Inactivated equine influenza virus vaccines
10555998 ยท 2020-02-11
Assignee
Inventors
- Zhisong Qiao (Omaha, NE)
- Catherine M. Peters (Osage, IA)
- Zhuyan Guo (Scotch Plains, NJ)
- Wendy Vaala (Alma, WI)
- Craig BARNETT (Paola, KS, US)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2760/16134
CHEMISTRY; METALLURGY
C12N2760/16122
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to equine influenza virus (EIV) isolates that when administered in vaccines to equine provide protection against currently emerging EIV strains in the U.S. The present invention also relates to inactivated EIV isolates. In addition, the present invention also relates to safe and efficacious vaccines that comprise the EIV isolates, as well as to corresponding subunit vaccines. The present invention further relates to methods of administering such safe and efficacious vaccines to equine.
Claims
1. An isolated equine influenza virus (EIV) isolate comprising a genome that encodes a hemagglutinin protein (HA) comprising an amino acid sequence that comprises 95% or greater identity with the amino acid sequence of SEQ ID NO: 2; wherein the amino acid sequence of the HA: comprises an amino acid residue at position 222 other than that of a tryptophan or an arginine, and either an amino acid residue at position 223 other than that of a valine, or an amino acid residue at position 188 other than that of an asparagine; or comprises an amino acid residue at position 222 other than that of a tryptophan or an arginine, an amino acid residue at position 223 other than that of a valine, and an amino acid residue at position 188 other than that of an asparagine; wherein said EIV has been inactivated through being killed in an unnatural manner.
2. The isolated EIV of claim 1, wherein said HA further comprises: an amino acid residue other than that of an arginine at position 62; or an amino acid residue other than that of an aspartic acid at position 104; or an amino acid residue other than that of an alanine at position 138; or an amino acid residue other than that of a glycine at position 7; or any combination thereof.
3. The isolated EIV of claim 1, wherein the amino acid residue at position 222 is that of a leucine.
4. The isolated EIV of claim 3, wherein the amino acid residue at position 223 is that of an isoleucine, or the amino acid residue at position 188 is that of a threonine; or the amino acid residue at position 223 is that of an isoleucine and the amino acid residue at position 188 is that of a threonine.
5. The isolated EIV of claim 4, wherein the amino acid residue at position 62 is that of a lysine; or the amino acid residue at position 104 is that of an asparagine; or the amino acid residue at position 138 is that of a serine; or the amino acid residue at position 7 is that of an aspartic acid; or any combination thereof.
6. An isolated equine influenza virus (EIV) isolate comprising the identifying characteristics of ATCC accession No. PTA-121715; wherein said EIV has been inactivated through being killed in an unnatural manner.
7. The inactivated EIV of claim 1, wherein the unnatural manner is selected from the group consisting of treatment with a synthetic agent and heating to 60-80 C. for at least 30 to 60 min.
8. The inactivated EIV of claim 7, wherein the synthetic agent is selected from the group consisting of binary ethylamine, formalin, and beta propiolactone.
9. A vaccine comprising one or more inactivated EIV of claim 1 and a pharmaceutically acceptable carrier.
10. The vaccine of claim 9, further comprising an adjuvant.
11. The vaccine of claim 9, that further comprises a clade 2 EIV.
12. The vaccine of claim 11, wherein the clade 2 EIV is selected from the group consisting of an inactivated Equine Influenza Virus/Eq/Richmond/1/2007, an inactivated A/Shropshire/1/10, an inactivated East Renfrewshire/2/11, an inactivated Northamptonshire/1/13, and any combination thereof.
13. The vaccine of claim 11, that is a multivalent vaccine that further comprises an antigen from a pathogen selected from the group consisting of an Equine Herpesvirus, an Equine Rhinitis virus, an Equine Arteritis virus, an Equine Rotavirus, a Neorickettsia risticii (N. risticii), an Equine Rotavirus, a Hendra virus, an Eastern Encephalomyelitis, a Western Encephalomyelitis, a Venezuelan Encephalomyelitis, a Japanese Encephalomyelitis, an Equine Infectious Anemia virus, a Corynebacterium pseudotuberculosis, a Clostridium tetanus, a rabies virus, a West Nile virus, a Rhodococcus equi, a Streptococcus equi, and any combination thereof.
14. A method of immunizing an equine against EIV comprising administering the vaccine of claim 13, to an equine.
15. An isolated or recombinant polypeptide comprising an amino acid sequence that comprises 95% or greater identity with the amino acid sequence of SEQ ID NO: 2; wherein the amino acid sequence of the HA: comprises an amino acid residue at position 222 other than that of a tryptophan or an arginine, and either an amino acid residue at position 223 other than that of a valine, or an amino acid residue at position 188 other than that of an asparagine; or comprises an amino acid residue at position 222 other than that of a tryptophan or an arginine, an amino acid residue at position 223 other than that of a valine, and an amino acid residue at position 188 other than that of an asparagine.
16. An immunogenic composition comprising the isolated or recombinant polypeptide of claim 15, and a pharmaceutically acceptable carrier.
17. A recombinant nucleic acid that encodes the polypeptide of claim 15.
18. A recombinant expression vector that comprises a heterologous sequence encoding the recombinant nucleic acid of claim 17.
19. A vaccine comprising the inactivated EIV of claim 4, and an inactivated Equine Influenza Virus/Eq/Richmond/1/2007.
20. A method of immunizing an equine against EIV comprising administering the vaccine of claim 19 to an equine.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION OF THE INVENTION
(8) Accordingly, the present invention provides equine influenza virus (EIV) isolates (including isolated EIV isolates) that comprise a genome that encodes a hemagglutinin protein (HA) comprising an amino acid sequence that previously had not been identified. Moreover, the present invention provides EIV isolates that have unique combinations of amino acid residue changes within regions of the HA protein that had been recognized by antibodies raised against earlier isolates. The present invention further employs three-dimensional structural modeling to correlate alterations in the amino acid sequence of the HA proteins of the EIV isolates of the present invention with the ability of antibodies raised against earlier isolates to recognize those earlier isolates. The present invention also provides immunogenic compositions (including multivalent immunogenic compositions) and vaccines (particularly safe and efficacious vaccines and multivalent) that can be used to aid in the protection of respiratory disease in horses.
(9) The use of singular terms for convenience in the description is in no way intended to be so limiting. Thus, for example, reference to a virus includes reference to one or more of such viruses, unless otherwise specified. The use of plural terms is also not intended to be limiting, unless otherwise specified.
(10) As used herein, the term, approximately, is used interchangeably with the term about and generally signifies that a value is within twenty-five percent of the indicated value, unless otherwise indicated, e.g., a time of about 60 minutes can be 45 minutes to 75 minutes.
(11) As used herein, a vaccine is a composition that is suitable for application to an animal (e.g., horses) which upon administration to the animal induces an immune response strong enough to minimally aid in the protection from a clinical disease arising from an infection with a wild-type micro-organism, i.e., strong enough for aiding in the prevention of the clinical disease, and/or preventing, ameliorating, or curing the clinical disease. Unless expressly indicated otherwise, the use of the term vaccine includes multivalent vaccines.
(12) As used herein, a multivalent vaccine is a vaccine that comprises two or more different antigens. In a particular embodiment of this type, the multivalent vaccine stimulates the immune system of the recipient against two or more different pathogens.
(13) As used herein, a liquid stable vaccine is a vaccine maintained as a liquid (including a liquid multivalent vaccine) that remains efficacious for at least one year when stored at or below 7 C. (e.g., in a standard refrigerator, and/or at 0 C.-7 C.). In particular embodiments a liquid stable vaccine remains efficacious when stored at or below 7 C. for at least 1.5 years. In more particular embodiments a liquid stable vaccine remains efficacious when stored at or below 7 C. for at least 2 years. In still more particular embodiments a liquid stable vaccine remains efficacious when stored at or below 7 C. for at least 2.5 to 3 years. Examples of liquid stable vaccines are provided in U.S. application Ser. No. 14/202,454 filed on Mar. 10, 2014, and U.S. application Ser. No. 14/202,194 filed on Mar. 10, 2014, the contents of both of which are hereby incorporated by reference in their entireties.
(14) As used herein, the terms protect, protecting, provide protection to, providing protection to, and aids in the protection do not require complete protection from any indication of infection. For example, aids in the protection can mean that the protection is sufficient such that, after challenge, symptoms of the underlying infection are at least reduced, and/or that one or more of the underlying cellular, physiological, or biochemical causes or mechanisms causing the symptoms are reduced and/or eliminated. It is understood that reduced, as used in this context, means relative to the state of the infection, including the molecular state of the infection, not just the physiological state of the infection.
(15) The term prophylactically-effective amount refers to the amount of a composition that when administered to equine significantly reduces the likelihood and/or extent of an infection/infestation due to a given pathogen.
(16) Metaphylaxis is the timely mass medication of an entire group of animals to eliminate or minimize an expected outbreak of disease, e.g. in one or more animals at high risk of infection/infestation. In one particular embodiment, high risk foals are light weight, young horses with unknown health histories.
(17) The term chemoprophylaxis refers to the administration of a medication/treatment, e.g., one or more prophylactic compositions, for the purpose of preventing or reducing viral, bacterial, and/or parasitic infection/infestation; and/or preventing or reducing disease and/or symptoms related to that infection/infestation.
(18) The term prophylactic composition refers to any agent used singularly or in combination with other agents that significantly reduces the likelihood and/or extent of an infection/infestation due to a given pathogen in equine. In one such embodiment the equine are at risk of developing equine respiratory disease.
(19) As used herein the term inactivated as it modifies the term virus, e.g., an inactivated EIV isolate, is used interchangeably with the term killed, e.g., a killed EIV isolate, and is a virus that has lost its ability to replicate due e.g., to an act of man, but still retains the ability of having the immune system recognize it. (Inactivated is often used rather than killed to refer to viral vaccines, as viruses are generally not considered to be alive.)
(20) As used herein the term killed in an unnatural way as it modifies the term virus indicates that the virus has been inactivated in a manner that does not naturally occur in nature. For example, a virus that has been inactivated by heating the virus above 60 C. (e.g., 60-80 C.) for about 30 minutes or more has been killed in an unnatural way because viruses are not naturally found at such high temperatures.
(21) As used herein, the term therapeutically effective amount is an amount of a given antigen, e.g., a killed equine influenza virus, which is sufficient to provide protection to and/or aid in the protection from the pathogen that the antigen is being administered to protect against, when provided in a single administration and/or when intended, provided as an initial administration with one or more subsequent booster administration(s).
(22) As used herein, an efficacious vaccine comprises a therapeutically effective amount of a given antigen. An efficacious vaccine retains sufficient titer for a given antigen to be compliant with the regulatory requirements for that antigen for the jurisdiction where the vaccine is administered, e.g., the administration of a vaccine in the United States is governed by the United States Department of Agriculture (USDA).
(23) As used herein, an immune response refers to the subject animal's active immunity due to having received one or more vaccines. The immune response can include the production of antibodies to the antigen or immunogen present in the vaccine. Immune response in a subject refers to the development of a humoral immune response, a cellular immune response, or a humoral and a cellular immune response to an antigen. Immune responses may be measured using standard immunoassays and neutralization assays, which are known in the art.
(24) As used herein, the term pharmaceutically acceptable is used adjectivally to mean that the modified noun is appropriate for use in a pharmaceutical product. When it is used, for example, to describe an excipient in a pharmaceutical vaccine, it characterizes the excipient as being compatible with the other ingredients of the composition and not disadvantageously deleterious to the intended recipient.
(25) The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Pharmaceutical acceptable carriers can be sterile liquids, such as water and/or oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, cellulose acetate, and the like. Water or aqueous solution saline solutions and aqueous sugar, e.g., dextrose and/or glycerol solutions can be employed as carriers, particularly for injectable solutions. Other pharmaceutical acceptable carriers include iminocarbonates, proteinoid microspheres, polyanhydrides, and the like. In addition, the carrier can be and/or comprise a hydrocolloid and/or polymer solution e.g., to thicken the equine vaccines that are to be sprayed onto the horses, e.g., foals.
(26) As used herein a pharmaceutically acceptable carrier that is not a product of nature is a pharmaceutically acceptable carrier that is not found in nature. Examples of pharmaceutically acceptable carrier that are not a product of nature include man-made polymers.
(27) As used herein, a substance that that is not naturally found in nature or a synthetic component and the like are substances (e.g., chemical compound) which uniquely exist due to an act of man. Of course, all substances that are not naturally found in nature must be derived or originate from substances that are.
(28) As used herein, an adjuvant is a substance that is able to favor or amplify the cascade of immunological events, ultimately leading to a better immunological response, i.e., the integrated bodily response to an antigen. An adjuvant is in general not required for the immunological response to occur, but favors or amplifies this response. In particular embodiments an adjuvant can comprise a one or more synthetic components. Examples of adjuvant components include polylactide-co-glycolides (PLG), and immuonstimulatory complexes (ISCOMS).
(29) A nucleotide sequence is operatively linked to an expression control sequence when the expression control sequence controls or regulates the transcription and translation of that nucleotide sequence. The term operatively linked includes having an appropriate start signal.
(30) Transcriptional and translational control sequences are nucleic acid (e.g., DNA or RNA) regulatory sequences, such as promoters, enhancers, terminators, and the like, that provide for the expression of a coding sequence in a host cell. In eukaryotic cells, polyadenylation signals are control sequences.
(31) A coding sequence is under the control of transcriptional and translational control sequences in a cell when RNA polymerase transcribes the coding sequence into mRNA, which can then be trans-RNA spliced, if, when, and where appropriate, and translated into the protein encoded by the coding sequence.
(32) A heterologous nucleotide sequence as used herein is a nucleotide sequence that is added by recombinant methods to a nucleotide sequence encoding a polypeptide of the present invention or encoding a fragment thereof (i.e., an antigenic fragment), to form a nucleic acid that is not naturally formed in nature. Such nucleic acids can e.g., encode chimeric proteins. In addition, as used herein, a heterologous nucleotide sequence need not be a single contiguous nucleotide sequence, but can include multiple non-contiguous nucleotide sequences that have been combined with a nucleotide sequence encoding a polypeptide of the present invention, or a portion thereof. A heterologous nucleotide sequence can comprise non-coding sequences including restriction sites, regulatory sites, promoters and the like. In still another embodiment the heterologous nucleotide can function as a means of detecting a nucleic acid of the present invention.
(33) As used herein one amino acid sequence is 100% identical to a second amino acid sequence when the amino acid residues of both sequences are identical. Accordingly, an amino acid sequence is 50% identical to a second amino acid sequence when 50% of the amino acid residues of the two amino acid sequences are identical. The sequence comparison is performed over a contiguous block of amino acid residues comprised by a given protein, e.g., a protein, or a portion of the polypeptide being compared. In a particular embodiment, selected deletions or insertions that could otherwise alter the correspondence between the two amino acid sequences are taken into account.
(34) As used herein, nucleotide and amino acid sequence percent identity can be determined using C, MacVector (MacVector, Inc. Cary, N.C. 27519), Vector NTI (Informax, Inc. MD), Oxford Molecular Group PLC (1996) and the Clustal W algorithm with the alignment default parameters, and default parameters for identity. These commercially available programs can also be used to determine sequence similarity using the same or analogous default parameters. Alternatively, an Advanced Blast search under the default filter conditions can be used, e.g., using the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.) pileup program using the default parameters.
(35) As used herein the term antigenic fragment of a HA protein of the present invention is a fragment of the amino acid sequence of SEQ ID NO: 2 (or corresponding recombinant peptide) that is antigenic, and retains between 25 to 500 contiguous amino acid residues of SEQ ID NO: 2 that includes the leucine residue at position 222 and the isoleucine at position 223 of SEQ ID NO: 2. In certain embodiments, the antigenic fragment contains 50 amino acid contiguous residues or more, but fewer than 350 contiguous amino acid residues of the amino acid sequence of SEQ ID NO: 2, but includes the leucine residue at position 222 and the isoleucine at position 223 of SEQ ID NO: 2. In still another embodiment, the antigenic fragment comprises 75 contiguous amino acid residues or more of SEQ ID NO: 2, but fewer than 250 contiguous amino acid residues, but includes the leucine residue at position 222 and the isoleucine at position 223 of SEQ ID NO: 2. In yet another embodiment, the antigenic fragment contains 150 contiguous amino acid residues or more of SEQ ID NO: 2, but fewer than 200 contiguous amino acid residues of SEQ ID NO: 2, but includes the leucine residue at position 222 and the isoleucine at position 223 of SEQ ID NO: 2. In particular embodiments, the antigenic fragment further comprises at least one, two, three, four, or five additional amino acid residues from the following: the threonine residue at position 188, the serine residue at position 138, the asparagine residue at position 104, the lysine residue at position 62, and/or the aspartic acid residue at position 7 of the amino acid sequence of SEQ ID NO: 2.
(36) An antigenic fragment of an HA protein of the present invention can be obtained from a recombinant source, from a protein isolated from natural sources, or through chemical synthesis. Similarly, an antigenic fragment can be obtained following the proteolytic digestion of such HA proteins or fragments thereof. Alternatively, an antigenic fragment of the present invention can be generated by recombinant expression, or alternatively, through peptide synthesis.
(37) As used herein, systemic administration is administration into the circulatory system of the body (comprising the cardiovascular and lymphatic system), thus affecting the body as a whole rather than a specific locus such as the gastro-intestinal tract (via e.g., oral or rectal administration) and the respiratory system (via e.g., intranasal administration). Systemic administration can be performed e.g., by administering into muscle tissue (intramuscular), into the dermis (intradermal, transdermal, or supradermal), underneath the skin (subcutaneous), underneath the mucosa (submucosal), in the veins (intravenous) etc.
(38) Parenteral administration includes subcutaneous injections, submucosal injections, intravenous injections, intramuscular injections, intradermal injections, and infusion.
(39) As used herein intranasal administration of a vaccine to an animal subject or intranasally administering a vaccine to an animal subject refers to applying or administering that vaccine to/through the nose and/or nasal cavity.
(40) Preparation of Killed and/or Attenuated EIV:
(41) Inactivation of an EIV isolate of the present invention can be accomplished by treating the virus with inactivation chemicals [e.g., formalin, formaldehyde, beta propiolactone (BPL), bromoethylamine (BEA), and binary ethylenimine (BEI)] or by non-chemical methods [e.g., heat, freeze/thaw, ultraviolet irradiation, acidic conditions, high voltage electrostatic fields, or sonication] to disable or decrease the replication capacity of the virus. In addition, the EIVs can be inactivated by treatment with certain detergents. Heat inactivation can be performed at 60 C. to 80 C. for about 30 to about 60 minutes. In certain cases the heat inactivation can be carried out for about 1 to about 12 hours.
(42) Alternatively, live attenuated vaccines may be prepared by the conventional means. Conventional means generally include, for example, modifying pathogenic strains by in vitro passaging, cold adaptation, modifying the pathogenicity of the organism by genetic manipulation, preparation of chimeras, insertion of antigens into viral vectors, selecting non-virulent wild type strains, and other methods well known to the skilled artisan.
(43) In certain embodiments, the live attenuated EIV strain is derived by serial passage of the wild-type virus through cell culture. In alternative embodiments, an attenuated strain is derived by serial passage of the wild-type virus through laboratory animals, non-host animals, or eggs. The accumulation of genetic mutation during such passage(s) typically leads to progressive loss of virulence of the organism to the original host.
(44) In particular embodiments, the live attenuated virus strain is prepared by co-infection of permissible cells with an attenuated mutant virus and pathogenic virus. The desired resultant recombinant virus has the safety of the attenuated virus with genes coding for protective antigens from the pathogenic virus.
(45) In other embodiments, the live attenuated virus strain is prepared by cold adaptation. A cold-adapted virus has an advantage of replicating only at the temperature found in upper respiratory tract. A method of generation of a cold-adapted equine influenza virus has been described in U.S. Pat. No. 6,177,082 [hereby incorporated by reference in its entirety]. A desired resulting cold-adapted virus confers one or more of the following phenotypes: cold adaptation, temperature sensitivity, dominant interference, and/or attenuation.
(46) In specific embodiments, the live attenuated virus strain is prepared by recombinant means, such as by homologous recombination, a point mutation, deletion, or insertion to convert a pathogenic virus to a non-pathogenic or less-pathogenic virus compared to the original virus, while preserving the protective properties of the original virus.
(47) Nucleic Acids Encoding the Hemagglutinin Proteins of the Present Invention
(48) A nucleic acid, such as a cDNA, that encodes a HA of the present invention, can be placed into a vector, e.g., a recombinant bacterial host cell, to express a protein and/or antigen of the present invention. Alternatively, the vector can be a recombinant virus (e.g., a canarypox virus) to be used in immunogenic compositions such as vaccines.
(49) In addition, obtaining and/or constructing a DNA that encodes a HA of the present invention, including antigenic fragments thereof, facilitates the production of economically important quantities of the protein or antigenic fragments thereof. The large quantities of the proteins and/or antigenic fragments thereof produced are useful for making certain vaccines of the present invention.
(50) Accordingly, the present invention also provides nucleotide constructs that allow for the expression and isolation of large quantities of the proteins and/or antigens of the present invention, such as the HA. These nucleic acids can further contain heterologous nucleotide sequences. To express a recombinant protein of the present invention in a host cell, an expression vector can be constructed comprising the corresponding cDNA. The present invention therefore, provides expression vectors containing nucleic acids encoding the HAs of the present invention, including variants thereof, and/or antigenic fragments thereof and/or chimeric proteins.
(51) Due to the degeneracy of nucleotide coding sequences, other DNA sequences which encode substantially the same amino acid sequence as a nucleic acid encoding a HA of the present invention may be used in the practice of the present invention. These include, but are not limited to, allelic genes, homologous genes from other strains, and/or those that are altered by the substitution of different codons that encode the same amino acid residue within the sequence, thus producing a silent change. Host cells comprising the expression vectors of the present invention are also provided. One particular host cell is an E. coli cell.
(52) General methods for the cloning of cDNAs and expression of their corresponding recombinant proteins have been described [see Sambrook and Russell, Molecular Cloning, A laboratory Manual, 3.sup.rd edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor L.I. (2000)]. Preferably, all of the nucleic acid constructs of the present invention are sequence confirmed.
(53) In addition, any technique for mutagenesis known in the art can be used to modify a HA of the present invention, including but not limited to, in vitro site-directed mutagenesis [Hutchinson et al., J. Biol. Chem., 253:6551 (1978); Zoller and Smith, DNA, 3:479-488 (1984); Oliphant et al., Gene, 44:177 (1986); Hutchinson et al., Proc. Natl. Acad. Sci. U.S.A., 83:710 (1986); Wang and Malcolm, BioTechniques 26:680-682 (1999) the contents of which are hereby incorporated by reference in their entireties]. The use of TAB@ linkers (Pharmacia), etc. and PCR techniques also can be employed for site directed mutagenesis [see Higuchi, Using PCR to Engineer DNA, in PCR Technology: Principles and Applications for DNA Amplification, H. Erlich, ed., Stockton Press, Chapter 6, pp. 61-70 (1989)].
(54) Recombinant Vectors
(55) The present invention also provides vectors that comprise the nucleic acids and express the proteins of the present invention. Such vectors can contain one or more nucleotide sequences and/or heterologous sequences of the present invention operatively linked to an expression control sequence. In certain embodiments the vector is an animal virus vector. Examples of such vectors include adenoviruses, vaccinia virus, herpesviruses, poxviruses e.g., canarypox virus, paramyxoviruses, rhabdoviruses, and baculoviruses. In other embodiments, the vector is a plasmid or a bacterium such as E. coli or Bordetella bronchiseptica [see, U.S. Pat. No. 8,821,852, the contents of which are hereby incorporated by reference in their entireties]. In another embodiment the recombinant virus is a parainfluenza virus. Any of the recombinant vectors of the present invention can be used in an immunogenic composition and/or a vaccine.
(56) Hemagglutinin of the Present Invention
(57) The present invention provides isolated and/or recombinant HAs, including antigen fragments and chimeric proteins thereof. In addition, HAs containing altered sequences in which functionally equivalent amino acid residues are substituted for those within the amino acid sequence resulting in a conservative amino acid substitution are also provided by the present invention.
(58) Thus, one or more of these amino acid residues within the sequence can possibly be substituted by another amino acid of a similar polarity, which can, but not necessarily, act as a functional equivalent, resulting in a silent alteration. Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs. For example, the nonpolar amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine. The polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine. The positively charged (basic) amino acids include arginine and lysine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
(59) Particularly preferred conserved amino acid exchanges are: (a) Lys for Arg or vice versa such that a positive charge may be maintained; (b) Glu for Asp or vice versa such that a negative charge may be maintained; (c) Ser for Thr or vice versa such that a free OH can be maintained; (d) Gln for Asn or vice versa such that a free NH.sub.2 can be maintained; and (e) Ile for Leu or for Val or vice versa as being roughly equivalent hydrophobic amino acids.
(60) All of the HAs of the present invention, including antigenic fragments thereof, also can be part of a chimeric protein. In a specific embodiment, a chimeric polypeptide is expressed in a prokaryotic cell. Such a chimeric protein can be a fusion protein used to isolate a HA of the present invention, through the use of an affinity column that is specific for a protein fused to the HA, for example. Examples of such fusion proteins include: a glutathione-S-transferase (GST) fusion protein, a maltose-binding protein (MBP) fusion protein, a FLAG-tagged fusion protein, or a poly-histidine-tagged fusion protein. Specific linker sequences such as a Ser-Gly linker can also be part of such a fusion protein.
(61) Indeed, the expression of one or more of the inventive proteins, as a fusion protein, can facilitate stable expression, and/or allow for purification based on the properties of the fusion partner. Thus the purification of the recombinant HAs of the present invention can be simplified through the use of fusion proteins having affinity Tags. For example, GST binds glutathione conjugated to a solid support matrix, MBP binds to a maltose matrix, and poly-histidine chelates to a Ni-chelation support matrix [see Hochuli et al., Biotechnology 6:1321-1325 (1998)].
(62) The fusion protein can be eluted from the specific matrix with appropriate buffers, or by treating with a protease that is specific for a cleavage site that has been genetically engineered in between the HA, for example, and its fusion partner. Alternatively, a HA can be combined with a marker protein such as green fluorescent protein [Waldo et al., Nature Biotech. 17:691-695 (1999); U.S. Pat. No. 5,625,048 and WO 97/26333, the contents of which are hereby incorporated by reference in their entireties].
(63) Alternatively or in addition, other column chromatography steps (e.g., gel filtration, ion exchange, affinity chromatography etc.) can be used to purify the recombinant polypeptides of the present invention (see below). In many cases, such column chromatography steps employ high performance liquid chromatography or analogous methods in place of the more classical gravity-based procedures.
(64) In addition, a HA of the present invention or an antigenic fragment thereof can be chemically synthesized [see e.g., Synthetic Peptides: A User's Guide, W.H. Freeman & Co., New York, N.Y., pp. 382, Grant, ed. (1992)].
(65) Antibodies to the Hemagglutinin Proteins of the Present Invention
(66) The HAs of the present invention, and antigenic fragments thereof, as produced by a recombinant source, or through chemical synthesis, or as isolated from natural sources; and variants, derivatives or analogs thereof, including fusion proteins, may be used as an immunogen to generate antibodies. Such antibodies include but are not limited to polyclonal, monoclonal, chimeric including single chain, Fab fragments, and a Fab expression library. Such antibodies can be used in diagnostic kits or as components in vaccines.
(67) Specific anti-HA antibodies of the invention, for example, may be cross-reactive, that is, they may recognize closely-related HAs obtained from a different source (e.g., a different EIV isolate). Polyclonal antibodies have greater likelihood of cross-reactivity. Alternatively, an antibody of the invention may be specific for a single form of an inventive protein, for example, such as a specific fragment of the HA protein comprising the amino acid sequence of SEQ ID NO: 2, or a closely related variant thereof.
(68) In a particular aspect of the present invention compositions and uses of antibodies that are immunoreactive with only a HA of the present invention are provided. Such antibodies bind specifically to the particular HA respectively, meaning that they bind via antigen-binding sites of the antibody as compared to non-specific binding interactions.
(69) The terms antibody and antibodies are used herein in their broadest sense, and include, without limitation, intact monoclonal and polyclonal antibodies as well as fragments such as Fv, Fab, and F(ab) fragments, single-chain antibodies such as scFv, and various chain combinations. The antibodies may be prepared using a variety of well-known methods including, without limitation, immunization of animals having native or transgenic immune repertoires, phage display, hybridoma and recombinant cell culture.
(70) Both polyclonal and monoclonal antibodies may be prepared by conventional techniques. [See, for example, Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), Plenum Press, New York 37 (1980); and Antibodies: A Laboratory Manual, Harlow and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988)].
(71) Various procedures known in the art may be used for the production of polyclonal antibodies to a particular HA, variants or derivatives or analogs thereof. For the production of an antibody, various host animals can be immunized by injection with the HA, variant or a derivative (e.g., or fusion protein) thereof or fragment thereof, including but not limited to rabbits, mice, rats, sheep, goats, etc. In one embodiment, the inventive protein can be conjugated to an immunogenic carrier, e.g., bovine serum albumin (BSA) or keyhole limpet hemocyanin (KLH). Various adjuvants may be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, aluminum phosphate, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, and dinitrophenol.
(72) For preparation of monoclonal antibodies directed toward a given inventive protein, variant, or analog, or derivative thereof, any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used. These include but are not limited to the hybridoma technique originally developed by Kohler and Milstein [Nature, 256:495-497 (1975)], as well as the trioma technique, and the human B cell hybridoma technique [Kozbor et al., Immunology Today, 4:72 (1983); Cote et al., Proc. Natl. Acad Sci. U.S.A., 80:2026-2030 (1983)].
(73) The monoclonal antibodies of the present invention include chimeric antibodies, versions of antibodies originally produced in mice or other non-human animals. Techniques developed for the production of chimeric antibodies by splicing the genes from a mouse antibody molecule specific for a given inventive protein, for example, together with genes from a equine antibody of appropriate biological activity can be used. Such chimeric antibodies are within the scope of this invention [see in general, Morrison et al., J Bacteriol, 159:870 (1984); Neuberger et al., Nature, 312:604-608 (1984); Takeda et al., Nature, 314:452-454 (1985)].
(74) Vaccines and Multivalent Vaccines
(75) The vaccines of the present invention can comprise any of the EIV isolates of the present invention (live attenuated and/or killed), and/or corresponding isolated and/or recombinant HA proteins, and/or novel antigenic fragments of the HA proteins, and/or recombinant nucleic acids encoding the HA proteins and/or encoding antigenic fragments of the HA proteins (including recombinant vectors, such as recombinant viruses, that comprise and express such nucleic acids), either individually or in any combination.
(76) In addition, any of such EIV antigens can be included in a multivalent vaccine. Such multivalent vaccines can comprise live attenuated or killed antigens of and/or from other equine pathogens including subunit antigens and/or corresponding recombinant vectors that expressing such subunit antigens from other equine pathogens. For example, a multivalent vaccine could include a HA antigen of the present invention along with a recombinant myxoma virus expressing a West Nile virus antigen.
(77) The present invention provides monovalent and multivalent equine vaccines. Non-limiting examples of antigens from other pathogens include one or more (including all) of the following: Clostridium tetanus (Tetanus), rabies virus (Rabies), Neorickettsia risticii (N. risticii), Equine Rotavirus, Equine Rhinitis virus, Equine Arteritis virus, Equine Infectious Anemia virus, Hendra virus, Eastern Encephalomyelitis, Western Encephalomyelitis, Corynebacterium pseudotuberculosis, Equine Herpesvirus, West Nile virus (including a live attenuated or killed yellow fever/west nile virus chimeric flavivirus, see e.g., US2009/0246233, hereby incorporated by reference in its entirety), Japanese Encephalomyelitis, Venezuelan Encephalomyelitis, Rhodococcus equi, and Streptococcus equi. Alternatively, a vaccine based upon material according to the present invention may be administered simultaneously with other inactivated (e.g., killed) or live attenuated vaccines.
(78) Vaccine Administration:
(79) The equine influenza virus vaccines of the present invention may be administered by any conventional means, for example, by systemic administration, including by parenteral administration such as, without limitation, subcutaneous or intramuscular administration. The equine influenza virus vaccines of the present invention also may be administered by mucosal administration, such as by intranasal, oral, intratracheal, rectal, and/or ocular administration. Alternatively, the vaccines may be administered via a skin patch, in a delayed release implant, scarification, or topical administration. It is contemplated that an equine virus vaccine of the present invention also may be administered via the drinking water and/or food of the recipient equine. In a particular embodiment, an equine influenza virus vaccine of the present invention comprises a killed EIV.
(80) The vaccines (including multivalent vaccines) of the present invention also may be administered as part of a combination therapy, i.e., a therapy that includes, in addition to the vaccine itself, administering one or more additional active agents, therapies, etc. In that instance, it should be recognized the amount of vaccine that constitutes a therapeutically effective amount may be more or less than the amount of vaccine that would constitute a therapeutically effective amount if the vaccine were to be administered alone. Other therapies may include those known in the art, such as, e.g., analgesics, fever-reducing medications, expectorants, anti-inflammation medications, antihistamines, and/or administration of fluids.
(81) The immunogenicity level may be determined experimentally by vaccine dose titration and challenge study techniques generally known in the art. Such techniques typically include vaccinating a number of animal subjects with the vaccine at different dosages and then challenging the animal subjects with the virulent virus to determine the minimum protective dose.
(82) Factors affecting the preferred dosage regimen may include, for example, the breed of an equine, age, weight, sex, diet, activity, lung size, and condition of the subject; the route of administration; the efficacy, safety, and duration-of-immunity profiles of the particular vaccine used; whether a delivery system is used; and whether the vaccine is administered as part of a drug and/or vaccine combination. Thus, the dosage actually employed can vary for specific animals, and, therefore, can deviate from the typical dosages set forth above. Determining such dosage adjustments is generally within the skill of those in the art of vaccine development using conventional means.
(83) Similarly, the volume with which such a dose can be administered typically lies between 0.1 mL (typical for intradermal or transdermal application) and 5.0 mL. A typical range for the administration volume is between 0.2 and 2.0 mL. In specific embodiments a range for the administration volume is about 1.0 to 2.0 mL for intramuscular or subcutaneous administration. In alternative specific embodiments a range for the administration volume is about 0.5 to 2.0 for intranasal administration.
(84) It is contemplated that the vaccine may be administered to the vaccine recipient at a single time or alternatively, two or more times over days, weeks, months, or years. In some embodiments, the vaccine is administered at least two times. In certain such embodiments, for example, the vaccine is administered twice, with the second dose (e.g., a booster) being administered at least 2 weeks after the first dose. In particular embodiments, the vaccine is administered twice, with the second dose being administered no longer than 8 weeks after the first dose. In other embodiments, the second dose is administered from 1 week to 2 years after the first dose, from 1.5 weeks to 8 weeks after the first dose, or from 2 to 4 weeks after the first dose. In other embodiments, the second dose is administered about 3 weeks after the first dose. In the above embodiments, the first and subsequent dosages may vary, such as in amount and/or form. Often, however, the dosages are the same in amount and form. When only a single dose is administered, the amount of vaccine in that dose alone generally comprises a therapeutically effective amount of the vaccine. When, however, more than one dose is administered, the amounts of vaccine in those doses together may constitute a therapeutically effective amount. In addition, a vaccine may be initially administered, and then a booster may be administered from 2 to 12 weeks later, as discussed above. However, subsequent administrations of the vaccine may be made on an annual (1-year) or bi-annual (2-year) basis, regardless as to whether a booster was administered or not.
(85) Adjuvants & Immunostimulants
(86) An adjuvant in general is a substance that boosts the immune response of the target in a non-specific manner. Many different adjuvants are known in the art. Non-limiting examples of adjuvants that may be used in the formulation of a vaccine made with material according to the present invention include aluminum salts (e.g., alum, aluminum hydroxide, aluminum phosphate, aluminum oxide), cholesterol, monophosphoryl lipid A adjuvants, amphigen, tocophenols, monophosphenyl lipid A, muramyl dipeptide, oil emulsions, squalane, squalene, glucans, carbomers, block copolymers, Avridine lipid-amine adjuvant, heat-labile enterotoxin from E coli (recombinant or otherwise), cholera toxin, muramyl dipeptide, Freund's Complete and-Incomplete adjuvant, vitamin E, non-ionic block polymers and polyamines such as dextransulphate, CARBOPOL [e.g., polymers of acrylic acid cross-linked with polyalkenyl ethers or divinyl glycol], pyran, saponins and saponin derivatives, block co-polymers, and adjuvants such as those identified in U.S. Pat. Nos. 4,578,269, 4,744,983, 5,254,339, which are all herein fully incorporated by reference. Non-limiting examples of peptides that can serve as adjuvants include muramyldipeptides, dimethylglycine, or tuftsin. Non-limiting examples of oils that can serve as adjuvants include mineral oils, vegetable oils, animal oils and emulsions thereof.
(87) Vaccines made from material according to the present invention may be formulated as oil-in-water emulsions, as water-in-oil emulsions or as water-in-oil-in-water emulsions. Non-limiting examples of oil-in-water emulsions include paraffin oil-in-water emulsions, or emulsions made from one or more of squalene, block copolymers of ethylene oxide and propylene oxide, polysorbate surfactants, and/or threonyl analogs of muramyl dipeptide.
(88) Oils used as adjuvants may be metabolizable by the subject receiving the vaccine such as vegetable or animal oils. Such oils typically consist largely of mixtures of triacylglycerols, also known as triglycerides or neutral fats. These nonpolar, water insoluble substances are fatty acid triesters of glycerol. Triacylglycerols differ according to the identity and placement of their three fatty acid residues.
(89) Adjuvants may also consist of components that cannot be metabolized by the body of the animal subject to which the emulsion is administered. Non-metabolizable oils suitable for use in the emulsions of the present invention include alkanes, alkenes, alkynes, and their corresponding acids and alcohols, the ethers and esters thereof, and mixtures thereof. The individual compounds of the oil may be light hydrocarbon compounds, e.g., compounds having 6 to 30 carbon atoms. The oil may be synthetically prepared or purified from petroleum products. Non-limiting examples of non-metabolizable oils for use in the preparation of vaccines based upon material cultured according to the present invention include mineral oil, paraffin oil, and cycloparaffins, for example. The term mineral oil refers to a non-metabolizable adjuvant oil that is a mixture of liquid hydrocarbons obtained from petrolatum via a distillation technique. The term is synonymous with liquefied paraffin, liquid petrolatum and white mineral oil. The term is also intended to include light mineral oil, i.e., oil which is similarly obtained by distillation of petrolatum, but which has a slightly lower specific gravity than white mineral oil.
(90) Other compounds capable of enhancing a humoral immunity response that may be used in the formulation of vaccines based upon material cultured according to the present invention include, without limitation, ethylene maleic anhydrate (EMA) copolymer, latex emulsions of a copolymer of styrene with a mixture of acrylic acid and methacrylic acid.
(91) In addition to the adjuvant, a vaccine based upon material cultured according to the present invention can include immunomodulatory agents such as, e.g., interleukins, interferons, or other cytokines [e.g., Thl-related cytokines, such as interleukin-12 (IL-12), interleukin-18 (IL-18), or gamma interferon]. The amount of adjuvant or immunostimulant added in a vaccine formulation based upon material cultured according to the present invention depends on the nature of the adjuvant or immunostimulant itself. The skilled artisan is capable of selecting an amount that is sufficient to enhance an immune response to the viral immunizing agent.
(92) Carriers
(93) Pharmaceutically acceptable carriers suitable for use in vaccines comprising material according to the present invention may be any conventional liquid carrier suitable for veterinary pharmaceutical compositions, including balanced salt solutions suitable for use in tissue culture media. Pharmaceutically acceptable carriers are understood to be compounds that do not adversely affect the health of the animal to be vaccinated, at least not to the extent that the adverse effect is worse than the effects seen when the animal is not vaccinated. Suitable carriers also include sterile water, saline, aqueous buffers such as PBS, solvents, diluents, isotonic agents, buffering agents, dextrose, ethanol, mannitol, sorbitol, lactose and glycerol, and the like.
(94) Vehicle
(95) Vaccines formulated from material according to the present invention may also comprise a vehicle. A vehicle is a compound to which the host cells, bacterial cells, or proteins, protein fragments, nucleic acids or parts thereof adhere, without being covalently bound to it. Non-limiting examples of such vehicles include bio-microcapsules, micro-alginates, liposomes, and macrosols. Some materials that serve as adjuvants can also serve as vehicles such as aluminum-hydroxide, aluminum phosphate, aluminum sulphate or aluminum oxide, silica, kaolin, and bentonite, which are all known in the art.
(96) Stabilizers and Preservatives
(97) Often, a vaccine is mixed with stabilizers and/or preservatives, e.g., to protect degradation-prone components from being degraded, to enhance the shelf-life of the vaccine, or to improve freeze-drying efficiency. Non-limiting examples of stabilizers that may be added to vaccine formulations based upon material cultured according to the present invention include SPGA, skimmed milk, gelatins, bovine serum albumin, carbohydrates (e.g., sorbitol, mannitol, trehalose, starch, sucrose, dextran or glucose), proteins (e.g., albumin, casein or degradation products thereof), non-animal origin stabilizers, and buffers (e.g., alkali metal phosphates). Non-limiting examples of preservatives include gentamycin (e.g., gentamycin sulfate), amphotericin, penicillin, streptomycin, EDTA, glycerol, and any combination thereof.
(98) Freeze-Drying/Reconstitution
(99) For reasons of stability or economy, vaccines based upon material cultured according to the present invention may be freeze-dried. In general this will enable prolonged storage at temperatures above 0 C., e.g., at 4 C. Procedures for freeze-drying are known to persons skilled in the art. Equipment for freeze-drying at different scales is available commercially. To reconstitute the freeze-dried vaccine, it may be suspended in a physiologically acceptable diluent. Such diluents may be as simple as sterile water, a physiological salt solution or other carrier as discussed above. In certain embodiments, a vaccine of the present invention can be formed into freeze-dried compositions, such as spheres, e.g., as produced by a method previously described [see e.g., WO 2010/125084; US 2012/0049412 A1, hereby incorporated by reference in their entireties].
Biological Deposit
(100) Cultures of the following biological material have been deposited with the following international depository: American Type Culture Collection (ATCC) 10801 University Boulevard, Manassas, Va. 20110-2209, U.S.A., under conditions that satisfy the requirements of the Budapest Treaty. All restrictions imposed by the depositor on the availability to the public of the deposited material will be irrevocably removed upon granting of a patent.
(101) TABLE-US-00001 Organism Accession No. Date of Deposit Equine Influenza Virus A/Eq/Florida/2013 PTA-121715 Nov. 11, 2014 (EIV FL/13 MSV Lot 9094140M01)
EXAMPLES
Example 1
Isolation and Characterization of Two Novel EIV Isolates
(102) Equine Influenza Virus A/Eq/Florida/2013 Isolate
(103) The Equine Influenza Virus A/Eq/Florida/2013 [or written as FL13; A.Eq.Florida.2013; or EIV FL/13 MSV Lot 9094140M01] isolate originated from a nasal secretion sample collected from a 6 year-old Warmblood gelding. The gelding was documented as having an acute onset of mucopurulent nasal discharge and fever (103.8 F.). The sample was identified by PCR as Equine Influenza Virus (EIV). Multiple horses were affected and all of these horses had been vaccinated with EIV vaccine containing clade I and clade II EIV isolates. Samples from 39 horses were received, 13 of the 39 samples were identified as EIV by PCR.
(104) One particular EIV isolate was passaged twice in eggs to expand. The allantoic fluid from each egg passage tested negative for bacterial contamination using TSA II+5% sheep blood agar plates. The isolate derived from the egg passage 2 was adapted to tissue culture by passaging 3 times using a canine kidney cell line. Two rounds of limiting dilution cloning (4th and 5th pass) were then conducted on the canine kidney cell line for the 3rd pass. The 2nd round limiting dilution clone harvest was used to infect the cells for the 3rd pass. This sixth passage on the canine kidney cell line was frozen down as the Pre-Master Seed.
(105) Nucleotide and Amino Acid Sequence of HA Protein of EIV FL13 Isolates
(106) The EIV virus in the premaster seeds of the FL13 isolates was amplified using established protocols. This allowed the HA gene to be sequenced with the use of existing primers for the HA gene. The nucleotide sequence (positive sense strain) of HA of FL13 is listed as SEQ ID NO: 3 (SEQ ID NO: 1 for the nucleotide sequence encoding only the mature HA). The deduced protein sequence (including the 15 amino acid signal peptide at N-terminus) for the HA protein of FL13 isolates is listed as SEQ ID NO: 4 (SEQ ID NO: 2 for the amino acid sequence of the mature HA).
(107) Currently, the OIE panel for vaccine strain updates recommends that the EIV A/Ohio/2003-like isolate be employed as the representative clade 1 strain. The EIV A/Ohio/2003 (or written as OH03) isolate is a representative strain from the EIV outbreak in 2003 and as of 2013, is not included in any of the EIV vaccines presently available on the market.
(108) All seven of these amino acid residue changes of FL13 appear to be unique, though changes in some amino acid residues (7, 62, 104, 138, 188 and 222) had been noted in some EIV isolates from 2003 to 2012 [Lewis et al., J. of Virol. 85:12742-12749 (2011); Woodward et al., Veterinary Microbiology 169:113-127 (2014)]. However, to our knowledge, none of the published EIV sequences carry amino acid changes at position 222 together with either or both position 188 and position 223 in HA region of the amino acid sequence of SEQ ID NO: 2, as the EIV isolate, FL13, as identified herein.
(109) Potential Structural and Functional Changes:
(110) The influenza virus HA amino acid sequence is highly conserved in each subtype among all species. For human influenza virus subtype H3, multiple neutralizing antibodies (nAbs) targeting the HA protein have been identified and characterized. The epitopes of several neutralizing antibodies against HA have been extensively characterized by three-dimensional structural analysis of the HA protein-antibody complex. Table 2 lists the location of the amino acid residues of the epitopes for three representative neutralizing antibodies, BH151, HC45 and HC63 [Fleury et al., Nature Structure Biology, 6:530-534 (1999); Fleury et al., Proteins: Structure, Function and Genetics, 40:572-578 (2000); Barbey-Martin et al., Virology 294:70-74 (2002)] for human influenza virus subtype H3. The FL13 EIV isolates are also a subtype H3 influenza virus. One amino acid residue change K.sub.62 in the FL13 EIV isolate is located in the epitopes of the neutralizing antibodies BH151 and HC45. Another amino acid residue change T.sub.188 in the FL13 EIV isolate is located in the epitope of the neutralizing antibody HC63. In an EIV outbreak of 2003, two amino acid residues located at positions 78 and 159 in the HA protein had been shown to be responsible for the major EIV antigenic shift in 2003 [Lewis et al., J. of Virol. 85:12742-12749 (2011)]. Interestingly, the amino acid residues at position 78 is located in the epitope of both neutralizing antibody BH151 and HC45, and the amino acid residue at 159 is located in the epitope of neutralizing antibody HC63. These findings indicate that the epitopes of neutralizing antibodies BH151, HC45 and HC63 might be a hot spot for virus antigenic shift that evades the host immune response to EIV. Amino acid residue changes at positions 62 and 188 in FL13 isolates might contribute to the virus breakthrough of the vaccine by escaping the neutralizing antibodies generated by the vaccine strain.
(111) The receptor binding site (RBS) is highly conserved in HA proteins among all clade I subtype H3 influenza viruses across different species. It is well documented that the following residues are involved in the receptor binding, including amino acid residues at positions 98, 135, 136, 137, 153, 183, 190, and 194 [Skehle and Wiley, Annu Rev Biochem, 2000, 69:531-569].
(112) TABLE-US-00002 TABLE 1 Amino Acid Changes in the HA Protein of EIV FL13 Isolates From To Location on the HA Trimer Structure and Potential AA (OH03) (FL13) Functional and Structual Changes 7 Gly Asp Located at the N-terminus of the HA protein. 20 Val Ala N/A 62 Arg Lys K.sub.62 is located in the epitope of the nAbs BH151 and HC45. The R.sub.62 to K.sub.62 change may abolish or reduce the BH151 and HC45-like nAb binding to this region of the HA trimer. 104 Asp Asn N.sub.104 is located in the inner core of the HA trimer. The D.sub.104 to N.sub.104 change may rearrange the structure of HA timer and affect the exposure for some nAbs. 138 Ala Ser S.sub.138 is proximal to RBS. An A.sub.138 to S.sub.138 change may abolish or reduce the binding of an nAb targeting to this region. 188 Asn Thr T.sub.188 is located in the epitope of nAb HC63. The N.sub.188 to T.sub.188 change may abolish or reduce the HC63-like nAb binding to this region of the HA trimer. 222 Trp Leu L.sub.222 and R.sub.222 are on the surface of the HA protein. In combination with 188 and 223, these amino acid changes might result in the structural change of HA trimeric structure, and thereby, interfere with a neutralizing antibody binding to this region. 223 Val Ile I.sub.223 is located on the surface of the HA protein. In combination with 188 and 222, the amino acid changes might result in the structural change of the HA trimeric structure. 311 Gln Arg N/A *The changes at amino acid residues 20 and 311 were considered unimportant and therefore, were not further analyzed (N/A).
Example 2
Structure Modeling of Ha Protein of FL13 Isolate
(113) Homology Model Building
(114) The crystal structure of the HA protein from human influenza virus H3N2 (PDB 2HMG) was used as a template for the homology model building of the HA protein of EIV FL13. The overall sequence homology of the two proteins is 85%. The crystal structure contains three identical HA monomers, each consists of HA1 and HA2 subunits. HA2 is a long helical chain anchored in the membrane, and HA1 is a large globular domain. The MOE molecular modeling software [Chemical Computing Group, Montreal, Canada] was used in this study.
(115) The Effect of Mutations:
(116) The amino acid changes (amino acid residues positions: 7, 62, 104, 138, 188, 222 and 223) discussed in the previous section were mapped onto the structural model of the HA protein of FL13 (
(117) R62K Mutation:
(118) Based on the structural model, R62K is located at the center of the HC45 epitope (
(119) N188T Mutation:
(120) As shown in
(121) A138S and (W222L+V223I) Mutations:
(122) The A138S and (W222L+V223I) mutations occur around the RBS region. As shown in
(123) TABLE-US-00003 TABLE 2 EPITOPES OF NEUTRALIZING ANTIBODIES (nAbs) TO HA PDB code for Neutralizing Amino acid 3D structure of Antibody Location in the nAb and HA (nAb) Epitope of nAb complex Reference BH151.sup.# 60, 62, 63, 75, 78, 1EO8 Fleury et al., Proteins: 79, 90, 271 Structure, Function and Genetics, 40:572-578 (2000) HC45.sup.# 60, 62, 63, 75, 78, 1QFU Fleury et al., 79, 90, 271 Nature Structure Biology, 6:530-534 (1999) HC63 136, 137, 153, 1KEN Barbey-Martin et al., 158, 159, 186-194 Virology, 294:70-74 (2002) .sup.#Neutralizing antibodies BH151 and HC45 overlap with each other, and possess the same epitope.
(124) TABLE-US-00004 SEQUENCE LISTING TABLE FOR HA SEQ ID NO: Strain Form NA AA 1 FL13 Mature 2 FL13 Mature 3 FL13 Uncleaved 4 FL13 Uncleaved 5 Ohio 03 Mature 6 Ohio 03 Mature 7 Ohio 03 Uncleaved 8 Ohio 03 Uncleaved
The Nucleotide Sequence that Encodes the HA Protein of FL13 EIV Isolate (SEQ ID NO: 3):
The nucleotide sequence that encodes the mature HA protein begins at position 46 (SEQ ID NO: 1). The nucleic acid sequence (1-45) encoding the signal peptide is in bold and underlined. The nucleotide sequence provided does not include the coding region for the last seventeen C-terminal amino acid residues of the HA protein. These seventeen amino acid residues are part of a highly conserved C-terminal cytoplasmic tail which enters the host cytoplasm. Accordingly, this portion of the HA protein is not available as an antigenic target for an infected host cell.
(125) TABLE-US-00005 ATGAAGACAACCATTATTTTGATACTACTGACCCATTGGG CTTACAGTCAAAACCCAATCAGTGACAACAACACAGCCAC ATTGTGTCTAGGACACCATGCAGCAGCAAATGGAACATTG GTAAAAACAATAAGTGATGATCAAATTGAGGTGACAAATG CTACAGAATTAGTTCAGAGCATTTCAATGGGGAAAATATG CAACAATTCATATAGAATTCTAGATGGAAAGAATTGCACA TTAATAGATGCAATGCTAGGAGACCCCCACTGTGACGCCT TTCAGTATGAGAATTGGGACCTCTTTATAGAAAGAAGCAG CGCCTTCAGCAATTGCTACCCATATGACATCCCTAACTAT GCATCGCTCCGATCCATTGTAGCATCCTCAGGAACATTGG AATTCACAGCAGAGGGATTCACATGGACAGGTGTCACTCA AAACGGAAGAAGTGGATCCTGCAAAAGGGGATCAGCCGAT AGTTTCTTTAGCCGACTGAATTGGCTAACAAAATCCGGAA GCTCTTACCCCACATTGAATGTGACAATGCCTAACAATAA AAATTTCGACAAGCTATACATCTGGGGGATCCATCACCCG AGCTCAACTCAAGAGCAGACAAAATTGTACATCCAAGAAT CAGGGCGAGTAACAGTCTCAACAAAAAGAAGTCAACAAAC AATAATCCCTAACATCGGGTCTAGACCATTGATCAGAGGT CAATCAGGTAGGATAAGCATATACTGGACCATTGTAAAAC CTGGAGATATCCTAATGATAAACAGTAATGGCAACTTAGT TGCACCGAGGGGATATTTTAAATTGAAAACAGGGAAAAGC TCTGTAATGAGATCAGATGTACCCATAGACATTTGTGTGT CTGAATGTATTACACCAAATGGAAGCATCTCCAACGACAA GCCATTCCAAAATGTGAACAAAGTTACATATGGAAAATGT CCCAAGTATATCAGACGAAACACTTTAAAGCTGGCCACTG GGATGAGGAATGTACCAGAAAAGCAAATCAGAGGAATCTT TGGGGCAATAGCGGGATTCATCGAAAACGGCTGGGAAGGA ATGGTTGATGGATGGTATGGGTTCCGATACCAAAACTCTG AAGGAACAGGGCAAGCTGCAGATCTAAAGAGCACTCAAGC AGCCATCGACCAGATCAATGGAAAGTTAAACAGAGTGATT GAAAGAACCAATGAGAAATTCCATCAAATAGAGAAGGAAT TCTCAGAAGTAGAAGGAAGAATTCAGGACTTGGAGAAATA TGTAGAAGACACCAAAATAGACCTATGGTCCTACAATGCA GAATTGCTGGTGGCTCTAGAAAATCAACATACAATTGACT TAACAGATGCAGAAATGAACAAATTATTTGAGAAGACTAG ACGCCAGTTAAGAGAAAACGCAGAAGACATGGGAGGTGGA TGTTTCAAGATTTACCACAAATGTGATAATGCATGCATTG GATCAATAAGAAATGGGACATATGACCATTACATATACAG AGATGAAGCATTAAACAACCGATTTCAGATCAAAGGTGTA GAGTTGAAATCAGGCTACAAAGATTGGATACTGTGGATTT CATTCGCCATATCATGCTTCTTAATTTGCGTTGTTCTATT GGGTTT
The Amino Acid Sequence of the HA Protein of FL13 EIV Isolate (SEQ ID NO: 4):
The mature HA protein begins at position 16 (SEQ ID NO: 2); the signal peptide at the N-terminal (residue 1-15) is highlighted by bold font with underline, this signal peptide will be cleaved from the mature HA protein. The amino acid sequence provided does not include the last seventeen C-terminal amino acid residues of the HA protein. These seventeen amino acid residues are part of a highly conserved C-terminal cytoplasmic tail which enters the host cytoplasm. Accordingly, this portion of the HA protein is not available as an antigenic target for an infected host cell.
(126) TABLE-US-00006 MKTTIILILLTHWAYSQNPISDNNTATLCLGHHAAANGTL VKTISDDQIEVTNATELVQSISMGKICNNSYRILDGKNCT LIDAMLGDPHCDAFQYENWDLFIERSSAFSNCYPYDIPNY ASLRSIVASSGTLEFTAEGFTWTGVTQNGRSGSCKRGSAD SFFSRLNWLTKSGSSYPTLNVTMPNNKNFDKLYIWGIHHP SSTQEQTKLYIQESGRVTVSTKRSQQTIIPNIGSRPLIRG QSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKLKTGKS SVMRSDVPIDICVSECITPNGSISNDKPFQNVNKVTYGKC PKYIRRNTLKLATGMRNVPEKQIRGIFGAIAGFIENGWEG MVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVI ERTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNA ELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGG CFKIYHKCDNACIGSIRNGTYDHYIYRDEALNNRFQIKGV ELKSGYKDWILWISFAISCFLICVVLLG
The Nucleotide Sequence that Encodes the HA Protein of the OH03 EIV Isolate (SEQ ID NO: 7):
The nucleotide sequence that encodes the mature HA protein begins at position 46 (SEQ ID NO: 5). The nucleotide sequence (1-45) encoding the signal peptide is in bold and underlined.
(127) TABLE-US-00007 ATGAAGACAA CCATTATTTT GATACTACTG ACCCATTGGG CTTACAGTCAAAACCCAATCAGTGGCAACAACACAGCCAC ATTGTGTCTGGGACACCATGCAGTAGCAAATGGAACATTG GTAAAAACAATAAGTGATGATCAAATTGAGGTGACAAATG CTACAGAATTAGTTCAGAGCATTTCAATGGGGAAAATATG CAACAACTCATATAGAATTCTAGATGGAAGAAATTGCACA TTAATAGATGCAATGCTAGGAGACCCCCACTGTGACGCCT TTCAGTATGAGAATTGGGACCTCTTTATAGAAAGAAGCAG CGCTTTCAGCAATTGCTACCCATATGACATCCCTGACTAT GCATCGCTCCGATCCATTGTAGCATCCTCAGGAACATTGG AATTCACAGCAGAGGGATTCACATGGACAGGTGTCACTCA AAACGGAAGAAGTGGAGCCTGCAAAAGGGGATCAGCCGAT AGTTTCTTTAGCCGACTGAATTGGCTAACAAAATCTGGAA GCTCTTACCCCACATTGAATGTGACAATGCCTAACAATAA AAATTTCGACAAGCTATACATCTGGGGGATTCATCACCCG AGCTCAAATCAAGAGCAGACAAAATTGTACATCCAAGAAT CAGGACGAGTAACAGTCTCAACAAAAAGAAGTCAACAAAC AATAATCCCTAACATCGGATCTAGACCGTGGGTCAGAGGT CAATCAGGCAGGATAAGCATATACTGGACCATTGTAAAAC CTGGAGATATCCTAATGATAAACAGTAATGGCAACTTAGT TGCACCGCGGGGATATTTTAAATTGAAAACAGGGAAAAGC TCTGTAATGAGATCAGATGTACCCATAGACATTTGTGTGT CTGAATGTATTACACCAAATGGAAGCATCTCCAACGACAA GCCATTCCAAAATGTGAACAAAGTTACATATGGAAAATGC CCCAAGTATATCAGGCAAAACACTTTAAAACTGGCCACTG GGATGAGGAATGTACCAGAAAAGCAAATCAGAGGAATCTT TGGAGCAATAGCGGGATTCATCGAAAACGGCTGGGAAGGA ATGGTTGATGGGTGGTATGGGTTCCGATATCAAAACTCTG AAGGAACAGGGCAAGCTGCAGATCTAAAGAGCACTCAAGC AGCCATCGACCAGATTAATGGAAAGTTAAACAGAGTGATC GAAAGAACCAATGAGAAATTCCATCAAATAGAGAAGGAAT TCTCAGAAGTAGAAGGAAGAATTCAGGACTTGGAGAAATA TGTAGAAGACACCAAAATAGACCTATGGTCCTACAATGCA GAATTGCTGGTGGCTCTGGAAAATCAACATACAATTGACT TAACAGATGCAGAAATGAATAAATTATTTGAGAAGACTAG ACGCCAGTTAAGAGAAAACGCAGAAGACATGGGAGGTGGA TGTTTCAAGATTTACCACAAATGTGATAATGCATGCATTG GATCAATAAGAAATGGGACATATGACCATTACATATACAG AGATGAAGCATTAAACAACCGATTTCAGATCAAAGGTGTA GAGTTGAAATCAGGCTACAAAGATTGGATACTGTGGATTT CATTCGCCATATCATGCTTCTTAATTTGCGTTGTTCTATT GGGTTTCATTATGTGGGCTTGCCAAAAAGGCAACATCAGA TGCAACATTTGCATT
The Amino Acid Sequence of the HA Protein of the OH03 EIV Isolate (SEQ ID NO: 8):
The mature HA protein begins at position 16 (SEQ ID NO: 6); the signal peptide at the N-terminal (residue 1-15) is highlighted by bold font with underline. This signal peptide will be cleaved from the mature HA protein.
(128) TABLE-US-00008 MKTTIILILLTHWAYSQNPISGNNTATLCLGHHAVANGTL VKTISDDQIEVTNATELVQSISMGKICNNSYRILDGRNCT LIDAMLGDPHCDAFQYENWDLFIERSSAFSNCYPYDIPDY ASLRSIVASSGTLEFTAEGFTWTGVTQNGRSGACKRGSAD SFFSRLNWLTKSGSSYPTLNVTMPNNKNFDKLYIWGIHHP SSNQEQTKLYIQESGRVTVSTKRSQQTIIPNIGSRPWVRG QSGRISIYWTIVKPGDILMINSNGNLVAPRGYFKLKTGKS SVMRSDVPIDICVSECITPNGSISNDKPFQNVNKVTYGKC PKYIRQNTLKLATGMRNVPEKQIRGIFGAIAGFIENGWEG MVDGWYGFRYQNSEGTGQAADLKSTQAAIDQINGKLNRVI ERTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNA ELLVALENQHTIDLTDAEMNKLFEKTRRQLRENAEDMGGG CFKIYHKCDNACIGSIRNGTYDHYIYRDEALNNRFQIKGV ELKSGYKDWILWISFAISCFLICVVLLGFIMWACQKGNIR CNICI
(129) The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
(130) It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description.