optimal manner, through a window of comparison. Said alignment of sequences can be carried out by well-known methods, for example, using the algorithm for global alignment of Needleman-Wunsch. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. Once the total alignment is obtained, the percentage of identity can be obtained by dividing the full number of identical amino acid residues aligned by the full number of residues contained in the longest sequence between the sequence (A) and (B). Sequence identity is typically determined using sequence analysis software. The % identity can be determined by known computer programs such as BLAST, FASTA, etc. For comparing two amino acid sequences, one can use also, for example, the tool Emboss needle for pairwise sequence alignment of proteins providing by EMBL-EBI and available on www.ebi.ac.uk/Tools/services/web/toolform.ebi?tool=emboss_needle&context=protein, using default settings: (I) Matrix: BLOSUM62, (ii) Gap open: 10, (iii) gap extend: 0.5, (iv) output format: pair, (v) end gap penalty: false, (vi) end gap open: 10, (vii) end gap extend: 0.5.
[0070] A particular example of a GFLV coat protein is a protein comprising or consisting of SEQ ID NO: 1. Another particular example of a GFLV coat protein is a protein comprising or consisting of amino acids 2-505 of SEQ ID NO: 1. Another particular example of a GFLV coat protein is a protein comprising or consisting of amino acids 1-504 or 2-504 of SEQ ID NO: 1. Another particular example of a GFLV coat protein is a protein comprising or consisting of amino acids 1-503 or 2-503 of SEQ ID NO: 1. Another example of a GFLV coat protein is a protein comprising or consisting of SEQ ID NO: 1 with 1 to 10 or 1 to 5 amino acid substitutions, additions or deletions, preferably substitutions. By substitution herein is meant the replacement of an amino acid at a particular position with another amino acid. By addition is meant the addition of an amino acid at a particular position in a polypeptide sequence. By deletion is meant the removal of an amino acid at a particular position in a polypeptide sequence.
[0071] The amino acid substitutions may be conservative. A conservative substitution is the replacement of a given amino acid residue by another residue having a side chain (R-group) with similar chemical properties (e.g., charge, bulk and/or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. Conservative substitutions and the corresponding rules are well-described in the state of the art. For instance, conservative substitutions can be defined by substitutions within the group of the amino acid which are known by the person skilled in the art such as acidic amino acid, basic amino acid, hydrophilic uncharged amino acid, aliphatic uncharged amino acid, non-polar uncharged amino acid and aromatic amino acid.
[0072] The proteins may be prepared by recombinant technology (i.e., expression in a cell or in vitro system), by synthesis, purification, or combinations thereof. In this regard, the proteins may be produced by expression in plant cells, in planta, in bacteria (e.g., in E. coli), or in other eukaryotic cells (e.g., in yeast, in insect cells, in CHO cells etc. . . . ). Alternatively, expression may be performed in in vitro systems. Also, the proteins may be modified to improve their stability. In particular, the coat proteins may contain one or more peptidomimetic bonds such as for instance intercalation of a methylene (CH.sub.2) or phosphate (PO.sub.2) group, secondary amine (NH) or oxygen (O), alpha-azapeptides, alpha-alkylpeptides, N-alkylpeptides, phosphonamidates, depsipeptides, hydroxymethylenes, hydroxyethylenes, dihydroxyethylenes, hydroxyethylamines, retro-inverso peptides, esters, phosphinates, phosphinics, phosphonamides and the like.
[0073] GFLV coat proteins may be used as such to produce VLPs of the invention. Also, as discussed previously, the invention shows that GFLV coat proteins may be conjugated to large compounds without losing their ability to assemble into VLPs. Moreover, the conjugation strategy allows control of exposure/encaging of a compound. Furthermore, very large compounds can be conjugated (e.g., which can represent at least 50% of the size of the coat protein itself) without affecting the ability of the protein to assemble into VLPs.
[0074] Conjugation may be covalent or not, direct or not (i.e., via a linker), and/or chemical, enzymatic or genetic. Furthermore, conjugation may involve terminal and/or lateral coupling. Also, a conjugated GFLV coat protein of the invention may comprise one or several conjugated compounds.
[0075] Conjugation can be carried out by any acceptable means of bonding taking into account the chemical nature and obstruction of the GFLV coat protein and compound. In this regards, coupling can thus be performed by one or more covalent, ionic, hydrogen, hydrophobic or Van der Waals bonds, cleavable or non-cleavable in physiological medium or within cells.
[0076] Furthermore, while coupling can be performed at any reactive groups of the GFLV coat protein, accessibility of the reactive group in a subsequent VLP should be considered. In this regard, the inventors have found that coupling at the N-term and/or C-term ends of the GFLV coat protein does not affect the ability of the coat protein to form a particle. Such terminal coupling is thus most preferred for the present invention. In addition, the inventors have surprisingly found that the fusion of a compound at the C-terminus of a GFLV coat protein results in the exposure of the compound on the surface of particles prepared with the conjugate, whereas a compound fused to the N-terminal leads to its internalization into the VLPs, making the compound inaccessible to antibodies (caging). It is therefore possible to adjust the coupling strategy to the type of compound, and also to produce VLPs having two distinct properties: the surface exposure and the protection by internalization (caging) of compounds of interest.
[0077] In a first preferred embodiment, conjugation is obtained by covalent coupling to the GFLV coat protein, typically by genetic fusion (i.e., by expression in a suitable system of a nucleic acid construct encoding the GFLV coat protein and the compound as a genetic fusion), optionally at the N-ter and/or C-ter of the coat protein, preferably at the N-terminal end.
[0078] In a particular embodiment, the invention relates to a GFLV coat protein conjugated at its N-terminal end to a compound (i.e., TagRFP). A typical structure of such conjugates is Compound-(Linker).sub.n-Coat protein with n=0 or 1. Conjugation at the N-ter end more preferably comprises conjugation at the first N-ter amino acid of the coat protein. The present invention does indeed show that conjugation at amino acid Meti of SEQ ID NO: 1 or at amino acid Gly.sub.1 of a GFLV coat protein comprising amino acids 2-505 of SEQ ID NO: 1 or a variant thereof can generate molecules that can form VLPs and that encage the conjugated compound inside of the VLP.
[0079] In another particular embodiment, the invention relates to a GFLV coat protein conjugated at its C-terminal end to a compound (i.e., Fluorescent proteins). A typical structure of such conjugates is Coat protein-(Linker).sub.n-Compound with n=0 or 1. Conjugation at the C-ter end more preferably comprises conjugation at anyone of the last three C-ter amino acids of the protein. The present invention does indeed show that conjugation at amino acid Phe.sub.503, Pro.sub.504 or Val.sub.505 of SEQ ID NO: 1 or a variant thereof can generate molecules that can form VLPs and that expose the conjugated compound outside of the VLP. More preferably, C-ter conjugation involves conjugation to the last C-ter amino acid residue of the coat protein.
[0080] The compound may be coupled directly to the GFLV coat protein, or indirectly by means of a linker. Means of covalent chemical coupling, include e.g., the use of bi- or multifunctional agents containing e.g., alkyl, aryl, peptide or carboxyl groups. Examples of linkers include any neutral amino acid or peptide sequence, such as for instance G.sub.3S, G.sub.3SG.sub.3, or DPAFLYKVVRSFGPA (SEQ ID NO: 6).
[0081] In a preferred embodiment, the compound is covalently linked to the GFLV coat protein, directly or via a linker.
[0082] In a further preferred embodiment, the compound and coat protein are linked by a peptide bond, either directly or via a linker.
Anti-GFLV Coat Protein Antibodies or Antibody Derivatives
[0083] The present invention relates to a VLP comprising a GFLV coat protein and at least two or three different anti-GFLV coat protein antibodies or antibody derivatives.
[0084] The present invention shows that VLPs derived from GFLV coat proteins can be simultaneously conjugated to at least two or three different types of anti-GFLV coat protein antibodies or antibody derivatives, said antibodies or antibody derivatives optionally being conjugated to proteins. For instance, the VLPs can be conjugated to up to 60 anti-GFLV coat protein antibodies or antibody derivatives by particle for each type of antibodies or antibody derivatives. According, with three different anti-GFLV coat protein antibodies, the VLP can bear up to 180 antibodies per VLP.
[0085] Preferably, the different anti-GFLV coat protein antibodies or antibody derivatives do not compete with each other for the binding to the GFLV coat protein. The present invention shows that a combination of at two or three different anti-GFLV coat protein antibodies or antibody derivatives can be used simultaneously. Accordingly, the VLP may comprise 1-60 copies of a first anti-GFLV coat protein antibodies or antibody derivatives, 1-60 copies of a second anti-GFLV coat protein antibodies or antibody derivatives and optionally 1-60 copies of a third anti-GFLV coat protein antibodies or antibody derivatives. Optionally, a fourth anti-GFLV coat protein antibodies or antibody derivatives can also be used simultaneously.
[0086] Preferably, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives do not compete with each other for the binding to the GFLV coat protein. In other words, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives bind epitopes of GFLV coat protein which are far enough for allowing the simultaneous binding of said two or three different anti-GFLV coat protein antibodies or antibody derivatives of the GFLV coat protein VLP.
[0087] By compete is intended to refer to an antibody or a derivative thereof which binds the same epitope or which overlaps the epitope of a first antibody or a derivative thereof, it is able to reduce by at least 20% binding of a first antibody or a derivative thereof to GFLV coat protein, when incubated at approximately similar concentrations. When an antibody or a derivative thereof is said to compete with a particular antibody, it means that the antibody or a derivative thereof competes with the particular antibody in a binding assay using either recombinant GFLV coat proteins or a GFLV VLP. It means that for an antibody (A) binding a recombinant GFLV coat proteins or a GFLV VLP the competition exists when an antibody (B) loses binding capacity of at least 20% to the recombinant GFLV coat proteins or the GFLV VLP due to the binding of antibody (A) one the same epitope (E1) or due to the fixation of antibody (A) overlapping the epitope (E2) of antibody (B) on the recombinant GFLV coat proteins or the GFLV VLP. Antibody or a derivative thereof may be tested for their ability to bind GFLV coat protein and a variant thereof or to compete with any particular antibodies or derivatives thereof as described in the examples or in WO2015/110601. In particular, the capacity to compete can be measured by a competitive ELISA.
[0088] Examples of anti-GFLV coat protein antibodies, or derivatives thereof retaining antigen specificity include, without limitation, monoclonal antibodies, nanobodies (e.g., derived from the structure of single chain only immunoglobulins found in camelids), single chain antibodies (i.e., ScFv or V.sub.NAR fragments), diabodies, etc.
[0089] The term nanobody (or VHH, Hamers-Casterman et al., 1993) designates a single chain polypeptide consisting essentially of three CDRs (complementarity-determining regions CDR1, CDR2 and CDR3) separated by four FR domains (for Framework regions) and essentially devoid of a light chain or a constant domain. The terms nanobodies, nanobody, VHH, VHH antibody fragment or single-domain antibody are used interchangeably. Nanobodies typically have the following structure: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. Preferably, the nanobodies of the invention are synthetic molecules produced by recombinant or chemical technologies. The CDRs of a given nanobody can be determined by any method available to those skilled in the art. For example, and in a non-limiting manner, the Chothia or the Kabat method can be used to determine the CDRs (Chothia et al., Nature 342, 877-883; Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda). Alternative method of determining CDRs can also be used such as the intermediate method between Chothia and Kabat called AbM (Oxford Molecular AbM antibody modelling software) or the so-called Contact method based on an analysis of available complex structures (Saerens et al, Mol Biol. 2005).
[0090] Nanobodies present high epitope specificity and affinity, usually in the nanomolar range. They are about ten times smaller than conventional IgG molecules. They are single-chain polypeptides, very stable, resisting extreme pH and temperature conditions. Moreover, they can resist to the action of proteases.
[0091] The present invention more particularly discloses particular nanobodies directed against the GFLV coat protein. These specific nanobodies have a very strong affinity for GFLV, in the nanomolar range.
[0092] The affinity of an antibody for GFLV may be determined by well-known methods described in the prior art. For instance, the Kd of an antibody can be determined by surface plasmon resonance assay in which the antibody is immobilized on the biosensor chip and the solubilized GFLV particle or GFLV coat protein is passed over the immobilized antibody under flow conditions leading to the measurements of k.sub.on and k.sub.off and thus Kd. Alternatively, GFLV particles or GFLV coat protein may be immobilized on the biosensor chip and the antibody of interest is passed over said immobilized GFLV VLPs or GFLV coat protein. As another alternative, the Kd of the antibody can be determined by Time Resolved-Fluorescence Energy Transfer analysis. In TR-FRET assays, ligands are usually coupled to conventional fluorescein-like or dy647-like fluorophores (acceptor species), whereas receptors are labelled with lanthanide cryptates (donor species). The FRET signal between the donor and the acceptor (for instance between terbium and d2) can be measured. This signal occurs when the antibody binds to the GFLV particle or GFLV coat protein only. The FRET signal can be plotted against antibody concentrations so as to obtain a dose-response curve from which the binding affinity of antibody for GFLV particle or GFLV coat protein can be determined.
[0093] The Kd of the nanobodies can be also determined by microscale thermophoresis. Microscale thermophoresis (MST) is a technology for the interaction analysis of biomolecules. Microscale thermophoresis is based on the detection of the movement of particles in a microscopic temperature gradient. Any change of the hydration shell of biomolecules due to changes in their structure/conformation results in a relative change in the movement along the temperature gradient and can be used to determine binding affinities. MST allows measurement of interactions directly in solution without the need of immobilization to a surface (immobilization-free technology). For determining Kd of a given anti-GFLV nanobody, purified TRCP VLPs in solubilized form are prepared and incubated with decreasing concentrations of nanobodies. After incubation, the samples are loaded in thin capillaries, a microscopic temperature gradient is induced by infrared laser and the directed movement of the solubilized TRCP VLP is detected and quantified. This thermophoresis signal is plotted against the antibody concentration so as to obtain a dose-response curve from which the binding affinity of nanobody for TRCP VLP can be deduced.
[0094] Preferably, the Kd of a nanobody for GFLV VLP is determined by microscale thermophoresis. Preferably, the at least two antibodies according to the invention have a Kd of at least 45 nM, preferably at least 40 nM, even more preferably at least 35 nM.
[0095] Accordingly, one of the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives can selected from the group consisting of nanobodies Nb23, Nb101, Nb126, Nbp71, Nbp75, Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, Nbp12 and anti-GFLV coat protein antibodies or antibody derivatives comprising the sequences of a set of CDR 1, CDR 2 and CDR 3 from one of these nanobodies. For the sake of clarity, an anti-GFLV coat protein antibody or antibody derivative comprising the sequences of a set of CDR 1, CDR 2 and CDR 3 from one of these nanobodies refers to an antibody or antibody derivative with comprises the sequences of CDR1, CDR2 and CDR3 of this particular nanobody.
[0096] Optionally, two or three of the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives can selected from the group consisting of nanobodies Nb23, Nb101, Nb126, Nbp71, Nbp75, Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, Nbp12 and anti-GFLV coat protein antibodies or antibody derivatives comprising the sequences of a set of CDR 1, CDR 2 and CDR 3 from one of these nanobodies.
[0097] The amino acid sequences of Nb23, Nb101, Nb126, Nbp71, Nbp75, Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139 and Nbp12 are disclosed in SEQ ID NOs: 9 to 29 and their CDRs sequences determined by Kabat method are disclosed in SEQ ID NOs: 34 to 102 and summarized in the following Table. Of course, based on the sequence of the nanobodies, the CDR may also be determined by another method such as IMGT.
TABLE-US-00003 CDR1 CDR2 CDR3 Nanobody SEQ SEQ SEQ SEQ (Nb) ID NO: ID NO: ID NO: ID NO: 23 9 34 35 36 p75 10 37 38 39 101 8 40 41 42 126 7 43 44 45 p71 11 46 47 48 p59 12 49 50 51 125 13 52 53 54 155 14 55 56 57 37 15 58 59 60 77 16 61 62 63 171 17 64 65 66 159 18 67 68 69 p25 19 70 71 72 172 20 73 74 75 122 21 76 77 78 15 22 79 80 81 p77 23 82 83 84 34 24 85 86 87 80 25 88 89 90 38 26 91 92 93 137 27 94 95 96 139 28 97 98 99 p12 29 100 101 102
[0098] Based on the similarity of CDR1, CDR2 and CDR3, but mainly of CDR3, the nanobodies can be arranged by families, the nanobodies of a family being capable to bind the same epitope.
[0099] In addition, based on competitive ELISA assay and modelisation studies, the capacity of nanobodies to compete with each other and the epitope can be determined. The nanobodies have been arranged in groups. Nanobodies belonging to two different groups should not compete with each other for the binding to GFLV coat protein or to a GFLV coat protein VLP.
TABLE-US-00004 Epitope Nanobody AA numbering of the CP (Nb) Family Group as shown in SEQ ID NO: 1 23 1 I loop region 213-217 (C) of domain B of the CP in p75 particular Thr213, Lys215, and Tyr217; -sheet 101 region 371-392 of the A domain of the CP in 126 particular Asp 372 Asn376, Val380, Ser381, Met382 p71 and also residues Tyr217, Phe371 Ala388, Ala389, Ala392, Phe503 and Val505. p59 2 II Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, 37 Ser84, Asp86, Tyr89, Gly138, 77 ProProIlePhePheAspLeuThrAlaValThrAlaLeuArgSerAla 171 186 to 201 MetValGlyThrThr 210 To 214 His239, Arg302, ThrAlaGluLeuProIleVal 322 to 328 125 3 II 159 p25 15 4 IV p77 34 5 V 80 155 6 II Ala83 172 38 7 VI 122 8 III Ser225, Leu228, Tyr288, Arg290, Pro292Ala293Arg294, Leu296Ala297Gly298, SerLeuProSerPheGlu 340 to 345 AspTyrPheVal 347 to 350 Glu384Asn385Pro386, Lys404, Arg486, Leu488 137 9 VII 139 10 VIII p12 11 IX
[0100] In a preferred embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group I. The group I comprises the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1. In a particular embodiment, the group I comprises the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nb23, Nb101, Nb126, Nbp71 and Nbp75, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1.
[0101] In a preferred embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group I consisting of the nanobodies Nb23 and Nbp75; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the nanobody Nb23 or Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or Nbp75 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 or Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with the nanobody Nb23 or Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23 or Nbp75, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobodies Nb23 and Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or Nbp75; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 or Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with the nanobody Nb23 or Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23 or Nbp75, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1.
[0102] In a very specific embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group I consisting of the nanobody Nb23; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb23; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb23 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nb23; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb23 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23, in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1.
[0103] In a preferred embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group II. The group II comprises the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1.
[0104] In a particular embodiment, the group II comprises the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nbp59, Nb125, Nb155, Nb37, Nb77, Nb171, Nb159, Nbp25 and Nb172, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1.
[0105] In a preferred embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group II consisting of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nbp59, Nb125, and Nb155 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, and Nb155 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nbp59, Nb125, and Nb155 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nbp59, Nb125, and Nb155, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobodies the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, and Nb155 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nbp59, Nb125, and Nb155 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nbp59, Nb125, and Nb155, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1.
[0106] In a very specific embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group II consisting of the nanobody Nbp59; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nbp59; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nbp59 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nbp59 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nbp59 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nbp59, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nbp59; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nbp59; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nbp59 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nbp59 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nbp59, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1.
[0107] In a preferred embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group III. The group III comprises the nanobody Nb122; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb122; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb122 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb122 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb122 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb122, especially an epitope comprising one or several amino acids selected from the group consisting of Ser225, Leu228, Tyr288, Arg290, Pro292, Ala293, Arg294, Leu296, Ala297, Gly298, residues from Ser340 to Glu345, residues from Asp347 to Val350, Glu384, Asn385, Pro386, Lys404, Arg486, and Leu488 as shown in SEQ ID NO: 1. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nb122; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb122; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb122 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR11 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb122 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb122, especially an epitope comprising one or several amino acids selected from the group consisting of Ser225, Leu228, Tyr288, Arg290, Pro292, Ala293, Arg294, Leu296, Ala297, Gly298, residues from Ser340 to Glu345, residues from Asp347 to Val350, Glu384, Asn385, Pro386, Lys404, Arg486, and Leu488 as shown in SEQ ID NO: 1.
[0108] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group IV. The group IV comprises the nanobodies Nb15 and Nbp77; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nb15 and Nbp77; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nb15 and Nbp77 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb15 and Nbp77 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nb15 and Nbp77 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nb15 and Nbp77. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobodies the nanobodies Nb15 and Nbp77; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nb15 and Nbp77; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb15 and Nbp77 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nb15 and Nbp77 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nb15 and Nbp77.
[0109] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group V. The group V comprises the nanobodies Nb34 and Nb80; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nb34 and Nb80; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nb34 and Nb80 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb34 and Nb80 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nb34 and Nb80 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nb34 and Nb80. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobodies the nanobodies Nb34 and Nb80; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nb34 and Nb80; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb34 and Nb80 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nb34 and Nb80 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nb34 and Nb80.
[0110] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group VI. The group VI comprises the nanobody Nb38; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb38; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb38 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb38 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb38 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb38. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nb38; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb38; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb38 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR11 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb38 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb38.
[0111] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group VII. The group VII comprises the nanobody Nb137; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb137; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb137 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb137 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb137 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb137. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nb137; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb137; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb137 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR11 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb137 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb137.
[0112] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group VIII. The group VIII comprises the nanobody Nb139; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb139; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb139 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb139 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb139 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb139. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nb139; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb139; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb139 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb139 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb139.
[0113] In one embodiment, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected in the Group IX. The group IX comprises the nanobody Nbp12; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nbp12; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nbp12 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nbp12 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nbp12 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nbp12. Optionally, one of the anti-GFLV coat protein antibodies or antibody derivatives is selected from the group consisting of the nanobody Nbp12; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nbp12; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nbp12 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nbp12 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nbp12.
[0114] Preferably, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives are each selected in a different group among groups I to IX, preferably among Groups I, II and III.
[0115] In a preferred embodiment, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives comprises one anti-GFLV coat protein antibody or antibody derivative selected in the group I and one anti-GFLV coat protein antibody or antibody derivative selected in the group II; or one anti-GFLV coat protein antibody or antibody derivative selected in the group I and one anti-GFLV coat protein antibody or antibody derivative selected in the group III; or one anti-GFLV coat protein antibody or antibody derivative selected in the group II and one anti-GFLV coat protein antibody or antibody derivative selected in the group III; or one anti-GFLV coat protein antibody or antibody derivative selected in the group I, one anti-GFLV coat protein antibody or antibody derivative selected in the group II; and one anti-GFLV coat protein antibody or antibody derivative selected in the group III. Of course, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives may comprise additional anti-GFLV coat protein antibodies or antibody derivatives.
[0116] In a preferred embodiment, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives comprises: [0117] one anti-GFLV coat protein antibody or antibody derivative selected in the group I consisting of the nanobodies Nb23 and Nbp75; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the nanobody Nb23 or Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or Nbp75 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 or Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with the nanobody Nb23 or Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23 or Nbp75 in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1; and one anti-GFLV coat protein antibody or antibody derivative selected in the group II consisting of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nbp59, Nb125, and Nb155 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, and Nb155 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nbp59, Nb125, and Nb155 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nbp59, Nb125, and Nb155, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1; or [0118] one anti-GFLV coat protein antibody or antibody derivative selected in the group I consisting of the nanobodies Nb23 and Nbp75; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the nanobody Nb23 or Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or Nbp75 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 or Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with the nanobody Nb23 or Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23 or Nbp75 in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1; and one anti-GFLV coat protein antibody or antibody derivative selected in the group III consisting of the nanobody Nb122; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb122; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb122 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb122 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb122 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb122, especially an epitope comprising one or several amino acids selected from the group consisting of Ser225, Leu228, Tyr288, Arg290, Pro292, Ala293, Arg294, Leu296, Ala297, Gly298, residues from Ser340 to Glu345, residues from Asp347 to Val350, Glu384, Asn385, Pro386, Lys404, Arg486, and Leu488 as shown in SEQ ID NO: 1; or [0119] one anti-GFLV coat protein antibody or antibody derivative selected in the group II consisting of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nbp59, Nb125, and Nb155 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, and Nb155 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nbp59, Nb125, and Nb155 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nbp59, Nb125, and Nb155, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1; and one anti-GFLV coat protein antibody or antibody derivative selected in the group III consisting of the nanobody Nb122; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb122; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb122 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb122 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb122 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb12, especially an epitope comprising one or several amino acids selected from the group consisting of Ser225, Leu228, Tyr288, Arg290, Pro292, Ala293, Arg294, Leu296, Ala297, Gly298, residues from Ser340 to Glu345, residues from Asp347 to Val350, Glu384, Asn385, Pro386, Lys404, Arg486, and Leu488 as shown in SEQ ID NO: 1; or [0120] one anti-GFLV coat protein antibody or antibody derivative selected in the group I consisting of the nanobodies Nb23 and Nbp75; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the nanobody Nb23 or Nbp75; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb23 or Nbp75 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb23 or Nbp75 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with the nanobody Nb23 or Nbp75 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb23 or Nbp75 in particular an epitope comprising or consisting of an epitope comprising one or several amino acids selected among the group consisting of Thr213, Lys215, Tyr217, Phe371, Asp372 Asn376, Val380, Ser381, Met382, Ala388, Ala389, Ala392, Phe503 and Val505 as shown in SEQ ID NO: 1; one anti-GFLV coat protein antibody or antibody derivative selected in the group II consisting of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one of the nanobodies Nbp59, Nb125, and Nb155; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one of the nanobodies Nbp59, Nb125, and Nb155 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nbp59, Nb125, and Nb155 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with one of the nanobodies Nbp59, Nb125, and Nb155 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of one of the nanobodies Nbp59, Nb125, and Nb155, especially an epitope comprising one or several amino acids selected from the group consisting of Gln16, Ala17, Asn18, Ser79, Arg80, Thr82, Ala83, Ser84, Asp86, Tyr89, Gly138, residues from Pro186 to Ala201, residues from Met210 to Thr214, His239, Arg302 and residues from Thr322 to Val328 as shown in SEQ ID NO: 1; and one anti-GFLV coat protein antibody or antibody derivative selected in the group III consisting of the nanobody Nb122; the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with Nb122; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of the nanobody Nb122 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of the nanobody Nb122 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with the CDR1 and CDR2; the antibodies or antibody derivatives competing with the nanobody Nb122 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of the nanobody Nb12, especially an epitope comprising one or several amino acids selected from the group consisting of Ser225, Leu228, Tyr288, Arg290, Pro292, Ala293, Arg294, Leu296, Ala297, Gly298, residues from Ser340 to Glu345, residues from Asp347 to Val350, Glu384, Asn385, Pro386, Lys404, Arg486, and Leu488 as shown in SEQ ID NO: 1.
[0121] Of course, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives may comprise additional anti-GFLV coat protein antibodies or antibody derivatives.
[0122] In a particular embodiment, when the GFLV coat protein is fused in C-terminal, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives are each selected in a different group among groups II to IX, preferably among Groups II and III. Preferably, the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives comprises one anti-GFLV coat protein antibody or antibody derivative selected in the group II, in particular as defined above, and one anti-GFLV coat protein antibody or antibody derivative selected in the group III, in particular as defined above.
[0123] Nanobodies typically comprise four framework regions FR1, FR2, FR3, and FR4, which may be selected e.g., from conventional FR regions of VHH polypeptides. The FR regions may, more preferably, be selected from FR1-FR4 domains having a sequence as defined below:
TABLE-US-00005 FR1: (SEQIDNO:103) Gln-Val-Gln-Leu-Gln-Glu-Ser-Gly-Gly-Gly-X.sub.1-Val- Gln-X.sub.2-Gly-Gly-Ser-Leu-X.sub.3-X.sub.4-X.sub.5-Cys-X.sub.6-Ala-Ser-X.sub.7- X.sub.8-X.sub.9-X.sub.10-X.sub.11
wherein: [0124] X.sub.1 is a serine or an alanine residue; [0125] X.sub.2 is a valine, a proline or an alanine residue; [0126] X.sub.3 is an arginine or a lysine residue; [0127] X.sub.4 is a valine or a leucine residue [0128] X.sub.5 is an alanine or a serine residue; [0129] X.sub.6 is an alanine, a glutamate or a valine residue; [0130] X.sub.7 is a glycine, a glutamate or a threonine; [0131] X.sub.8 is an aspartate, a tyrosine, a leucine or an isoleucine; [0132] X.sub.9 is a threonine, a valine, a proline, an arginine or an isoleucine; [0133] X.sub.10 is a phenylalanine, a proline, a serine, a tyrosine, a leucine, a histidine, an alanine or a threonine; and [0134] X.sub.11 is a serine, a glutamate, an asparagine, or an arginine.
TABLE-US-00006 FR2: (SEQIDNO:104) Trp-Phe-Arg-Gln-Ala-Pro-Gly-Lys-X.sub.1-Arg-Glu-Gly- Val-Ala
wherein: [0135] X.sub.1 is a glycine or a glutamate residue;
TABLE-US-00007 FR3: (SEQIDNO:105) Arg-Phe-Thr-Ile-Ser-Lys-Asp-Asn-Ala-Asp-Asn-X.sub.1- Met-Tyr-Leu-Glu-Met-Asn-X.sub.2-Leu-Lys-Pro-Glu-Asp- Thr-Ala-Ile-Tyr-Tyr-Cys-Ala-Ala
wherein: [0136] X.sub.1 is a isoleucine or a methionine residue; and [0137] X.sub.2 is a serine or a glycine residue; and/or
TABLE-US-00008 FR4: (SEQIDNO:106) Trp-Gly-Gln-Gly-Thr-Gln-Val-Thr-Val-Ser-Ser.
[0138] As an alternative, the one skilled in the art may graft the CDRs within a universal scaffold of VHH described in the state in the art (Saerens et al., J. Mol. Biol. (2005) 352, 597-607), so as to obtain the desired nanobody against GFLV. The nanobody of the invention may be a VHH comprising a universal framework scaffold, for instance as shown in Saerens et al. and comprising at least one CDR, preferably three CDRs, having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1, CDR2 and/or CDR3 from a nanobody selected from the group I, II, III, IV, V, VI, VII, VIII and IX.
[0139] An object of the invention thus relates to a nanobody selected from the groups II to XI as defined above, in particular from the groups II and III as defined above. In particular, the nanobody is selected from the group consisting of the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12, the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12. The present invention also relates to a VLP comprising GFLV coat proteins and a nanobody selected from the groups II to XI as defined above, in particular from the groups II and III as defined above.
[0140] An object of the invention thus relates to a combination of at least two nanobodies which are each selected in a different group among groups I to IX as defined above, preferably among Groups I, II and III as defined above.
[0141] Nanobodies can be prepared by standard production, isolation and purification methods or by recombinant or synthesis technology. For example, anti-GFLV nanobodies can be generated e.g. by immunization of a camelid animal with purified GFLV particles or from nave synthetic libraries and selected by methods known by the person skilled in the art, such as phage display. Camelids encompass dromedary, camel llama and alpaca. For instance, in order to generate a library of VHHs displayed on bacteriophages, the skilled artisan can refer to Muydermans et al., Molecular Biotechnology, 2001, 74, 277-302, in particular to the section entitled Recombinant VHH, the disclosure of which being incorporated therein by reference. Alternatively, nanobody can derived from a cartilaginous fish such as nurse shark (Ginglymostoma cirratum) and wobbegong shark (Orectolobus maculates). The skilled artisan may refer to Dooley et al. Mol Immunol, 2003, 40:25-30 which describes the selection and characterization of naturally occurring single-domain (IgNAR) antibody fragments from immunized sharks by phage display.
[0142] The DNA molecule encoding said nanobodies can be determined or isolated or cloned by methods well-known in the art. Nanobodies having specific sequences as defined above can be produced by artificial synthesis or recombinant DNA technology. Nanobodies may then be tested for their ability to bind GFLV and variant thereof or to compete with any particular nanobodies as described in the examples.
[0143] The invention also relates to a nucleic acid molecule comprising a nucleotide sequence encoding a nanobody, antibody or antibody derivative as defined above. The nucleic acid may be DNA or RNA, single- or double-stranded. The nucleic acid may further comprise regulatory domains (e.g., a promoter or terminator sequence). The nucleic acid may be cloned in suitable cloning or expression vectors, such as plasmids, viruses, cosmids, phages, etc. The present invention further relates to a nucleic acid encoding a nanobody as defined above and any expression vector or cell host suitable for producing the nanobody.
[0144] The compound may be linked to the anti-GFLV coat protein antibodies or antibody derivatives through known techniques such as genetic fusion, chemical coupling, affinity binding via affinity tags (such as Strep tag or PolyHis Tag), for instance, that cause covalent or non-covalent coupling. A preferred way is by genetic fusion or chemical coupling, most preferably by genetic fusion when the compound is a polypeptide. In a particular embodiment, the compound is coupled to the ligand at an end of the ligand, most preferably covalently, such as by genetic fusion or chemical coupling. Such coupling does not substantially affect or prevent binding of the anti-GFLV coat protein antibodies or antibody derivatives to the virus coat protein or particle.
[0145] In a particular embodiment, the compound fused to an antibody is a protein. Noteworthy, the advantage of producing antibodies conjugated or fused to a compound compared GFLV coat protein fused to a compound in C-ter for the expression of the compound at the external surface of the viral capsid is that the production pathway may differ for these two types of constructions. Indeed, the compound fused to GFLV coat protein would be produced and assemble in the cytoplasm of production cells, where post-translational modifications such as N-glycosylation will not occur. On the contrary, compound fused to antibody may go through endoplasmic reticulum and N-glycosylation.
[0146] Also, compared to the conjugation of a compound to the GFLV coat protein, the use of antibodies allows to increase the display number of compounds at the outer surface of the VLP. Indeed, compound conjugated to GFLV coat protein enables the display of 60 compounds (as the GFLV capsid is made of 60 coat protein subunits) whereas the use of two non-competitive antibodies enables the display of up to 120 compounds and the use of three non-competitive antibodies enables the display of up to 180 compounds at the outer surface of GFLV VLPs.
[0147] Antibodies may recognize epitopes that are present on each coat protein subunit that forms the VLP but also may recognize epitopes formed by the association of coat proteins to form the viral capsid. It is known that icosahedral capsid may present epitopes formed from one coat protein subunit or from the association of two, three or five coat proteins, leading to symmetry axis of order 1, 2, 3 and 5. For a capsid formed by 60 subunits of coat protein such as GFLV which has a pseudo T=3 icosahedral capsid, epitopes defined by symmetry axis of order 1 will be present 60 times on the surface of the viral capsid (i.e. one antibody per coat protein subunit), epitopes defined by symmetry axis of order 2 will be present 30 times (i.e. one antibody at the junction of two coat protein subunits), epitopes defined by symmetry axis of order 3 will be present 20 times (i.e. one antibody at the junction of three coat protein subunits) and epitopes defined by symmetry axis of order 5 will be present 12 times (i.e. one antibody at the junction of five coat protein subunits, e.g. on the top of pentamer forming the vertices of the icosahedra). This characteristic is of great importance for antigen presentation and vaccination purposes, as it is known that the increase of antigen content and presentation increase the probability of an immune response. Accordingly, the at least two antibodies of the invention are non-competitive antibodies that each binds epitopes that are defined by one coat protein subunit, i.e. present 60 times on the GFLV VLP, meaning that the at least two non-competitive antibodies bind at least 120 epitopes on the outer surface of the VLP.
[0148] In a preferred embodiment, the invention thus relates to GFLV virus-like particles comprising or obtainable from GFLV coat proteins, wherein said particles comprise at least one compound of interest conjugated to the coat protein by attachment mediated by the at least two or three anti-GFLV coat protein antibodies or antibody derivatives. Such compound is exposed at the surface of the particles. The particle may have several distinct compounds exposed on its surface through conjugation with the same or distinct anti-GFLV coat protein antibodies or antibody derivatives. In a preferred embodiment, conjugation is performed using anti-GFLV coat protein antibodies or antibody derivatives, coupled to the compound, even more preferably using a nanobody.
[0149] In another preferred embodiment, the invention relates to GFLV virus-like particles comprising or obtainable from GFLV coat proteins, wherein said particles comprise an encaged compound conjugated to the N-ter of the coat protein, and an exposed compound, conjugated to the surface of the particle by attachment mediated by anti-GFLV coat protein antibodies or antibody derivatives, more preferably by at least two or three different anti-GFLV coat protein antibodies or antibody derivatives, even more preferably by at least two or three different anti-GFLV coat protein nanobodies. Preferably, said least two or three different anti-GFLV coat protein antibodies or antibody derivatives, preferably nanobodies, do not compete with each other for the binding to the GFLV coat protein.
[0150] In one embodiment, the invention relates to a VLP comprising a GFLV coat protein and at least two different anti-GFLV coat protein antibodies or antibody derivatives, said antibodies or antibody derivatives being conjugated, preferably covalently conjugated, to compounds, preferably different compounds. In particular, the VLP may comprise a first anti-GFLV coat protein antibody or antibody derivative conjugated to a first compound, a second anti-GFLV coat protein antibody or antibody derivative conjugated to a second compound, and optionally a third anti-GFLV coat protein antibody or antibody derivative conjugated to a third compound. Optionally, the VLP may comprise a GFLV coat protein fused to another compound at the N-terminal end.
[0151] An object of the invention thus relates to a compound covalently conjugated to a nanobody selected from the groups II to XI as defined above, in particular from the groups II and III as defined above. In particular, the nanobody is selected from the group consisting of the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12, the antibodies or derivatives having a sequence comprising a sequence having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12; the antibodies or derivatives having a sequence comprising the sequences of a set of CDR1, CDR2 and CDR3 of one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 or sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity therewith; the antibodies or derivatives having a sequence of CDR3 of one nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 and sequences having at least 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity with CDR1 and CDR2 of the same nanobody; the antibodies or antibody derivatives competing with a nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12 for the binding to GFLV coat protein; and the antibodies or antibody derivatives having the same epitope of a nanobody among the nanobodies Nb37, Nb77, Nb77, Nb171, Nbp59, Nb125, Nb159, Nbp25, Nb15, Nbp77, Nb34, Nb80, Nb155, Nb172, Nb38, Nb122, Nb137, Nb139, and Nbp12.
[0152] An object of the invention thus relates to a combination or composition comprising at least two nanobodies covalently conjugated to a compound which can be the same or different for each nanobody and which are each selected in a different group among groups I to IX as defined above, preferably among Groups I, II and III as defined above.
[0153] Another object of the invention relates to a combination or composition comprising at least two or at least three nanobodies conjugated, preferably covalently conjugated, to a compound which can be the same or different for each nanobody, each nanobody being selected in a different group among groups I to IX as defined above, preferably among Groups I, II and III.
[0154] The inventors surprisingly observed that some antibodies are capable of increasing the stability of the GFLV capsid. In particular, the nanobody Nb23 is capable of dramatically increasing the stability of the GFLV capsid. By stabilization it is meant that the capsid shape and function is more strongly conserved or that the disruption of the viral capsid needs more stringent conditions to occur in the presence of the antibodies bound on the outer surface of the VLP compared to the VLP without antibodies. For example, stability of the GFLV capsid can be assessed by measuring the effect of temperature on GFLV capsid without any antibody compared to GFLV capsid bound to antibodies. Such effect can be measured by Thermal shift assay that quantifies the change in thermal denaturation temperature of a protein under varying conditions, as described in the examples below. By increase is meant that the temperature at which 50% of the maximal fluorescent signal is reached is increased by at least 2 C., preferably at least 3 C., more preferably at least 5 C., even more preferably 10 C. The Thermal shift assay is detailed in the example section.
[0155] Accordingly, at least one of the at least two or at least three nanobody selected in the group I, II and III stabilizes the GFLV capsid. Even more preferably, one of the at least two or at least three nanobody is a nanobody from the group I that stabilizes the GFLV capsid. Particularly, one of the at least two or at least three nanobody is the nanobody Nb23.
[0156] Particularly, the invention relates to a combination or composition comprising at least two or three nanobodies covalently conjugated to a compound which can be the same or different for each nanobody and which are each selected in a different group among groups I to IX as defined above, preferably among Groups I, II and III as defined above, where the nanobodies chosen do not compete which each other and/or each of the at least two or three nanobodies recognized an epitope present 60 times on the outer surface of the viral particle, and/or at least one of the at least two or three nanobody stabilizes the GFLV capsid.
[0157] According to a further alternative embodiment, chemical conjugation to VLPs can be contemplated, such as conjugation through an exposed sulfhydryl group (Cys), attachment of an affinity tag (i.e. 6 Histidine, Flag Tag, Strep Tag, SpyCatcher etc.) to the particles for subsequent binding of compounds, or incorporation of unnatural amino acids into the VLP and compound for click chemistry conjugation.
Compounds
[0158] The compound for use in a conjugate or VLP of the invention may be any compound of interest, such as a therapeutic, diagnostic, targeting or imaging agent. The compound may also be a tag, allowing subsequent attachment of any agent of interest by exposing the conjugated coat protein or VLP to said agent under suitable conditions.
[0159] In a particular embodiment, the compound is a chemical entity of biological interest such as a small chemical molecule (e.g., antibiotic, antiviral, immunomodulator, antineoplastic, etc.), a peptide or polypeptide (such as a cytokine, a hormone, a toxin, an antigen), a protein (such as an enzyme, an antibody (such as a nanobody) or a part of an antibody), a nucleic acid (e.g., a dsRNA, siRNA, miRNA), or a marker (such as a fluorescent or luminescent agent).
[0160] In a particular embodiment, the compound is a protein, polypeptide or peptide. With such type of compound, the conjugates of the invention can be produced by genetic fusion.
[0161] Other examples of such compounds include, for instance peptide or protein antigens. Such compounds are typically conjugated to the anti-GFLV coat protein antibodies or antibody derivatives, so as to allow their exposure at the surface of a resulting particle. In this manner, the conjugate or resulting VLP can be used as a therapeutic or prophylactic vaccine or immunogenic composition, to induce or stimulate an immune response against the antigen.
[0162] Another example of such compounds includes peptides or proteins with affinity to metal or tracer molecules such as gadolinium, silver, gold etc.
[0163] Another example are compounds that allows to evade the immune system such as protein A from Staphylococcus aureus, protein G from Streptococcal bacteria, or peptides that are markers or Self such as peptides derived from CD47.
[0164] Another example of such compounds includes toxins, enzymes or toxic molecules which should preferably not be exposed in the organism before they have reached their target tissue.
[0165] Examples of such toxic compounds include, for instance, caspases, the cytosine deaminase and uracil phospho-ribosyltransferase Fcy and Fur, ribosome inactivating proteins, and bacterial and plant toxins, which act by inhibiting protein synthesis in eukaryotic cells. The toxins of the Shiga and ricin family inactivate 60S ribosomal subunits by an N-glycosidic cleavage, which releases a specific adenine base from the sugar-phosphate backbone of 28S rRNA. Members of the family include shiga and shiga-like toxins, and type I (e.g. trichosanthin and luffin) and type II (e.g. ricin, agglutinin and abrin) ribosome inactivating proteins (RIPs). All these toxins are structurally related. RIPs have been of considerable interest because of their potential use, conjugated with monoclonal antibodies, as immunotoxins to treat cancers. Further, trichosanthin has been shown to have potent activity against HIV-1-infected T cells and macrophages.
[0166] Another example of such compounds includes cell targeting ligands. Such compounds allow specific or targeted binding to cell receptors or structures, thus allowing targeting of the conjugate or VLP to a preferred target cell or tissue. Examples of such targeting ligands include ligands of cell surface receptors, or receptors of cell surface proteins, or antibodies (such as nanobodies) or fragments thereof.
[0167] Another example of such compounds includes cell-penetrating peptides and transduction domains. Such compounds allow internalization of conjugate or VLP in the cell. Examples of such peptides include tat peptide of HIV-1.
[0168] In one embodiment, the present invention relates to a VLP comprising a GFLV coat protein conjugated with at least two or three different anti-GFLV coat protein antibodies or antibody derivatives, wherein at least one anti-GFLV coat protein antibody or antibody derivative is conjugated to a protein, polypeptide or peptide. With such type of compound, the conjugates of the invention can be produced by genetic fusion or chemical conjugation to an antibody, preferably to a nanobody.
[0169] In a particular embodiment, the compound fused to the anti-GFLV coat protein nanobody is a protein, polypeptide or peptide that has a size of at least 1.5 times the size of the nanobody (i.e. about at least 22 kDa), a size of at least twice the size of the nanobody (i.e. about at least 30 kDa), a size of at least 3 times the size of the nanobody (i.e. about at least 45 kDa) or a size of at least 4 times the size of the nanobody (i.e. about at least 60 kDa).
[0170] In a particular embodiment, the compound fused to the anti-GFLV coat protein nanobody is a protein, polypeptide or peptide that has a diameter of at least twice the diameter of the nanobody (i.e. about at least 5 nm), a diameter of at least 3 times the diameter of the nanobody (i.e. about at least 10 nm), a diameter of at least 4 times the diameter of the nanobody (i.e. about at least 15 nm) or a diameter of at least 5 times the diameter of the nanobody (i.e. about at least 20 nm). By diameter it is meant the mean diameter of a protein, polypeptide or peptide when considered as a globular compound.
[0171] In a particular embodiment, the present invention relates to a VLP comprising a GFLV coat protein conjugated at least two or three different anti-GFLV coat protein antibodies or antibody derivatives, wherein at least one anti-GFLV coat protein antibody or antibody derivative is conjugated to a targeting ligand. Preferably, the GFLV coat protein can be conjugated at the N-term end to a toxic compound, in particular a cytotoxic compound such as those used in the treatment of cancer. Such conjugate allows formation of a VLP having the targeting ligand exposed at the surface and the toxic compound encaged. Alternatively, the toxic compound may be conjugated to another anti-GFLV coat protein antibodies or antibody derivatives, thereby allowing the targeted delivery of the toxic compound.
[0172] In another particular embodiment, the present invention relates to a VLP comprising a GFLV coat protein and at least two or three different anti-GFLV coat protein antibodies or antibody derivatives, said at least two or three different anti-GFLV coat protein antibodies or antibody derivatives being conjugated to antigens, which can be the same or different, more preferably which are different. In the context of three different anti-GFLV coat protein antibodies or antibody derivatives conjugated to three different antigens, the resulting VLP may expose up to 60 copies of each antigen at the surface of the VLP. In the context of three different anti-GFLV coat protein antibodies or antibody derivatives conjugated to the same antigen, the resulting VLP may expose up to 180 copies of the antigen at the surface of the VLP.
[0173] The antigen may be chosen a viral, bacterial, fungal, parasite or cancer antigen.
[0174] As used herein, the term bacterial antigen includes, but is not limited to, intact, attenuated or killed bacteria, any structural or functional bacterial protein or carbohydrate, or any peptide portion of a bacterial protein of sufficient length (typically about 8 amino acids or longer) to be antigenic. Examples include gram-positive bacterial antigens and gram-negative bacterial antigens. In exemplary embodiments the bacterial antigen is derived from a bacterium selected from the group consisting of Lysteria species, in particular Lysteria monocytogenese; Helicobacter species, in particular Helicobacter pyloris; Borelia species, in particular Borelia burgdorferi; Legionella species, in particular Legionella pneumophilia; Mycobacteria s species, in particular M. tuberculosis, M. avium, M. intracellulare, M. kansasii, M. gordonae; Staphylococcus species, in particular Staphylococcus aureus; Neisseria species, in particular N. gonorrhoeae, N. meningitidis; Listeria species, in particular Listeria monocytogenes; Streptococcus species, in particular S. pyogenes, S. agalactiae; S. faecalis; S. bovis, S. pneumonias; anaerobic Streptococcus species; pathogenic Campylobacter species; Enterococcus species; Haemophilus species, in particular Haemophilus influenzue; Bacillus species, in particular Bacillus anthracis; Corynebacterium species, in particular Corynebacterium diphtheriae; Erysipelothrix species, in particular Erysipelothrix rhusiopathiae; Clostridium species, in particular C. perfringens, C. tetani; Enterobacter species, in particular Enterobacter aerogenes, Klebsiella species, in particular Klebsiella 1S pneumoniae, Pasteurella species, in particular Pasteurella multocida, Bacteroides species; Fusobacterium species, in particular Fusobacterium nucleatum; Streptobacillus species, in particular Streptobacillus moniliformis; Treponema species, in particular Treponema pertenue; Leptospira; pathogenic Escherichia species; and Actinomyces species, in particular Actinomyces israelli.
[0175] As used herein, the term viral antigen includes, but is not limited to, intact, attenuated or killed whole virus, any structural or functional viral protein, or any peptide portion of a viral protein of sufficient length (typically about 8 amino acids or longer) to be antigenic. Sources of a viral antigen include, but are not limited to viruses from the families: Retroviridae (e.g., human immunodeficiency viruses, such as HIV-1 (also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); Flaviviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses, Zika virus, West Nile virus); Coronaviridae (e.g., coronaviruses such as SARS (Severe acute respiratory syndrome) virus); Rhabdoviridae (e.g., vesicular stomatitis viruses, rabies viruses); Filoviridae (e.g., ebola viruses); Paramyxoviridae (e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus (RSV), especially human respiratory syncytial virus, metapneumovirus, especially human metapneumovirus (hMPV)); Orthomyxoviridae (e.g., influenza viruses such as H5N1, H7N9, H9N2); Bunyaviridae (e.g., Hantaan viruses, bunya viruses, phleboviruses and Nairo viruses, Crimean-Congo hemorrhagic fever (CCHF)); Arenaviridae (hemorrhagic fever viruses); Reoviridae (e.g., reoviruses, orbiviruses and rotaviruses); Bornaviridae; Hepadnaviridae (Hepatitis B virus); Parvoviridae (parvoviruses); Papovaviridae (papilloma viruses, polyoma viruses); Adenoviridae (most adenoviruses); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus; Poxyiridae (variola viruses, vaccinia viruses, pox viruses); and Iridoviridae (e.g., African swine fever virus); and unclassified viruses (e.g., the agent of delta hepatitis (thought to be a defective satellite of hepatitis B virus), Hepatitis C; Norwalk and related viruses, and astroviruses), alphavirus (chikungunya virus). Alternatively, a viral antigen may be produced recombinantly.
[0176] As used herein, the terms cancer antigen and tumour antigen are used interchangeably and refer to antigens that are differentially expressed by cancer cells and can thereby be exploited in order to target cancer cells. Cancer antigens are antigens which can potentially stimulate apparently tumour-specific immune responses. Some of these antigens are encoded, although not necessarily expressed, by normal cells. These antigens can be characterized as those which are normally silent (i.e., not expressed) in normal cells, those that are expressed only at certain stages of differentiation and those that are temporally expressed such as embryonic and fetal antigens. Other cancer antigens are encoded by mutant cellular genes, such as oncogenes (e.g., activated ras oncogene), suppressor genes (e.g., mutant p53), fusion proteins resulting from internal deletions or chromosomal translocations. Still other cancer antigens can be encoded by viral genes such as those carried on RNA and DNA tumour viruses. The cancer antigens are usually normal cell surface antigens which are either over-expressed or expressed at abnormal times. Ideally the target antigen is expressed only on proliferative cells (preferably tumour cells), however this is rarely observed in practice. As a result, target antigens are usually selected on the basis of differential expression between proliferative and healthy tissue. Antibodies have been raised to target specific tumour related antigens including: Cripto, CD4, CD20, CD30, CD19, CD33, Glycoprotein NMB, CanAg, Her2 (ErbB2/Neu), CD56 (NCAM), CD22 (Siglec2), CD33 (Siglec3), CD79, CD138, CD171, PSCA, PSMA (prostate specific membrane antigen), BCMA, CD52, CD56, CD80, CD70, E-selectin, EphB2, Melanotransferin, Mud 6 and TMEFF2. Examples of cancer antigens also include B7-H3, B7-H4, B7-H6, PD-L1, MAGE, MART-1/Melan-A, gp100, adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-C017-1A/GA733, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1, prostate specific antigen (PSA), T-cell receptor/CD3-zeta chain, MAGE-family of tumour antigens, GAGE-family of tumour antigens, BAGE, RAGE, LAGE-1, NAG, GnT-V, MUM-1, CDK4, MUC family, VEGF, VEGF receptors, PDGF, TGF-alpha, EGF, EGF receptor, a member of the human EGF-like receptor family such as HER-2/neu, HER-3, HER-4 or a heterodimeric receptor comprised of at least one HER subunit, gastrin releasing peptide receptor antigen, Muc-1, CA125, v3 integrins, 51 integrins, IIb3-integrins, PDGF beta receptor, SVE-cadherin, IL-8, hCG, IL-6, IL-6 receptor, IL-15, -fetoprotein, E-cadherin, -catenin, -catenin and -catenin, p120ctn, PRAME, NY-ESO-1, cdc27, adenomatous polyposis coli protein (APC), fodrin, Connexin 37, Ig-idiotype, p15, gp75, GM2 and GD2 gangliosides, viral products such as human papillomavirus proteins, imp-1, P1A, EBV-encoded nuclear antigen (EBNA)-1, brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1 and CT-7, and c-erbB-2, although this is not intended to be exhaustive.
[0177] As used herein, the term parasite antigen includes, but is not limited to, antigen from parasites such as P. falciform proteins such as CSP (circumsporozoite protein), AMA-1 (apical membrane antigen-1), TRAP/SSP2 (sporozoite surface protein 2, LSA (liver stage antigen), Pf Exp 1 (Pf exported protein 1), SALSA (Pf antigen 2 sporozoite and liver stage antigen), STARP (sporozoite threonine and asparagins-rich protein).
Methods for Preparing VLPs
[0178] The invention also relates to a method of producing a conjugated molecule as defined above, comprising providing a GFLV coat protein or anti-GFLV coat protein antibody or antibody derivative, and conjugating said protein or antibody to a compound. In a particular embodiment, providing a GFLV coat protein or anti-GFLV coat protein antibody or antibody derivative comprises expressing a nucleic acid construct encoding said protein or antibody in a host cell or an in vitro expression system, and collecting the expressed protein or antibody. Subsequently, the protein or antibody may be conjugated to a compound. In an alternative route, the conjugated protein or antibody is expressed directly using a recombinant fusion nucleic acid. In this regard, in a particular embodiment, the invention relates to a method of producing a conjugated molecule as defined above comprising providing a nucleic acid construct encoding said molecule and expressing said nucleic acid in a host cell or an in vitro expression system. Recombinant production may be performed in any suitable host such as plant cells, in planta, in bacteria, yeasts, insects, CHO or other eukaryotic cells or in an in vitro transcription system. The expressed conjugate may be collected and stored as free molecules in any suitable medium or state. It may also be allowed to assemble into VLPs, which can then be collected and stored under suitable conditions.
[0179] Further objects of the invention also reside in a nucleic acid molecule (e.g., DNA, RNA) encoding a molecule as defined above; a vector comprising such a nucleic acid; and a host cell containing such a nucleic acid or vector.
[0180] The invention also provides a method of producing virus-like particles according to the present invention. The method comprises (i) providing a GFLV coat protein, optionally conjugated to a compound, (ii) allowing said GFLV coat protein, alone or in mixture with other proteins, to assemble into virus-like particles, and (iii) coupling the particles of (ii) to at least two different anti-GFLV coat protein antibodies or antibody derivatives as disclosed in the present document.
[0181] In a typical embodiment, the GFLV coat proteins are maintained under conditions allowing self-assembly into particles. Such conditions include in solution at a pH comprised typically between 5 and 9, more typically between 6 and 8, and at a temperature comprised between 4 C. and 50 C., more preferably around room temperature.
[0182] The GFLV coat protein may be provided by artificial synthesis, enzymatic production/assembly, purification, and/or recombinant technology. In this respect, in a preferred embodiment, the method comprises: [0183] providing a nucleic acid construct encoding a GFLV coat protein, optionally conjugated to a compound, [0184] expressing said nucleic acid in a host cell or an in vitro expression system, [0185] optionally purifying the GFLV coat protein, [0186] forming VLPs from the expressed and optionally purified GFLV coat proteins, and [0187] collecting or purifying the VLPs.
[0188] In a particular embodiment, the method comprises a further step of adding to the VLPs the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives, optionally conjugated to a compound. Particularly, the method comprises a further step of adding to the VLPs at least two or three different anti-GFLV coat protein antibodies.
[0189] Preferably, the antibodies chosen do not compete which each other and/or each of the at least two or three antibodies recognized an epitope present 60 times on the outer surface of the GFLV capsid, and/or at least one of the at least two or three antibody stabilizes the GFLV capsid.
[0190] In another particular embodiment, the step of forming the VLP is performed in the presence the at least two or three different anti-GFLV coat protein antibodies or antibody derivatives.
[0191] In the above methods, recombinant production may be performed in any suitable host such as plant cells, in planta, in bacteria, yeasts, CHO or other eukaryotic system or in an in vitro transcription system.
[0192] The VLPs may be collected and purified by conventional techniques such as, for instance, chromatography, centrifugation, and the like. Because VLPs are stable under physiological conditions, they may be stored in solution or frozen or lyophilized, according to conventional techniques.
Pharmaceutical Compositions and Methods
[0193] The invention also relates to a pharmaceutical composition comprising at least one VLP as defined above and, preferably, one or more pharmaceutically acceptable excipients. The invention also relates to a pharmaceutical composition comprising a VLP comprising a GFLV coat protein and at least two different anti-GFLV coat protein antibodies or antibody derivatives as defined above and, preferably, one or more pharmaceutically acceptable excipients. Preferably, the antibody derivatives are antibodies chosen to not compete which each other and/or each of the at least two or three antibodies recognized an epitope present 60 times on the outer surface of the GFLV capsid, and/or at least one of the at least two or three antibodies stabilizes the GFLV capsid. Even more preferably, the antibody derivatives are nanobodies genetically fused to a compound as described above.
[0194] Depending on the presence or absence, and on the nature of a compound or active group bound to the GFLV coat protein or the anti-GFLV coat protein antibodies or antibody derivatives, the compositions of the invention may have various utilities such as therapeutic compositions, vaccines, adjuvants, diagnostic compositions, immunogenic compositions, research samples, etc.
[0195] The compositions of the invention advantageously comprise a pharmaceutically acceptable vector or excipient. The pharmaceutically acceptable excipient can be selected from any suitable and conventional excipient, depending on the form of the composition. In particular, for solid compositions such as tablets, pills, powders, or granules, the composition may comprise e.g., lactose, dextrose, sucrose, mannitol, or sorbitol. A lubricant, such as talc or stearic acid, a binder, such as starch or gelatin, a disintegrant such as agar, and/or a sweetener may be further added to the composition as well. For semi-solid compositions, the excipient can, for example, be an emulsion or oily suspension. Liquid compositions, in particular injectable or those included in a soft capsule, can include a diluent or solvent such as, for example, water, physiological saline solution, aqueous dextrose, an alcohol, an oil and analogues thereof.
[0196] The compositions or conjugates of the invention can be administered by any suitable route such as, without limitation, by parenteral (e.g., subcutaneous, intravenous or intramuscular route), oral, rectal, ocular or intranasal routes. The pharmaceutical compositions typically comprise an effective dose of a VP or conjugate or compound, e.g., any dose that gives a therapeutic effect for a given condition and administration schedule.
[0197] Depending on the nature of the compound conjugated to the coat protein, the VLPs and compositions of the invention can be used for treating, preventing, diagnosing or imaging various pathologies.
[0198] In this respect, the invention relates to VLPs as defined above for use as a medicament. It also related to the use of VLPs as defined above for the manufacture of a medicament. It also relates to a method for treating a disease in a subject comprising administering a therapeutic effective amount of VLPs as defined above to said subject.
[0199] The invention relates to VLPs as defined above for use as a vaccine. It also related to the use of VLPs as defined above for the manufacture of a vaccine. It also relates to a vaccine composition comprising VLPs as defined above.
[0200] The invention relates to VLPs as defined above for use as an adjuvant or immunomodulator.
[0201] The invention relates to VLPs as defined above for use as a diagnostic agent. The invention relates to VLPs as defined above for use as a tracer.
[0202] Further aspects and advantages of the invention will be disclosed in the following experimental section, which shall be considered as illustrative.
EXAMPLES
A. Experimental Procedures
Construction of Binary Plasmids
[0203] Coding sequences for GFLV-CP.sub.F13, TagRFP and EGFP were amplified by PCR using Phusion high fidelity DNA polymerase according to the manufacturer's instructions (New England Biolabs, Thermo Fisher Scientific, Massachusetts) using pVec2ABC (Viry et al., 1993; Schellenberger et al., 2010; Vigne et al., 2013), pTagRFP-C (Evrogen, Russia) and pEGFP-N1 (Clontech, California) as templates, respectively. The translational fusions TRCP and CPTR, corresponding respectively to N- or C-terminal fusions of GFLV-CP.sub.F13 with TagRFP, were obtained by overlapping PCRs (Ho et al., 1989) using above described PCR products as templates and overlapping primers encoding the Gly.sub.3-Ser-Gly.sub.3 peptide linker sequence. The attB-flancked CP, TR, CPTR and TRCP PCR products were cloned by Gateway recombination into the pDONR/Zeo entry vector (Invitrogen, Thermo Fisher Scientific, Massachusetts) and further recombined into the pEAQ-HT-DEST1 binary plasmid (Sainsbury et al., 2009). For CPEG, in which the C-terminus of GFLV-CP.sub.F13 is fused to EGFP, a pDONR.sup.TM/Zeo vector containing the CP coding sequence devoid of stop codon was used for cloning by recombination in a homemade Gateway expression vector deriving from the pEAQ-HT-DEST1 (Sainsbury et al., 2009) vector by the introduction of the EGFP encoding sequence (Clontech, California) downstream of the attR2 recombination site. Recombination resulted in the introduction of the DPAFLYKVVRSFGPA linker peptide between GFLV-CP.sub.F13 C-terminal residue and EGFP (
Immunization, Nanobodies Library Construction and Screening
[0204] GFLV-specific single domain antibodies Nanobodies (Nbs) were generated according to Ghassabeh, Saerens and Muyldermans. Briefly, a camel (Camelus dromedarius) was injected 6 times subcutaneously at weekly intervals with 100 g of purified GFLV according to standard immunization protocols. After immunization, total RNA was extracted from isolated peripheral blood lymphocytes and mRNAs reverse transcribed to cDNA. The region encoding variable fragments of heavy chain antibodies were then amplified with two subsequent PCR, cloned into the pHEN4 phagemid vector (10) and transformed into E. coli TG1 cells. The resulting Nbs library was screened by phage display for GFLV-specific binders in three consecutive biopanning rounds against 10 g of purified GFLV each. Sequences of GFLV-specific Nbs were obtained following the isolation of individual clones from the enriched library by a phage-ELISA approach performed against 100 ng of purified GFLV.
Plant Material, Virus Infection and Virus-Like Particles Production
[0205] C. quinoa and N. benthamiana plants were grown in greenhouses at 22/18 C. (day/night) temperatures. GFLV-CP.sub.F13 infectious crude sap derived from pMV13+pVec.sub.Acc65I2ABC-infected material (Schellenberger et al., 2010) was used to mechanically inoculate a large number of three weeks old C. quinoa plants. Plant were harvested 14 days post-inoculation and used for virus purification. For mechanical inoculations of N. benthamiana, three weeks old plants were inoculated with purified GFLV-CP.sub.F13. VLPs were produced by transient expression after agro-infiltration of N. benthamiana leaves. Binary plasmids were introduced by electroporation and maintained in Agrobacterium tumefaciens strain GV3101:pMP90. Cultures were grown to stable phase in Luria-Bertani media with appropriated antibiotics, pelleted and then resuspended in sterile water, alone or in a 1:1 ratio for coexpression, to a final optical density of 0.5 at 600 nm. Suspensions were infiltrated into four weeks old N. benthamiana leaves with 2 ml plastic syringes. Healthy, infected and agro-infiltrated N. benthamiana plants were maintained in a growth chamber set at 14/10 photoperiod (4800 1) with a temperature setting of 21/18 C. (day/night) for 7 days before leaf harvesting.
Agro-Infiltrated-Leaves Observation
[0206] Fluorescent proteins visualisation was realised 5 days post-agro-infiltration. Leaves were imaged with an AxioZoom V16 macroscope (Zeiss, Germany) using excitation and emission wavelength filters of 450-490 nm and 500-550 nm for EGFP imaging and of 625-655 nm and 665-715 nm for TagRFP visualization. Images were processed using ImageJ (Schneider et al., 2012) and GNU Image Manipulation Program (GIMP, www.gimp.org) softwares.
DAS-ELISA
[0207] Healthy, infected and agro-infiltrated leaves were grinded at 1:5 w/v ratio in HEPES 100 mM pH8 and clarified for 5 min at 3000 g. GFLV or VLPs detection was performed using commercial DAS-ELISA kit (Bioreba, Switzerland) according the manufacturer's instructions. Briefly, plates were coated with polyclonal anti-GFLV antibodies diluted in coating buffer at 1:1000 dilution, incubated with clarified extracts before the addition of anti-GFLV monoclonal antibodies coupled to alkaline phosphatase at 1:1000 dilution in conjugate buffer. Three washings were done between each step of the DAS-ELISA procedure. Detection was realised using para-nitrophenylphosphate as substrate that produces a yellow water-soluble reaction product in alkaline media. Absorbance at 405 nm was measured with the Titertek Multiscan MCC/340 reader (Labsystems, France). Samples were considered to be positive when the absorbance values exceed the control samples by at least a factor of three after substrate incubation period.
Competitive ELISA Assessment of Nanobodies Against GFLV Particles
[0208] GFLV or VLP detection was performed using a homemade DAS-ELISA kit using different strep-tagged nanobodies (Nb-ST) or fused to Alkaline Phosphatase protein (Nb-AP). Briefly, plates were coated directly with purified GFLV particles diluted at a 1:1000 in coating buffer, incubated with strep-tagged nanobodies (Nb23:ST, Nb75:ST, Nbp59:ST, Nb125:ST or Nb122:ST) at a 1:100 dilution in conjugate buffer before addition of anti-GFLV nanobodies fused to AP (Nb75:AP, Nbp59:AP or Nb155:AP) at a 1:500 dilution in conjugate buffer. Competition assessment of tested nanobodies on viral epitopes was performed by challenging two Nb:STs versus same Nbs fused to AP in each ELISA test. Detection was realized using para-nitrophenylphosphate (PNPP) and absorbance at 405 nm measured with a Titertek Multiskan MCC/340 reader (Labsystems).
Negative Staining, Immunocapture and Immunosorbent Electron Microscopy (ISEM)
[0209] Healthy, infected and agro-infiltrated leaves were grinded in 100 mM pH 8 HEPES buffer, clarified by centrifugation at 3000 g for 5 min and either processed for simple negative staining, for immunocapture or for ISEM. For all the grids, negative staining was performed on 300 mesh nickel grids covered with carbon-coated Formvar (Electron Microscopy Science, Pennsylvania) by incubation with 1% ammonium molybdate solution for 90 sec. For immunocaptures performed on clarified saps, grids were coated with polyclonal antibodies (Bioreba, Switzerland) at 1:100 dilution, incubated with plant extracts for 2 h at 4 C., washed in HEPES 25 mM pH 8 buffer and finally processed for negative staining. For ISEM on purified CP, CPTR and TRCP VLPs, grids were coated with homemade monoclonal antibodies against GFLV at a 0.05 mg/mL concentration and incubated with VLPs for 1 h at room temperature. After blocking with 2% w/v BSA, 10% v/v normal goat serum, 0.05% Triton-X100 in 22.5 mM HEPES pH 8, grids were further incubated with either anti-GFLV (Bioreba, Switzerland) at 1:100 dilution or anti-TR polyclonal antibodies at 0.01 mg/mL concentration (Evrogen, Russia) for 1 h at room temperature. Immunogold labelling was performed using anti-rabbit antibodies conjugated to 10 nm colloidal gold particles at 1:50 dilution (British Biocell International, Wales). Washes with 25 mM pH 8 HEPES buffer were done between all steps. ISEM on purified CPEG and CPEG+TRCP VLPs were performed in a similar manner except that polyclonal antibodies against GFLV (Bioreba, Switzerland) were used for capture and either home-made monoclonal antibodies mix against GFLV or monoclonal anti-EG antibodies (Roche, Germany) employed for detection. Finally, immunogold labelling was performed using anti-mouse antibodies conjugated with 10 nm colloidal gold particles (British Biocell International, Wales). Observations were realised using a Philips EM208 transmission electron microscope. Film-based photographs were acquired onto Kodak Electron Image Films SO-163 (Electron Microscopy Science, Pennsylvania) and revealed with the adapted chemicals (Electron Microscopy Science, Pennsylvania). Finally, photographs were scanned to obtain digital electron microscope images and processed using GNU Image Manipulation Program (GIMP, www.gimp.org).
GFLV-CP Structure Representation and Analysis
[0210] CP subunit and capsid representations were made using the previously 3 resolved GFLV-F13 atomic structure (PDB ID: 4V5T, Schellenberger, Sauter, et al., 2011) with the UCSF Chimera package (Pettersen et al., 2004). The CP subunit ends accessibility data were obtained using VIPERdb (Carrillo-Tripp et al., 2009).
Virus and Virus-Like Particles Purification
[0211] GFLV was purified from N. benthamiana infected-plants according to Schellenberger et al., (2011a). VLPs were purified from agro-infiltrated N. benthamiana leaves following the same experimental procedure. Briefly, a minimum of 1000 g of leaves were ground in extraction buffer, the resulting extract was filtered, incubated with bentonite and finally clarified by centrifugation for 15 min at 1,900 g. VLPs were precipitated from clarified sap by adding PEG-20,000 and sodium chloride and further processed by centrifugation on a sucrose cushion pH 9 followed by a sucrose density gradient fractionation. Two mL fractions were collected from which aliquots at 1:500, 1:5,000 and 1:10,000 dilutions were processed for a semi-quantitative DAS-ELISA to identify GFLV- or VLP-enriched fractions that were further pooled before final ultracentrifugation at 290,000 g for 2 hours. After resuspension in HEPES 25 mM pH 9, VLPs were quantified by DAS-ELISA (Vigne et al., 2013) using purified GFLV as a standard.
Expression and Purification of NbsST from E. coli
[0212] GFLV-specific Nbs coding sequences were sub-cloned into the pHEN6 (Conrath et al., 2001) expression vector as a BstEII/PstI fragment adding a N-terminal pelB signal sequence for periplasmic targeting and a C-terminal 6-His-tag for purification. Production of 6-His-tagged Nbs constructs was performed by expression in freshly transformed E. coli WK6 cells grown in Terrific Broth (TB) medium and induced overnight with 1 mM isopropyl-BD-thiogalactopyranoside (IPTG) at 28 C. (Thys et al., 2010).
[0213] An additional C-terminal Strep-tag II (Trp-Ser-His-Pro-Gln-Phe-Glu-Lys) was added for Nbs use in ELISA. To do so, Nbs coding sequences were amplified by PCR and amplicons introduced by Gateway cloning into the pDONR/Zeo vector (Invitrogen) which was further recombined into the pOGWA expression vector (Busso et al., 2005). Large-scale production of Strep II tagged Nbs constructs was performed by expression in freshly transformed E. coli BL21 (DE3) cells grown overnight at 23 C. in auto-inducing ZYP 50502 medium (Studier, 2005).
[0214] Nbs were extracted from periplasm by osmotic shock (Habib et al., 2013) and purified at 4 C. by immobilized metal ion chromatography (IMAC) on a 1 ml Protino Ni-NTA column [Macherey-Nagel] using 500 mM imidazole in running buffer (50 mM Tris, 300 mM NaCl, 5% glycerol, pH 8.0) for elution, followed by size exclusion chromatography (SEC) on a Hiload 16/60 Superdex75 prep grade column (GE Healthcare Life Science) in 1 phosphate buffer saline (PBS) (Conrath et al., 2001; Thys et al., 2010). Purity of eluted proteins was assessed by Coomassie blue staining of denatured Nbs that migrate as single bands of ca. 15 kDa in Tris-tricine polyacrylamide gel. Purification yields were estimated from absorbance at 280 nm based on extinction coefficients computed from Nbs amino acid composition.
Expression and Nbs:EGFP Chromobodies Purification from E. coli
[0215] EGFP:6his and Nbs sequences were amplified by PCR using Phusion high fidelity DNA polymerase according to the manufacturer's instructions (New England Biolabs). EGFP:6his was amplified from pEAQ:GFP vector with BamHI/XhoI flanking restriction sites and Nbs sequences were amplified with NdeI/BamHI flanking restriction sites. PCR fragment were digested with restriction enzymes according to the manufacturer's instructions, and cloned into the pET-22b (+) expression vector (Novagen). Expression was performed in freshly transformed E. coli SHuffle T7 Express cells (New England Biolabs) grown in TB medium at 30 C. until the culture reach an O.D=0.8-1 then protein production is induced overnight with 0.1 mM IPTG at 20 C. 41. Pelleted cells resuspended in running buffer (50 mM Tris, 300 mM NaCl, 5% glycerol, pH 7.4) were lysed by sonication (100% amplitude for 2 min with 13 mm diameter probe, Vibra-Cell VCX 500 (Sonics)) and purification of cytoplasmic extract by IMAC follow by SEC was carried out as indicated above. The purity of the eluted protein was assessed by Coomassie blue staining of denatured Nbs:EGFP that migrate as a band of 43 kDa in Tris-tricine polyacrylamide gel upon electrophoresis.
Expression and Purification of Nbs:ALP from E. coli
[0216] Alkaline phosphatase:6his (AP:6his) and Nbs sequences were amplified by PCR using Phusion high fidelity DNA polymerase according to the manufacturer's instructions (New England Biolabs). AP:6his was amplified from pLIP6 vector with BamHI/XhoI flanking restriction sites and Nbs sequences were amplified with NdeI/BamHI flanking restriction sites. PCR fragment were digested with restriction enzymes according to the manufacturer's instructions, and cloned into the pET-22b (+) expression vector (Novagen). Expression was performed in freshly transformed E. coli BL21 expression strain (New England Biolabs) grown in TB medium at 37 C. until the culture reach an O.D=0.8-1 then protein production is induced overnight with 0.1 mM IPTG at 20 C. 41. Nbs were extracted from periplasm by osmotic shock 41 and purified at 4 C. by immobilized metal ion chromatography (IMAC) on a 1 ml Histrap HP Ni-NTA column (GE Healthcare) using 500 mM imidazole in running buffer (50 mM Tris, 300 mM NaCl, 5% glycerol, pH 8.0) for elution. The purity of the eluted protein was assessed by Coomassie blue staining of denatured Nbs:AP:6his that migrate as a band of 60 kDa in Tris-tricine polyacrylamide gel upon electrophoresis. ALP or AP or PAL refers to alkaline phosphatase.
SDS-Page Electrophoresis, Western-Blot and Mass Spectrometry
[0217] For SDS-Page analysis, 6 g of GFLV-particles equivalent from each purified sample were separated on an 8% acrylamide gel and stained with Coomassie blue using Instant Blue (Expedeon, England). For mass spectrometry, SDS-Page bands of interest were excised and proteins destained, reduced, alkyled, trypsin-digested overnight, chemotrypsin-digested and finally processed for nanoLC-MSMS analysis on a nanoU3000 (Dionex, Thermo Fisher Scientific, Massachusetts)-ESI-MicroTOFQII (Bruker, Massachusetts). Mass spectrometry data were analysed with the help of Mascot (Matrix Science Limited, England) and Proteinscape (Bruker, Massachusetts). For Western-Blot analyses, 0.05 g of each sample were resolved on an 8% acrylamide gel and denatured proteins electrotransferred onto Immobilon PVDF membranes. Membranes were incubated either with rabbit polyclonal anti-GFLV antibodies at a 1:1000 dilution or with commercial polyclonal anti-TR antibodies (Evrogen, Russia) at a 1:5000 dilution. Proteins were revealed by chemiluminescence after incubation with goat anti-rabbit conjugated to horseradish peroxidase at a 1:12500 dilution (Thermo Fisher Scientific, Massachusetts) and Lumi-Light solution (Roche, Germany). Images were taken with a G:Box imaging system (Syngene, England), analysed with GeneTools (Syngene, England) and finally processed with GIMP (www.gimp.org).
Single-Particle Epifluorescence Microscopy
[0218] Purified particles from TRCP, CPEG or CPEG+TRCP samples were diluted in HEPES 25 mM pH8 in order to obtain individual spots upon imaging on an inverted epi-fluorescence microscope Axio Abserver Z1 (Zeiss, Germany) equipped with an Orca Flash4.0 camera (Hamamatsu, Japan) and Spectra X light engine (Lumencor, Oregon). Excitation and emission wavelength filters were 455-495 nm and 505-555 nm for EGFP and of 532.5-557.5 nm and 570-640 nm for TagRFP. Images were finally processed using ImageJ (Schneider et al., 2012) and GIMP softwares (www.gimp.org).
Native Agarose Gel Electrophoresis
[0219] Native gel electrophoresis of purified virions and VLPs was performed in 1% w/v agarose gels in 1.0TA buffer (20 mM TrisBase, 0.06% v/v acetic acid) pH 9. For nucleic-acids detection, 5 g of virus particles or VLPs were diluted in loading buffer (10% v/v glycerol, HEPES 25 mM pH 9) supplemented with ethidium bromide (EtBr) at 0.1 g/mL. After electrophoretic separation, the EtBr-prestained gel was first processed for nucleic-acid content using the Gel Doc system (Bio-Rad) equipped with a 302 nm excitation source and a 520-640 nm band-pass emission filter before processing for Coomassie blue staining as mentioned previously. For fluorescence imaging, 3 g of purified VLPs were diluted in loading buffer and native gel electrophoresis performed in the absence of EtBr. Imaging was done with Ettan DIGE Imager imaging system (GE healthcare) equipped with bandpass excitation (380-650 nm) and emission (465-695 nm) filters for EG visualization. TR visualization was realized upon 480-540 nm excitation and 590-660 nm band-pass emission filtering.
Modeling
[0220] The crystal structures of GFLV (PDBid 4V5T), EG (PDBid 1GFL) and TR (PDBid 3M22) were used to model the CPEG, TRCP or TRCPEG VLPs. Chimeric CPs were created with Modeller (Eswar et al., 2006) by appending the linker and corresponding FP sequences to the free C- and N-terminal ends of the CP pointing outside and inside the VLP, respectively. Full capsids were reconstituted using the icosahedral symmetry in PyMOL (The PyMOL Molecular Graphics System, Version 1.7.4 Schrdinger, LLC). The position of the FP in the TRCP capsid was adjusted to avoid steric clashes using Coot (Emsley et al., 2010). Chimeric CPs were created with Modeller (Webb et al., 2014) by appending the linker and corresponding FP sequences to the free C- and N-terminal ends of the CP pointing outside and inside the VLP,
Accession Code
[0221] Cryo-EM map and coordinates of the atomic model can be found in the Protein Data Bank (PDB) and the Electron Microscopy Data Bank (EMD) under the following accession numbers, respectively: PDB (5foj), EMD-3246.
Docking by pyATTRACT
[0222] The ATTRACT docking program was used to dock Nbp59 and Nb122 to GFLV coat protein. pyATTRACT is implemented as a Python script using the pTools library. The docking protocol was applied as described in Zacharias (2005) Proteins: Structure, Function, and Bioinformatics 60, 252-256) and Saladin et al., (2009). PTools: an opensource molecular docking library. BMC structural biology 9, 27.
[0223] Briefly, pyATrRACT performs systematic docking without using any experimental data concerning the native complex. This algorithm relies on minimization of the interaction energy, the ligand (mobile partner) being placed at regular positions/orientations around the receptor surface (fixed partner) at a distance slightly larger than its biggest dimension. For each starting position, about 250 initial ligand orientations are generated. For each starting geometry, energy minimization (quasi-Newton minimizer) is performed using transitional and rotational degrees of freedom of the ligand. The top-ranking solution is very close to the X-ray structure. Different Python scripts are provided with the ATTRACT program to set up the input files needed by the pyATTRACT docking script. The procedure of script analysis was followed as described in Saladin et al., (2009). PTools: an opensource molecular docking library. BMC structural biology 9, 27.
Dynamic Light Scattering (DLS).
[0224] Mean particle diameters and polydispersity of TRCP VLP alone or complexed to Nb23 to Nb23:EGFP or to Nb23:ALP was estimated by DLS using a Zetasizer NanoZS (Malvern) and Nanostar (Wyatt). Five successive measurements were performed using three independent virus and protein preparations with virus at 0.1 mg/ml in Tris buffer (50 mM Tris, 100 mM NaCl, pH 8.3), Nb23 at 0.2 mg/ml, Nb23:EGFP at 0.5 mg/ml and Nb23:ALP at 1 mg/ml. Scattered intensities were recorded at 20 C. and data processed with DTS software (version 6.01) or DYMAMICS (version 7.1.8.93), respectively. All particles were monodisperse. ALP or AP or PAL refers to alkaline phosphatase.
Thermal Shift Assay
[0225] In a ThermoFluor thermal shift assay, the capsid-stabilizing properties of the VHHs were investigated. GFLV (final concentration, 100 g/ml) was exposed to increasing temperatures in the presence or absence of Nb23 at a final concentration of 10 M. All of the samples were prepared in PBS buffer and SYBR green II RNA gel stain (Life Technologies). SYBR green II is a fluorescent dye that emits green light only when bound to nucleic acids. During heating of GFLV particles, the capsid is destabilized and RNA is released. The samples were gradually heated from 30 to 84 C. (steps of 0.4 C., one step per second). Because of the temperature sensitivity of the SYBR green II fluorescence, the temperature was changed to 30 C. after each step to measure the fluorescent signal. For each sample and control, the temperature at which 50% of the maximal fluorescent signal was reached was determined, using Graph Pad Prism.
Microscale Thermophoresis (MST)
[0226] Microscale thermophoresis (MST) measurements were performed using a Monolith NT115 (NanoTemper Technologies GmbH, Germany). The concentration of the fluorescent VLP was kept constant at a concentration of 100 nM, while the concentration of Nb23 was varied from 0.07 nM-1.0 M. Samples were diluted in MST optimized buffer (20 mM TRIS-HCL buffer, pH=9.5). Each experiment consisted of 15-point titration series in which the Nb concentrations were generated as a 1:1 dilution of VLP. For the measurement, 10 L of the different dilutions of samples were filled into hydrophilic treated capillaries (premium coated capillaries, NanoTemper technologies, Germany) and measured after a 10 min equilibration at room temperature. The measurements were performed (n=3) at 40% LED, and 20%, 40%, and 80% MST power. Laser-On time was 30 sec, Laser-Off time 5 sec. MST Analysis data of each VLP vs Nb experiment was loaded into PALMIST (http://biophysics.swmed.edu/MBR/software.html) and evaluated using the appropriate model (1:1) according to Scheuermann et al. (2016) Analytical biochemistry 496, 79-93.
BResults
[0227] 1. GFLV Coat Protein Self-Assembles into Virus-Like Particles
[0228] To address the ability of GFLV coat protein (CP) to produce VLPs in planta, the sequence encoding the CP of GFLV isolate F13 (SEQ ID NO: 1 with no N-ter methionine) was introduced in the pEAQ-HT-DEST1 binary vector (Sainsbury et al., 2009) (
2. GFLV CP Maintains its Capacity to Assemble into VLPs Upon Fusion of its N- or C-Terminal Ends to Foreign Proteins
[0229] Analysis of the GFLV atomic structure (Schellenberger et al. 2011b) reveals that the GFLV CP amino-terminal residue Gly.sub.1 and the three carboxy-terminal residues Phe502, Pro.sub.503 and Val504 do not contribute to the final quaternary structure of the virus capsid and are exposed at the inner and outer surfaces of the GFLV particle, respectively (
[0230] To confirm our results and to gain insights into the biochemical properties of such VLPs, large-scale production in N. benthamiana leaves was carried out followed by purification using standard GFLV purification procedure that includes clarification and ultracentrifugation steps in the absence of protease inhibitors (see methods). In parallel, GFLV-CP.sub.F13 virions were purified from infected C. quinoa leaves at 14 dpi. After linear sucrose gradient, a sharp pink band was observed in the TRCP gradient (
[0231] To assess their quality and purity, purified samples were analysed by Coomassie blue staining after SDS-PAGE (
[0232] To gain insights into the composition of the purified products, Coomassie-stained bands were subjected to mass spectrometry analysis leading to the identification of peptides covering nearly the entire CP for all bands analysed (
3. N- and C-Terminal CP Fusions are Oriented Towards the Interior or Exterior of VLPs, Respectively.
[0233] To gain insights into the orientation of N- and C-terminal CP fusions, VLPs were further subjected to negative staining and immuno-sorbent electron microscopy analyses. As expected, direct coating of purified material onto nickel grids followed by negative staining revealed the presence of numerous VLPs in all samples (
4. Hybrid VLPs can be Produced
[0234] In view of our results, the capacity of GFLV CP to form hybrid VLPs upon co-expression of N- and C-terminal CP fusions was tested. To do so, EGFP was selected as reporter protein and fused to the CP N-terminus as indicated in
[0235] To confirm the production of bonafide hybrid VLPs and hence the presence of particles that emit simultaneously in green and red, purified samples were further processed for single particle imaging by epifluorescence microscopy. In this manner, numerous TRCP VLPs were observed that appeared as individual spots emitting only in the red channel (
5. The GFLV VLPs are Free from Nucleic Acids
[0236] To examine the content of the VLPs, native agarose gel electrophoresis was performed and gel stained either with Coomassie blue for protein content (
6. GFLV CP-Derived VLPs are Compatible with the Simultaneous Encapsidation and Exposure of Up to 120 FPs To estimate the maximum number of FPs that could be incorporated in VLPs upon genetic fusion to the CP, CPEG- and TRCP-derived particles were modelled (see experimental procedures). Both fusions turned out to be fully compatible with the formation of VLPs (
7. Nanobodies are Versatile Tools for the Display of Foreign Proteins at the Surface of GFLV CP-Derived VLPs
[0237] Nb23 which has been described in WO2015/110601 can efficiently bind to purified GFLV particles allowing the structure of the GFLV-Nb23 complex to be determined by single particle cryo-electron microscopy at 2.8 resolution (
[0238] The interaction region essentially involves residues of the complementarity determining regions (CDR) 3 and CDR2 of Nb23, as well as the two neighboring CP domains A and B (2 out of the 3 jellyroll -sandwiches of the CP) that jointly form a composite binding site with two core interacting regions denoted 1 and 2, adding up to a large total interaction surface of 1100 .sup.2 indicative of a stable complex. Within these regions, a high level of specific interactions between the capsid and the antibody is provided through a series of hydrogen bonds. Region 1 comprises loop region 212-216 (C) of domain B of the CP in which Thr212 interacts with Asp100.sub.Nb23, Lys214 forms hydrogen bonds with the carbonyl backbone of Ile 102.sub.Nb23, and Tyr216 interacts with the backbone of Leu104Nb2.sub.3 and forms hydrophobic contacts with Leu104.sub.Nb23. Region 2 comprises the two strands of the capsid -sheet region 370-391 (domain A of the CP) in which Asp371 forms a salt bridge with Arg55Nb23 and Asn375 interacts with Thr58.sub.Nb23. An additional anchor point of the antibody is provided through Lys65.sub.Nb23). In the second -strand of the 370-391 region, the backbone of Val379 interacts with Thr110.sub.Nb23, and the Ser380 backbone and Met381 form hydrophobic contacts with Ser109.sub.Nb23 and Trp108.sub.Nb23, respectively. The CDR3 forms a long loop with a short -helical turn carrying Leu104.sub.Nb23 which is accommodated within a hydrophobic pocket formed by Phe502, Val504, Tyr216, Phe370 and an alanine cluster formed by residues 387, 388 and 391. Phe370 provides -stacking interactions with the side-chain of Trp108.sub.Nb23, which deeply inserts into the binding site within a cavity formed at the junction of the A and B domains of the CP. Finally, the C-terminal Phe502 and Val504 residues form hydrophobic contacts with Tyr107.sub.Nb23, Trp108.sub.Nb23 and Leu104.sub.Nb23. Taken together, the cryo-EM structure provides a precise mapping of the Nb23 epitope on the GFLV capsid and identifies the key residues of GFLV and Nb23 (residues 55-65 of CDR2 and 100-110 of CDR3) involved in the specific molecular recognition events occurring upon complex formation.
[0239] To test whether GFLV CP-derived VLPs are compatible with the binding of Nb23 similarly to viral particles, dynamic light scattering (DLS) and native agarose gel electrophoresis analyses were performed. DLS revealed that TRCP VLPs alone are monodisperse with a particle diameter of 32.0 nm2 nm (meanSD) whereas in the presence of saturating concentration of Nb23, the diameter of TRCP VLPs increased to 37.82 nm (
[0240] To assess whether VLP can be decorated with larger molecules, TRCP VLP where incubated in the presence of purified Nb23 fused to EGFP (27 kDa) (SEQ ID NO: 31) or to bacterial alkaline phosphatase (ALP) (SEQ ID NO: 32), a homo-dimeric protein of approximately 58 kDa for each monomer (Muller et al., 2001), and tested by DLS and native agarose gel electrophoresis. Similarly to our previous results with Nb23, a significant increase of the apparent diameter of the VLPs was observed in the presence of either Nb23:GFP (43.8+/2 nm (mean+/SD, n=3)) or Nb23ALP (40.0+/2 nm (mean+/SD, n=3)) (
[0241] In agreement with the efficient binding of Nb23:GFP and Nb23ALP to TRCP VLPs as suggested by our DLS results, a significant shift in mobility of the VLPs was also observed upon decoration of the VLPs by Nb23:GFP (
[0242] The inventors could demonstrate that Nb23:GFP binding to VLPs is saturable since shift in VLP mobility progressively increased upon addition of increasing amount of Nb23:GFP (
[0243] Similar results were shown for several other nanobodies. VLPs can be decorated with Nbp59 and Nb122. Interestingly the ability of these nanobodies to bind CP is similar to that of Nb23 suggesting a similar stoichiometry of 1:1 for Nbp59 and Nb122 (
[0244] In order to determine potential differences in epitope recognition between the different nanobodies (Nb), competitive ELISA tests were carried out. During this test, purified GFLV viral particles were adsorbed on ELISA plates, and the presence of viral particles was revealed through Nb-PAL (p59-PAL, p75-PAL, 155-PAL) diluted at 1:500. During the detection phase of the test, conjugated buffer containing the Nb-PAL was complemented with or without the different Nb-STs diluted at 1:100 (23, 75, p59, 125, and 122) which is a large excess as compare to Nb-PAL. Binding of a given Nb-ST to the surface of the viral particle do not allow ELISA signalling as opposed to the binding of Nb-PAL. Thus, a decrease in signalling of Nb-PAL in the presence of a given Nb-ST compared to the signalling of Nb-PAL without said Nb-ST demonstrates a competition. As a control the inventors observe a very significant decrease in signalling when the p59-PAL competes with p59-ST, p75-PAL with p75-ST, and 155-PAL with 155-ST. Similar results are observed for 122-ST and 122-PAL. In agreement with their belongings to the same family, Nb23 competes with Nbp75 and no other nanobodies among Nbp59, Nb125, Nb155 and Nb122. Nb-59, Nb125 and Nb155 partially compete with each other but not with Nb23, Nb75 or Nb122. Nb122 does not compete with the other nanobodies (
[0245] The inventors then investigated whether VLP could be decorated with different nanobodies at the time. To address this question, DLS analysis were carried out. Results show that all particles are monodisperse with diameters of 32.0+/2 nm for VLP, 34.0+/2 nm for VLP saturated with Nbp59, 43.8+/2 nm for VLP saturated with Nbp59 and Nb122:ALP and 50.7+/2 nm for VLP saturated with Nbp59 and Nb122:ALP and Nb23:GFP. The increase in apparent diameter of the VLP confirms the successful displaying of two and even three different nanobodies on its surface (
8. Identification of Non-Competing Nbs Recognizing Different Viral Epitopes
[0246] The viral epitope recognition by non-competing Nbs is crucial to realize a multiple decoration on VLP particles. Hence, the interaction of different Nbs with the viral capsid protein epitopes was inspected using competitive ELISA (
[0247] To determine the affinity of interaction between non-competitor to Nb23 and the viral epitopes, Nb23, Nbp59 and Nb122 were selected to measure the affinity of interaction in solution using MST. A titration series of Nbp59 or Nb122 a range of 0.07 nM to 2.5 M was performed while fluorescently labelled VLP was kept constant at 1.0 M throughout the series. Upon binding of Nbs, a change in thermophoretic signal was observed.
[0248] Subsequent fitting of the data to a 1:1 binding model yielded a dissociation constant Kd of (12.563.37) nM for Nb59 and (34.5113.63) nM for Nb122 (
TABLE-US-00009 TABLE 1 Standard Kd (nM) deviation Nb23 9.13 2.91 Nbp59 12.56 3.37 Nb122 34.51 13.63
9. Epitope Mapping and Modelling of Nbp59 and Nb122 Epitopes
[0249] As shown in
[0250] Nb23 was docked first as a control to test the capacity of the docking ATTRACT software to reproduce the position revealed by our EM structure and resulted in a model differing with a RMSD of only 3.4 compared to the resolved EM structure of Nb23-GFLV complex. Within the top 10 predictions proposed for Nb59, only one mapped to residue 198 (whose mutation affect Nb59 binding) in the region R2 (Schellenberger, 2011) and did not overlap with the Nb23 epitope (
10. Heat Stabilization of the GFLV Capsid by Nb23.
[0251] The inventors were interested in finding out whether the Nb23 exerts a stabilizing activity against heat on the GFLV capsid. When a GFLV particle is heated, the capsid is destabilized and viral RNA becomes accessible. The thermostability of the capsid alone or complexed to Nb23 was assessed using a ThermoFluor assay, in which the compounds are gradually heated in the presence of SYBR green II to detect the release of viral RNA. The fluorescent signals are continuously measured and result in a sigmoidal curve when plotted as a function of the temperature. From these curves, the temperature at which 50% of the RNA was released from the capsid (50% effective temperature [ET50]) could be calculated. These ET50 values are given in Table 2 and show that Nb23 was able to increase the stability of the GFLV capsid by approximately 10 C., which represents a nearly 20% increase in thermal stability of the particle. This is significantly better than the stability exerted by neutralizing Nanobodies recognizing poliovirus type 1 (Schotte, L., et al. (2014) J Virol 88, 4403-4413).
TABLE-US-00010 TABLE 2 Temperature Standard mean ( C.) deviation GFLV 49.833 0.453 GFLV + Nb23 59.745 0.064
[0252] Altogether our results demonstrate that nanobodies allow efficient and rapid display of foreign proteins at the surface of GFLV CP-derived VLPs. They also show that native molecules as large as Nb23:GFP (42 Kda) and Nb23:ALP (73 kDa) in its monomeric form) can be bound to VLP without loss of activity. In addition, a combination of three nanobodies allows the display of up to 180 nanobodies at the surface of the VLPs.
TABLE-US-00011 Sequences SEQIDNO:1:GFLVCoatProteinaminoacidsequence MGLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRI TASADPVYTLSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATS FLGKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAP IFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQ LPIVVQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGVLDLKL QWSLNTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLR VLCKPRPGFSFYGRTSFPV SEQIDNO:2:CPTR MGLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRI TASADPVYTLSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATS FLGKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAP IFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQ LPIVVQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGVLDLKL QWSLNTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLR VLCKPRPGFSFYGRTSFPVGGGSGGGMSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAF DILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKK TLGWEANTEMLYPADGGLEGRSDMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVA VARYCDLPSKLGHKLN Bold:linker underlined:coatprotein SEQIDNO:3:TRCP MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFK QSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMAL KLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGGGSGGGGLA GRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRITASA DPVYTLSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATSFLGK PTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAPIFYS IVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQLPIV VQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGVLDLKLQWSL NTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLRVLCK PRPGFSFYGRTSFPV Bold:linker underlined:coatprotein SEQIDNO:4:CPEG MGLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRI TASADPVYTLSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATS FLGKPTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAP IFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQ LPIVVQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGVLDLKL QWSLNTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLR VLCKPRPGFSFYGRTSFPVDPAFLYKVVRSFGPAMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKG IDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALS KDPNEKRDHMVLLEFVTAAGITLGMDELYKTS Bold:linker underlined:coatprotein SEQIDNO:5:TR MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFK QSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMAL KLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHN SEQIDNO:6:LINKER DPAFLYKVVRSFGPA SEQIDNO:7:Nb126 QVQLQESGGGSVQVGGSLRLACAASGDTFSGYLAAWFRQAPGKEREGVAAINSVRHTTSY 60 ANSVKGRFTISKDNADNMMYLEMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKY 120 WGQGTQVTVSS SEQIDNO:8:Nb101 QVQLQESGGGSVQVGGSLRLACAASGDTFSGYLAAWFRQAPGKEREGVAAINSVRHTTSY 60 ADSVKGRFTISKDNADNMMYLEMNGLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKY 120 WGQGTQVTVSS 131 SEQIDNO:9:Nb23 QVQLQESGGGSVQVGGSLRVACAASGDTFSGYLAAWFRQAPGKGREGVAAINSKRHTTSY 60 ADSVKGRFTISKDNADNIMYLEMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKY 120 WGQGTQVTVSS 131 SEQIDNO:10:Nbp75 QVQLQESGGGSVQAGGSLRLSCVASEYPSSSTAMAWFRQAPGKEREGVAAINSVRHTTSY 60 ADSVKGRFTISKDNADNMMYLEMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKY 120 WGQGTQVTVSS 131 SEQIDNO:11:Nbp71 QVQLQESGGGAVQPGGSLKLSCEASGDVPENGYMAWFRQAPGKEREGVAAINSVRHTTSY 60 ADSVKGRFTISKDNADNMMYLEMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKY 120 WGQGTQVTVSS 131 SEQIDNO:12:Nbp59 QVQLQESGGGTVQAGGSLRLSCSISGDTSNSYCMGWFRQAPGKEREVVAHISTGVISPGY 60 NKFSEGRFTISPDNAKNSVYLQMNNLKPDDTAMYYCAARTGYCSGSWGVADSFNGWGQGT 120 QVTVSS 126 SEQIDNO:13:Nb125 QVQLQESGGGSVQAGGSLRLSCAASGYTYSMYCMAWFRQAPGKEREGVAAINSGNRSTYY 60 ADSVKGRFTISQDNAKNTVYLIMNSLKPEDTAIYYCAADPQRCGSWTWANMYEYNYWGQG 120 TQVTVSS 127 SEQIDNO:14:Nb155 QVQLQESGGGSVQAGESLRLSCTASELTFSDYIMNWFRQAQGKECERVSMIIQNGGDTHY 60 ADSVKGRFTISRDNTKSTLHLQMNNLRPDDTAVYYCAAGALLPTFNHCPPPGAYFGQGTQ 120 VTVSS 125 SEQIDNO:15:Nb37 QVQLQESGGGTVQAGGSLRLSCSISGDTSNSYCMGWFRQAPGKEREVVAHISTNNISPAY 60 NKFREGRFTISPDNAKNSVYLQMNNLKPEDTAMYYCAARTGYCSGSWGVADSFNGWGQGT 120 QVTVSS 126 SEQIDNO:16:Nb77 QVQLQESGGGTVQAGGSLRLSCSISGDTSNSYCMGWFRQAPGKEREVVAHISTGVISPGY 60 NKFAEGRFTISPDNAKNSVYLQMNNLKPEDTAMYFCAARTGSCSGSWGVADSFNGWGQGT 120 QVTVSS 126 SEQIDNO:17:Nb171 QVQLQESGGGTVQAGGSLRLSCSISGDTSNSYCMGWFRQAPGKEREVVARISTGVISPGY 60 NKFAEGRFTISPDNAKNSVYLQMNNLKPEDTAMYFCAARTGSCSGSWGVADSFNGWGQGT 120 QVTVSS 126 SEQIDNO:18:Nb159 QVQLQESGGGSVQAGGSLRLSCAASGYTYSMYCMAWFRQAPGKEREGVAAINSGGPSTYY 60 ADSVKGRFTISQDNAKNTVYLIMNSLKPEDTAIYYCAADPQRCGSWSWANMYEYNYWGQG 120 TQVTVSS 127 SEQIDNO:19:Nbp25 QVQLQESGGGSVQAGGSLRLSCAASGYTYSMYCMGWFRQAPGKEREGVAAINSGNGNTYY 60 ADSVKGRFTISQDNAKNTMYLLMNSLKPEDTAIYYCAADPQRCGSWTWAGVFEYNYWGQG 120 TQVTVSS 127 SEQIDNO:20:Nb172 QVQLQESGGGSVQAGESLRLSCTASGITFSDYFMNWFRQAQGKECERVSMISMNGADTHY 60 ADSVKGRFTISRDNTKSTLHLQMNNLRPDDTAVYYCAAGALLPSYNHCPPPGAYFGQGTQ 120 VTVSS 125 SEQIDNO:21:Nb122 QVQLQESGGGSVQGGGSLRLSCAVSGYRFSSYAMAWFRQAPGKEREAVAAYYRGFGGAQH 60 STHYAASVTGRFTITQNDALNTGYLQMNNLKPEDTAMYYCALSTADDDDWHSLRRYNYWG 120 QGTQVTVSS 129 SEQIDNO:22:Nb15 QVQLQESGGGSVQAGGSLRLSCATSGYTLRPYCMGWFRQAPGKEREGVATITRSGDRTYY 60 ADAVKGRFTISQDTAKNTVYLQMNNLKSEDAANYYCAASFNYLPTYLTCGSRTAEYNFWG 120 QGTQVTVSS 129 SEQIDNO:23:Nbp77 QVQLQESGGGSVQAGGSLRLSCTTSGYTLRPYCMGWFRQAPGKEREGVATITRSGDRTSY 60 ADAVKGRFTISQDTAKNTVYLQMNNLKSEDAANYYCAASFNYRPTYVTCNSRTAEYNFWG 120 QGTQVTVSS 129 SEQIDNO:24:Nb34 QVQLQESGGGSVQAGGSLRLSCAASGYTYSSYCMGWFRQAPGKEREGVATIDSGSGRTYY 60 ADSVKGRFTISRDNAKDTVYLLMNNLKPEDTAIYYCAAVGANSGGLWSSCGYCYGGLCGD 120 DFGYWGQGTQVTVSS 135 SEQIDNO:25:Nb80 QVQLQESGGGSVQAGGSLRLSCAASGYTYSSYCMGWFRQAPGKEREGVATIDSGSGRTYY 60 ADSVKGRFTISQDNAKNTVYLLMNNLKPEDTAIYYCAAVGANSGGLWSSCGYCYGGLCED 120 DFGYWGQGTQVTVSS 135 SEQIDNO:26:Nb38 QVQLQESGGGSVQAGGSLRLSCAASGYTHSINLMGWFRQAPGKEREGVATIYTVGSSSTY 60 YADSVKGRFTISLDNAKNTVYLRMNSLKPEDTAMYYCAAGVGWLSNSEYNYWGQGTQVTV 120 SS 122 SEQIDNO:27:Nb137 QVQLQESGGGSVQAGGSLKLSCRVYGYIASQCGMGWYRQAPGKGRELVTTISSDGSTTYA 60 DSIKGRFTISRDNVENTLYLQMNNLKPEDTAVYYCAADPLGNSCPGLSYSAQGTQVTVSS 120 SEQIDNO:28:Nb139 QVQLQESGGGSVQAGGSLRLSCAASEYIYSRNCMGWFRQAPGKEREGVAAIYTGSGNTNY 60 ADSVKGRFTIAQDNAKNAVYLQMNSLKPEDTAVYYCAARNSGSWWRPSCNFDSDFGYWGQ 120 GTQVTVSS 128 SEQIDNO:29:Nbp12 QVQLQESGGGSVQAGGSLRLSCKASTYTTNSFCMGWFRQAPGKEREGVAVIQPGRNSKDY 60 ADSVKGRFTISQDNALNTVYLQMNSLKPEDTAMYYCASTGLWISSGSCQTIPDQYSYWGQ 120 GTQVTVSS 128 SEQIDNO:30:TRCPEG MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFK QSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMAL KLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGGGSGGGGLA GRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRITASA DPVYTLSVPHWLIHHKLGTFSCEIDYGELCGHAMWFKSTTFESPRLHFTCLTGNNKELAADWQAVVELYAELEEATSFLGK PTLVFDPGVFNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAPIFYS IVLWVVSEWNGTTMDWNELFKYPGVYVEEDGSFEVKIRSPYHRTPARLLAGQSQRDMSSLNFYAIAGPIAPSGETAQLPIV VQIDEIVRPDLSLPSFEDDYFVWVDFSEFTLDKEEIEIGSRFFDFTSNTCRVSMGENPFAAMIACHGLHSGVLDLKLQWSL NTEFGKSSGSVTITKLVGDKAMGLDGPSHVFAIQKLEGTTELLVGNFAGANPNTRFSLYSRWMAIKLDQAKSIKVLRVLCK PRPGFSFYGRTSFPVDPAFLYKVVRSFGPAMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFK EDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPN EKRDHMVLLEFVTAAGITLGMDELYKTS Theproteinweighs111.52kilodaltons.InboldtheCPofGFLV. SEQIDNO:31:Nb23EGFP QVQLQESGGGSVQVGGSLRVACAASGDTFSGYLAAWFRQAPGKGREGVAAINSKRHTTSYADSVKGRFTISKDNADNIMYL EMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKYWGQGTQVTVSSGGGSGGGMVSKGEELFTGVVPILVELDGDVN GHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQN TPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKTSHHHHHH InboldthesequenceofEGFP.Underlined:Nb23 SEQIDNO:32:Nb23ALP QVQLQESGGGSVQVGGSLRVACAASGDTFSGYLAAWFRQAPGKGREGVAAINSKRHTTSYADSVKGRFTISKDNADNIMYL EMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKYWGQGTQVTVSSGGGSGGGVKQSTIALALLPLLFTPVTKARTP EMPLQTQATSREEPPRLPSKHRPGVKTQATSREEPPRLPSKHRPGVKTQATSREEPPRLPSKHRPGVKTQATSREEPPRLP SKHRPGVKTQATSLEVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGF FKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQ DATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARG YQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNE KGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDG AVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAAHHHHHH InboldthesequenceofALP.Underlined:Nb23 SEQIDNO:33:Nb122:ALP MAQVQLQESGGGSVQGGGSLRLSCAVSGYRFSSYAMAWFRQAPGKEREAVAAYYRGFGGAQHSTHYAASVTGRFTITQNDA LNTGYLQMNNLKPEDTAMYYCALSTADDDDWHSLRRYNYWGQGTQVTVSSGGGSGGGVKQSTIALALLPLLFTPVTKARTP EMPLQTQATSREEPPRLPSKHRPGVKTQATSREEPPRLPSKHRPGVKTQATSREEPPRLPSKHRPGVKTQATSREEPPRLP SKHRPGVKTQATSLEVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGF FKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDTHEKDHPTILEMAKAAGLATGNVSTAELQ DATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARG YQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNE KGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDG AVMVMSYGNSEEDSQEHTGSQLRIApAYGPHAAHHHHHH InboldthesequenceofALP.Underlined:Nb122
REFERENCES
[0253] Busso, D., Delagoutte-Busso, B. and Moras, D. (2005) Construction of a set Gateway-based destination vectors for high-throughput cloning and expression screening in Escherichia coli. Analytical biochemistry 343, 313-321. [0254] Carrillo-Tripp, M., Shepherd, C. M., Borelli, I. a., Venkataraman, S., Lander, G., Natarajan, P., Johnson, J. E., Brooks, C. I. and Reddy, V. S. (2009) VIPERdb2: An enhanced and web API enabled relational database for structural virology. Nucleic Acids Res., 37, 436-442. [0255] Conrath, K. E., Lauwereys, M., Galleni, M., Matagne, A., Frbre, J.-M., Kinne, J., Wyns, L and Muyldermans, S. (2001) O-Lactamase inhibitors derived from single-domain antibody fragments elicited in the camelidae. Antimicrobial agents and chemotherapy 45, 2807-2812. [0256] Habib, I., Smolarek, D., Hattab, C., Grodecka, M., Hassanzadeh-Ghassabeh, G., Muyldermans, S., Sagan, S., Gutidrrez, C., Laperche, S. and Le-Van-Kim, C. (2013) V H H (nanobody) directed against human glycophorin A: A tool for autologous red cell agglutination assays. Analytical biochemistry 438, 82-89. [0257] Ho, S. N., Hunt, H. D., Horton, R. M., Pullen, J. K. and Pease, L R. (1989) Site-directed mutagenesis by overlap extension using the polymerase chain reaction. Gene, 77, 51-59. [0258] Merzlyak, E. M., Goedhart, J., Shcherbo, D., et al. (2007) Bright monomeric red fluorescent protein with an extended fluorescence lifetime. Nat. Methods, 4, 555-557. [0259] Muller, B. H., Lamoure, C., Le Du, M. H., Cattolico, L, Lajeunesse, E., Lemaltre, F., Pearson, A., Ducancel, F., Mdnez, A. and Boulain, J. C. (2001) Improving Escherichia coli alkaline phosphatase efficacy by additional mutations inside and outside the catalytic pocket. Chembiochem 2, 517-523. [0260] Pettersen, E. F., Goddard, T. D., Huang, C. C., Couch, G. S., Greenblatt, D. M., Meng, E. C. and Ferrin, T. E. (2004) UCSF ChimeraA visualization system for exploratory research and analysis. J. Comput. Chem., 25, 1605-1612. [0261] Quacquarelli, a., Gallitelli, D., Savino, V. and Martelli, G. P. (1976) Properties of grapevine fanleaf virus. J. Gen. Virol., 32, 349-360. [0262] Reddy Chichili, V. P., Kumar, V. and Sivaraman, J. (2013) Linkers in the structural biology of protein-protein interactions. Protein Sci., 22, 153-167. [0263] Sainsbury, F., Thuenemann, E. C. and Lomonossoff, G. P. (2009) pEAQ: versatile expression vectors for easy and quick transient expression of heterologous proteins in plants. Plant Biotechnol. J., 7, 682-93. Available at: http://www.ncbi.nlm.nih.gov/pubmed/19627561 [Accessed Mar. 15, 2012]. [0264] Schellenberger, P., Andret-Unk, P., Schmitt-Keichinger, C., et al. (2010) A stretch of 11 amino acids in the betaB-betaC loop of the coat protein of grapevine fanleaf virus is essential for transmission by the nematode Xiphinema index. J. Virol. [0265] Schellenberger, P., Demangeat, G., Lemaire, O., Ritzenthaler, C., Bergdoll, M., Olieric, V., Sauter, C. and Lorber, B. (2011) Strategies for the crystallization of viruses: Using phase diagrams and gels to produce 3D crystals of Grapevine fanleaf virus. J. Struct. Biol., 174, 344-351. [0266] Schellenberger, P., Sauter, C., Lorber, B., et al. (2011) Structural insights into viral determinants of nematode mediated grapevine fanleaf virus transmission. PLoS Pathog., 7. [0267] Schneider, C. a, Rasband, W. S. and Eliceiri, K. W. (2012) NIH Image to ImageJ: 25 years of image analysis. Nat. Methods, 9, 671-675. Available at: http://dx.doi.org/10.1038/nmeth.2089. [0268] Studier, F. W. (2005) Protein production by auto-induction in high-density shaking cultures. Protein expression and purification 41, 207-234. [0269] Thys, B., Schotte, L, Muyldermans, S., Wernery, U., Hassanzadeh-Ghassabeh, G. and Rombaut, B. (2010) In vitro antiviral activity of single domain antibody fragments against poliovirus. Antiviral Research 87, 257-264. [0270] Vigne, E., Gottula, J., Schmitt-Keichinger, C., et al. (2013) A strain-specific segment of the RNA-dependent RNA polymerase of grapevine fanleaf virus determines symptoms in Nicotiana species. J. Gen. Virol., 94, 2803-2813. [0271] Viry, M., Serghini, M. A., Hans, F., et al. (1993) Biologically active transcripts from cloned eDNA of genomic grapevine fanleaf nepovirus RNAs. In Vitro, 4207, 169-174. [0272] Zilian, E. and Maiss, E. (2011) An optimized mRFP-based bimolecular fluorescence complementation system for the detection of protein-protein interactions in planta. J. [0273] Virol. Methods, 174, 158-165. Available at: http://dx.doi.org/10.1016/j.jviromet.2011.03.032.