Yeast host cells and methods for producing fatty alcohols
10557152 ยท 2020-02-11
Assignee
Inventors
Cpc classification
Y02E50/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12Y102/01084
CHEMISTRY; METALLURGY
C12N9/1029
CHEMISTRY; METALLURGY
C12Y203/0102
CHEMISTRY; METALLURGY
C12N9/0008
CHEMISTRY; METALLURGY
International classification
C12N9/00
CHEMISTRY; METALLURGY
Abstract
The present invention provides for a genetically modified yeast cell comprising at least six or more of the following modifications: increased expression of Mus musculus fatty acid reductase, acetyl-CoA carboxylase, fatty acid synthase 1, fatty acid synthase 2, a mutant of the bottleneck enzyme encoded by ACC1 insensitive to post-transcriptional and post-translational repression, and/or a desaturase encoded by OLE1, and reduced expression of DGA1, HFD1, ADH6, and/or GDH1. The present invention provides a method for constructing the genetically modified yeast cell, and a method for producing a fatty alcohol from the genetically modified yeast cell.
Claims
1. A genetically modified yeast cell comprising the following modifications: (a) an increased expression of Mus musculus fatty acid reductase (FAR) (MmFAR1); (b) an increased expression of acetyl-CoA carboxylase (ACC1); (c) an increased expression of fatty acid synthase 1 (FAS1);(d) an increased expression of fatty acid synthase 2 (FAS2); (e) a reduced expression of or deleted for diacylglycerol O-acyltransferase (DGA1); (f) a reduced expression of or deleted for homolog of fatty acid aldehyde (HFD1); (g) a reduced expression of or deleted for alcohol dehydrogenase (ADH6); (h) an increased expression of a Saccharomyces cerevisiae ACC1 comprising the mutations S659A and S1157A; (i) a reduced expression of or deleted for glutamate dehydrogenase (GDH1); and (j) an increased expression of a delta(9) fatty acid desaturase encoded by OLE1; wherein the genetically modified yeast cell is capable of producing at least 1.0 g of fatty alcohol per liter of medium.
2. A method of constructing a genetically modified yeast cell comprising the following steps: (a) introducing a first nucleic acid encoding Mus musculus fatty acid reductase (FAR) (MmFAR1), operatively linked to a promoter capable of expressing the MmFAR1 gene product in the yeast cell; (b) introducing a second nucleic acid encoding an acetyl-CoA carboxylase (ACC1), operatively linked to a promoter capable of expressing the ACC1 gene product in the yeast cell, or replacing the native promoter of ACC1 with a promoter with a higher transcription activity; (c) introducing a third nucleic acid encoding FAS1, operatively linked to a promoter capable of expressing the FAS1 gene product in the yeast cell, or replacing the native promoter of FAS1 with a promoter with a higher transcription activity; (d) introducing a fourth nucleic acid encoding FAS2 operatively linked to a promoter capable of expressing the FAS2 gene product in the yeast cell, or replacing the native promoter of FAS2 with a promoter with a higher transcription activity; (e) removing all or a portion of a diacylglycerol O-acyltransferase (DGA1) gene, or introducing a nucleic acid into the yeast cell targeting the DGA1 gene or its gene product, wherein the yeast cell has a reduced amount of activity of the DGA1 gene product; (f) removing all or a portion of a homolog of fatty acid aldehyde (HFD1) gene, or introducing a nucleic acid into the yeast cell targeting the HFD1 gene or its gene product, wherein the yeast cell has a reduced amount of activity of the HFD1 gene product; (g) removing all or a portion of an alcohol dehydrogenase (ADH6) gene, or introducing a nucleic acid into the yeast cell targeting the ADH6 gene or its gene product, wherein the yeast cell has a reduced amount of activity of the ADH6 gene product; (h) introducing a fifth nucleic acid encoding a Saccharomyces cerevisiae ACC1 comprising the mutations S659A and S1157A, operatively linked to a promoter capable of expressing the mutant ACC1 gene product in the yeast cell; (i) removing all or a portion of a glutamate dehydrogenase (GDH1) gene, or introducing a nucleic acid into the yeast cell targeting the GDH1 gene or its gene product, wherein the yeast cell has a reduced amount of activity of the GDH1 gene product; and (j) introducing a sixth nucleic acid encoding a delta(9) fatty acid saturase (OLE1), operatively linked to a promoter capable of expressing the OLE1 gene product in the yeast cell; wherein the genetically modified yeast cell is capable of producing at least 1.0 g of fatty alcohol per liter of medium.
3. A method of producing a fatty alcohol from a genetically modified yeast cell comprising: (a) providing a genetically modified yeast cell of claim 1, and (b) growing or culturing the genetically modified yeast cell in a medium such that the genetically modified yeast cell produces one or more fatty alcohols, or a mixture thereof.
4. The genetically modified yeast cell of claim 1, wherein the genetically modified yeast cell is a Saccharomyces cell.
5. The genetically modified yeast cell of claim 4, wherein the Saccharomyces cell is a Saccharomyces cerevisiae cell.
6. The method of claim 2, wherein the promoter with a higher transcription activity of step (b) is promoter TEF1, the promoter with a higher transcription activity of step (c) is promoter TEF1, and the promoter with a higher transcription activity of step (d) is promoter TEF1.
7. The method of claim 2, wherein the genetically modified yeast cell is a Saccharomyces cell.
8. The method of claim 2, wherein the Saccharomyces cell is a Saccharomyces cerevisiae cell.
9. The method of claim 3, wherein the growing or culturing step is growing or culturing in a continuous culture, which produces a yield of at least 1.0 g of fatty acid alcohol in a liter of the medium.
10. The method of claim 9, wherein the growing or culturing step is growing or culturing in a continuous culture, which produces a yield of at least 6.0 g of fatty acid alcohol in a liter of the medium.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DETAILED DESCRIPTION OF THE INVENTION
(15) Before the invention is described in detail, it is to be understood that, unless otherwise indicated, this invention is not limited to particular sequences, expression vectors, enzymes, yeast microorganisms, or processes, as such may vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting.
(16) As used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to an expression vector includes a single expression vector as well as a plurality of expression vectors, either the same (e.g., the same operon) or different; reference to cell includes a single cell as well as a plurality of cells; and the like.
(17) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
(18) In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings:
(19) The terms optional or optionally as used herein mean that the subsequently described feature or structure may or may not be present, or that the subsequently described event or circumstance may or may not occur, and that the description includes instances where a particular feature or structure is present and instances where the feature or structure is absent, or instances where the event or circumstance occurs and instances where it does not.
(20) The term about refers to a value including 10% more than the stated value and 10% less than the stated value.
(21) The following abbreviations are used herein: Ac-CoA Acetyl-Coenzyme A, cytoplasmic AcaI Acetaldehyde ACC1 Acetyl-CoA carboxylase (overexpressed) ACC1** ACC1 with two mutations abolishing post-translational phosphorylation inhibition Ace Acetate ADH1 Alcohol dehydrogenase (ethanol-forming, NAD-dependent) ADH6 Medium chain alcohol dehydrogenase ALD6 Aldehyde dehydrogenase (cystolic, NADP+-dependnet) ARE1 Acyl-CoA:sterol acyltransferase ARE2 Acyl-CoA:sterol acyltransferase BcGapN B. cereus Glyceraldehyde-3-phosphate dehydrogenase (Non-phosphorylating, NADP-dependent) DGA1 Diacylglycerol acyltransferase FA-CoA Fatty acyl-CoA FAL Fatty aldehyde FAR Fatty acid reductase (Fatty acyl-CoA reductase, NADPH-dependent) FAS 1 Fatty acid synthase (subunit beta) FAS2 Fatty acid synthase (subunit alpha) FFA Free fatty acid G3P Glyceraldehyde 3-phosphate G6P Glucose 6-phosphate GDH1 Glutamate dehydrogenase (NADPH-dependent) GFP A. victoria Green fluorescent protein HFA1 cvt Mitochondrial acetyl-CoA carboxylase with mitochondrial targeting signal deleted HFD1 Fatty aldehyde dehydrogenase INO2 Transcription factor, derepression of phospholipid biosynthetic genes KlGapDH K. lactis Glyceraldehyde-3-phosphate dehydrogenase (NADP-dependent) LRO1 Diacylglycerol acyltransferase Mal-CoA Malonyl-CoA MBP E. coli maltose-binding protein NADH Nicotinamide adenine dinucleotide (reduced form) NADPH Nicotinamide adenine dinucleotide phosphate (reduced form) OLE1 Delta(9) fatty acid desaturase OL11 Transcription factor, negative regulation of phospholipid biosynthetic genes PGI1 Phosphoglucose isomerase PDX1 Fatty-acid coenzyme A oxidase PXA1 Peroxisomal fatty acyl-CoA importer (with PXA2) Pvr Pyruvate RPD3 Histone deacetylase SE Steryl esters TAG Triacylglycerides TCA Tricarboxylic acid cycle TDH3 Glyceraldehyde-3-phosphate dehydrogenase (NAD-dependent) ZWF1 Glucose-6-phosphate dehydrogenase (NADP-dependent)
(22) The term heterologous DNA as used herein refers to a polymer of nucleic acids wherein at least one of the following is true: (a) the sequence of nucleic acids is foreign to (i.e., not naturally found in) a given yeast microorganism; (b) the sequence may be naturally found in a given yeast microorganism, but in an unnatural (e.g., greater than expected) amount; or (c) the sequence of nucleic acids comprises two or more subsequences that are not found in the same relationship to each other in nature. For example, regarding instance (c), a heterologous nucleic acid sequence that is recombinantly produced will have two or more sequences from unrelated genes arranged to make a new functional nucleic acid. Specifically, the present invention describes the introduction of an expression vector into a yeast microorganism, wherein the expression vector contains a nucleic acid sequence coding for an enzyme that is not normally found in a yeast microorganism. With reference to the yeast microorganism's genome, then, the nucleic acid sequence that codes for the enzyme is heterologous.
(23) The terms expression vector or vector refer to a compound and/or composition that transduces, transforms, or infects a yeast microorganism, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An expression vector contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the yeast microorganism. Optionally, the expression vector also comprises materials to aid in achieving entry of the nucleic acid into the yeast microorganism, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present invention include those into which a nucleic acid sequence can be inserted, along with any preferred or required operational elements. Further, the expression vector must be one that can be transferred into a yeast microorganism and replicated therein. Preferred expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements preferred or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known to those of ordinary skill in the art.
(24) The term transduce as used herein refers to the transfer of a sequence of nucleic acids into a yeast microorganism or cell. Only when the sequence of nucleic acids becomes stably replicated by the cell does the yeast microorganism or cell become transformed. As will be appreciated by those of ordinary skill in the art, transformation may take place either by incorporation of the sequence of nucleic acids into the cellular genome, i.e., chromosomal integration, or by extrachromosomal integration. In contrast, an expression vector, e.g., a virus, is infective when it transduces a yeast microorganism, replicates, and (without the benefit of any complementary virus or vector) spreads progeny expression vectors, e.g., viruses, of the same type as the original transducing expression vector to other microorganisms, wherein the progeny expression vectors possess the same ability to reproduce.
(25) The terms isolated or biologically pure refer to material that is substantially or essentially free of components that normally accompany it in its native state or free of components from a yeast cell or culture medium from which the material is obtained.
(26) The term operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
(27) The term functional fragment refers to an enzyme that has an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95% or 99% identical to the amino acid sequence of any one of the enzymes described in this specification or in an incorporated reference. The functional fragment retains amino acids residues that are recognized as conserved for the enzyme. The functional fragment may have non-conserved amino acid residues replaced or found to be of a different amino acid, or amino acid(s) inserted or deleted, but which does not affect or has insignificant effect on the enzymatic activity of the functional fragment. The functional fragment has an enzymatic activity that is identical or essentially identical to the enzymatic activity any one of the enzymes described in this specification or in an incorporated reference. The functional fragment may be found in nature or be an engineered mutant thereof. The mutant may have one or more amino acids substituted, deleted or inserted, or a combination thereof, as compared to the enzyme described in this specification or in an incorporated reference.
(28) The amino acid sequence of Mus musculus fatty acid reductase (FAR) is as follows:
(29) TABLE-US-00001 (SEQIDNO:1) 10203040 MVSIPEYYEGKNILLTGATGFLGKVLLEKLLRSCPRVNSV 50607080 YVLVRQKAGQTPQERVEEILSSKLFDRLRDENPDFREKII 90100110120 AINSELTQPKLALSEEDKEIIIDSTNVIFHCAATVRFNEN 130140150160 LRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNR 170180190200 KHIDEVVYPPPVDPKKLIDSLEWMDDGLVNDITPKLIGDR 210220230240 PNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF 250260270280 PGWIDNFNGPSGLFIAAGKGILRTMRASNNALADLVPVDV 290300310320 VVNTSLAAAWYSGVNRPRNIMVYNCTTGSTNPFHWGEVEY 330340350360 HVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSHKAP 370380390400 AFLYDIYLRMTGRSPRMMKTITRLHKAMVFLEYFTSNSWV 410420430440 WNTDNVNMLMNQLNPEDKKTFNIDVRQLHWAEYIENYCMG 450460470480 TKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWR 490500510 IFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY
(30) In some embodiments, the yeast cell in its unmodified form has a native enzyme of one of the enzymes described herein. In some embodiments, the gene encoding the enzyme of one of the enzymes described herein is deleted or modified such that expression of the gene is reduced or eliminated. In some embodiments, the yeast cell has a reduced capability to catabolize, metabolize, or modify the fatty alcohol.
(31) The nucleic acid constructs of the present invention comprise nucleic acid sequences encoding one or more of the subject enzymes. The nucleic acid of the subject enzymes are operably linked to promoters and optionally control sequences such that the subject enzymes are expressed in a yeast cell cultured under suitable conditions. The promoters and control sequences are specific for each yeast cell species. In some embodiments, expression vectors comprise the nucleic acid constructs. Methods for designing and making nucleic acid constructs and expression vectors are well known to those skilled in the art.
(32) Sequences of nucleic acids encoding the subject enzymes are prepared by any suitable method known to those of ordinary skill in the art, including, for example, direct chemical synthesis or cloning. For direct chemical synthesis, formation of a polymer of nucleic acids typically involves sequential addition of 3-blocked and 5-blocked nucleotide monomers to the terminal 5-hydroxyl group of a growing nucleotide chain, wherein each addition is effected by nucleophilic attack of the terminal 5-hydroxyl group of the growing chain on the 3-position of the added monomer, which is typically a phosphorus derivative, such as a phosphotriester, phosphoramidite, or the like. Such methodology is known to those of ordinary skill in the art and is described in the pertinent texts and literature (e.g., in Matteuci et al. (1980) Tet. Lett. 521:719; U.S. Pat. Nos. 4,500,707; 5,436,327; and 5,700,637). In addition, the desired sequences may be isolated from natural sources by splitting DNA using appropriate restriction enzymes, separating the fragments using gel electrophoresis, and thereafter, recovering the desired nucleic acid sequence from the gel via techniques known to those of ordinary skill in the art, such as utilization of polymerase chain reactions (PCR; e.g., U.S. Pat. No. 4,683,195).
(33) Each nucleic acid sequence encoding the desired subject enzyme can be incorporated into an expression vector. Incorporation of the individual nucleic acid sequences may be accomplished through known methods that include, for example, the use of restriction enzymes (such as BamHI, EcoRI, HhaI, Xhol, XmaI, and so forth) to cleave specific sites in the expression vector, e.g., plasmid. The restriction enzyme produces single stranded ends that may be annealed to a nucleic acid sequence having, or synthesized to have, a terminus with a sequence complementary to the ends of the cleaved expression vector. Annealing is performed using an appropriate enzyme, e.g., DNA ligase. As will be appreciated by those of ordinary skill in the art, both the expression vector and the desired nucleic acid sequence are often cleaved with the same restriction enzyme, thereby assuring that the ends of the expression vector and the ends of the nucleic acid sequence are complementary to each other. In addition, DNA linkers may be used to facilitate linking of nucleic acids sequences into an expression vector.
(34) A series of individual nucleic acid sequences can also be combined by utilizing methods that are known to those having ordinary skill in the art (e.g., U.S. Pat. No. 4,683,195).
(35) For example, each of the desired nucleic acid sequences can be initially generated in a separate PCR. Thereafter, specific primers are designed such that the ends of the PCR products contain complementary sequences. When the PCR products are mixed, denatured, and reannealed, the strands having the matching sequences at their 3 ends overlap and can act as primers for each other. Extension of this overlap by DNA polymerase produces a molecule in which the original sequences are spliced together. In this way, a series of individual nucleic acid sequences may be spliced together and subsequently transduced into a yeast microorganism simultaneously. Thus, expression of each of the plurality of nucleic acid sequences is effected.
(36) In some embodiments, the yeast cells of the present invention are genetically modified in that heterologous nucleic acid have been introduced into the yeast cells, and as such the genetically modified yeast cells do not occur in nature. The suitable yeast cell is one capable of expressing a nucleic acid construct encoding the enzyme(s) described herein. The gene encoding the enzyme may be heterologous to the yeast cell or the gene may be native to the yeast cell but is operatively linked to a heterologous promoter and one or more control regions which result in a higher expression of the gene in the yeast cell. Each enzyme described herein can be native or heterologous to the yeast cell. Where the enzyme is native to the yeast cell, the yeast cell is genetically modified to modulate expression of the enzyme. This modification can involve the modification of the chromosomal gene encoding the enzyme in the yeast cell or a nucleic acid construct encoding the gene of the enzyme is introduced into the yeast cell. One of the effects of the modification is the expression of the enzyme is modulated in the yeast cell, such as the increased expression of the enzyme in the yeast cell as compared to the expression of the enzyme in an unmodified yeast cell.
(37) It is to be understood that, while the invention has been described in conjunction with the preferred specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.
(38) All patents, patent applications, and publications mentioned herein are hereby incorporated by reference in their entireties.
(39) The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.
EXAMPLE 1
Engineering High-Level Production of Fatty Alcohols by Saccharomyces cerevisiae from Lignocellulosic Feedstocks
(40) Fatty alcohols in the C12-C18 range are used in personal care products, lubricants, and potentially biofuels. These compounds can be produced from the fatty acid pathway by a fatty acid reductase (FAR), yet yields from the preferred industrial yeast Saccharomyces cerevisiae remain under 2% of the theoretical maximum from glucose. Titer and yield of fatty alcohols are improved using an approach involving quantitative analysis of protein levels and metabolic flux, engineering enzyme level and localization, pull-push-block engineering of carbon flux, and cofactor balancing. Four heterologous FARs are compared, finding highest activity and endoplasmic reticulum localization from a Mus musculus FAR. After screening an additional twenty-one single-gene edits, increasing FAR expression is identified; deleting competing reactions encoded by DGA1, HFD1, and ADH6; overexpressing a mutant acetyl-CoA carboxylase; limiting NADPH and carbon usage by the glutamate dehydrogenase encoded by GDH1; and overexpressing the fatty acid-desaturase encoded by OLE1 as successful strategies to improve titer. The final strain produced 1.2 g/L fatty alcohols in shake flasks, and 6.0 g/L in fed-batch fermentation, corresponding to 20% of the maximum theoretical yield from glucose, the highest titers and yields reported to date in S. cerevisiae. High-level production from lignocellulosic feedstocks derived from ionic-liquid treated switchgrass and sorghum is demostrated, reaching 0.7 g/L in shake flasks. Altogether, these results represent progress towards efficient and renewable microbial production of fatty acid-derived products.
(41) Titers and yields of fatty alcohols produced by S. cerevisiae are improved and demonstrate high-level production from lignocellulosic biomass hydrolysates. This approach included quantitative analysis of metabolic flux and global protein expression to identify pathway bottlenecks in a first-generation fatty chemical producer strain and identify genetic modifications for maximizing pathway flux. Among these modifications, four heterologous fatty acid reductaseswhich convert fatty acyl-CoA into fatty alcoholsare compared exploring enzyme expression level and subcellular localization. Additionally, over two dozen genetic modifications for improvements in fatty alcohol production are screened and combined beneficial changes into a strain that produced fatty alcohols at high titers and yields. To develop an efficient bioprocess with this strain, fatty alcohol production from lignocellulosic feedstocks is evaluated in a one-pot process using cholinium-based ionic liquids. Lastly, successful scale-up in 2 L fed-batch bioreactors combined with an initial exploration of alternative substrate feeding strategies is demonstrated to maximize titer and yield.
(42) Materials and Methods
(43) Generating Strains
(44) All yeast strains in this study are derived from Saccharomyces cerevisiae BY4741 (Brachmann et al., 1998), to which the native promoters driving ACC1, FAS1, and FAS2 are replaced with the TEF1 promoter as previously reported, generating strain WRY1 (Runguphan and Keasling, 2013). All subsequent strains (Table 1) are created via Cas9-aided homologous recombination using the software tool CASdesigner (the webpage of casdesigner.jbei.org) to design integration cassettes and following a previously reported, cloning-free methodology (Reider Apel et al., 2016). Briefly, integration cassettes containing 1-kb flanking homology regions targeting a chosen genomic locus are constructed by PCR-amplifying donor DNA fragments using primers generated by CASdesigner, then co-transformed with a Cas9-gRNA plasmid (pCut) targeting the chosen genomic locus. CASdesigner primers provide 30-60 nt of inter-fragment homology allowing 1-5 separate fragments to assemble via homologous recombination in vivo. pCuts targeting empty genomic loci (e.g., 208a, 1622b) are available pre-cloned, and pCuts targeting new sites (e.g., for deletions) are assembled in vivo from a linear backbone and a linear PCR fragment containing the new gRNA sequence, as described previously (Reider Apel et al., 2016). New gRNA sequences are chosen using DNA2.0 (the webpage of dna20.com/eCommerce/cas9/input) or CHOP-CHOP (the webpage of chopchop.rc.fas.harvard.edu) (Montague et al., 2014). To generate donor DNA fragments, native sequencese.g., chromosomal homology regions, promotersare amplified from BY4741 genomic DNA, while heterologous sequencese.g., fatty acid reductase coding sequencesare amplified from synthetic gene blocks codon-optimized (for expression in S. cerevisiae) and synthesized by Integrated DNA Technologies (the webpage of idtdna.com). All PCRs used Phusion Hot Start II DNA polymerase (the webpage of thermofisher.com, cat. F549L).
(45) Transformations are performed via heat-shock (Gietz and Woods, 2002) using 200 ng pCut, 1 ug donor DNA per sample, and 20 min heat shock. For assembling a pCut targeting a new site by homologous recombination, 200 ng linear pCut backbone and 500 ng of a 1-kb fragment containing the gRNA sequence are used, as described (Reider Apel et al., 2016). For multi-site integrations, 200 ng total linear pCut backbone, and the same amounts of gRNA fragment and donor DNA for each site are used as one would have for a single integration. Colonies are screened by PCR directed at the target locus, and for integrations, one representative colony sequenced. Three to four biological replicates are analyzed for each strain.
(46) Media and Culture Conditions
(47) Selective agar plates used for transformations are purchased from Teknova (the webpage for: teknova.com, cat. C3080). Liquid selective medium used to grow transformants contains 0.2% (w/v) complete supplement mixture (CSM) lacking uracil, 0.67% yeast nitrogen base, and 2% dextrose. Nonselective medium contains 1% yeast extract, 2% peptone (Difco cat. 288620 and 211677, respectively), and either 2% dextrose (YPD) or 2% galactose and 0.2% dextrose (YPG). Nonselective agar YPD plates are purchased from Teknova (cat. Y100). Cultures are grown in plastic 96-deep well plates, 24-deep well plastic plates (CWR cat. 89080-534), glass test tubes, or 250-ml baffled flasks, as indicated in the results section. Production cultures are overlaid with dodecane, the latter spiked with 200 mg/L methyl nonadecanoate (sigma cat. N5377) as an internal standard. Plastic plates are covered with aeraseal film and shaken at 800 rpm in a Multitron shaker. Glass tubes and baffled flasks are shaken at 200 rpm. All strains are grown at 30 C.
(48) Shotgun Proteomics
(49) Strains for proteomics analysis are grown in YPD overnight, then back-diluted 1:100 into 5 ml fresh YPD and grown 8 hrs. For each sample, the entire culture volume is centrifuged at 3000g on a table-top centrifuge, decanted, and the pellet flash-frozen in liquid nitrogen and stored at 80 C. until preparation as described (Batth et al., 2012). Briefly, cell pellets are lysed in urea and bead-beaten. The lysate is reduced using tris(2-carboxyethyl)phosphine (sigma cat. C4706), then alkylated using iodoacetamide (sigma cat. 11149), trypsinized, desalted on spin columns, and finally suspended in a buffer of 0.1% formic acid to a final concentration of 2 g protein/l. Peptide data are acquired using an Agilent 1290 liquid chromatography system coupled to an Agilent 6550 QTOF mass spectrometer and analyzed using Agilent MassHunter version B.06.00. Resultant data files are searched with Mascot version 2.3.02 (the webpage of matrixscience.com) then filtered and validated using Scaffold version 4.4.0 (the webpage of proteomesoftware.com).
(50) Metabolic Flux Analysis using .sup.13C-Labeled Glucose
(51) Metabolic flux analysis is performed as previously reported (Garca Martn et al., 2015; Ghosh et al., 2016). Briefly, strains are grown in 250-ml shake flasks in 25 ml medium containing .sup.13C-labeled glucose (sigma cat. 407-622-22-9 and 110187-42-3) and sampled at exponential phase near OD 1.0. Sampling included filtering media for high-performance liquid chromatography (HPLC) to quantify extracellular metabolites, ethyl acetate extraction followed by gas chromatography-mass spectrometry (GC-MS) to quantify fatty acid products, and methanol/chloroform extraction followed by liquid chromatography-mass spectrometry (LC-MS/MS) to analyze .sup.13C labeling in metabolites. These .sup.13C labeling data are used to constrain the S. cerevisiae genome-scale model iMM904 (Mo et al., 2009) using two-scale .sup.13C Metabolic Flux Analysis (Garca Martn et al., 2015; Ghosh et al., 2016) with the open-source, python-based JBEI Quantitative Metabolic Modeling library (the webpage of github.com/JBEI/jqmm) to model the metabolic flux distribution.
(52) Fatty Alcohol Production Cultivations
(53) Initial production cultivations are performed as described (Runguphan and Keasling, 2013). Briefly, three to four biological replicates are each inoculated into 5 ml medium in glass test tubes overnight, then back-diluted 1:100 into 5 ml of the same medium, overlaid with 0.5 ml dodecane (spiked with internal standard), and shaken at 200 rpm for three days. The overlay is collected and centrifuged at 3000g, and 10 l of the top organic phase added to 90 l ethyl acetate in a GC-MS vial containing a glass insert for subsequent analysis. This method of cultivation and sampling is used to compare the fatty acid reductases, in YPD, and for initial cultivations of strain yL405 in biomass hydrolysates and other media.
(54) To screen genetically edited strains for improvements in fatty alcohol production, the appearance of precipitated fatty alcohols in some strains (
(55) To characterize production of the final highest-producer strain yL434, four biological replicates are grown in 1 ml corresponding medium overnight in glass test tubes, then back-diluted 1:100 into 10 ml of the same medium in 250-ml baffled flasks, overlaid with 2 ml dodecane (spiked with internal standard), and shaken at 200 rpm for three days. Then, 100 l culture is extracted with ethyl acetate and processed into GC-MS vials as described immediately above. This method of cultivation and sampling is used to compare production of yL434 in YPG, YPD, and YPBiomass media (see Preparation of biomass hydrolysates).
(56) Fed Batch 2 L-Scale Bioreactor Fermentations
(57) Fed-batch fermentations are performed in Sartorius 2 L bioreactors equipped Sartorius BIOSTAT B Plus control units at the Advanced Biofuels Process Demonstration Unit (ABPDU, Lawrence Berkeley National Laboratory, Emeryville, Calif.). The seed strain is inoculated in 500 ml YPD in a 1-L flask and grown overnight to an OD of 4.3. Each bioreactor is loaded with 900 ml YPD, 100 ml inoculum, and 200 ml dodecane (spiked with internal standard). Temperature is maintained at 30 C. via water flow through the reactor jacket. The pH is maintained at 5.0 by auto-dispensing a base solution (2N NH.sub.4OH). Dissolved oxygen is maintained at 20% via stirring from 400 to 800 rpm (primary cascade), then sparging air from 1 vvm (volume of air per volume of liquid per minute) to 1.5 vvm (secondary cascade). The feed contained 500 g/L glucose, 10 g/L yeast extract, 10 g/L (NH.sub.4).sub.2SO.sub.4, 8 g/L KH.sub.2PO.sub.4, 4 g/L MgSO.sub.4, 0.8 g/L NaCl, and 0.5 g/L CaCl.sub.2 and is added as described in the results section.
(58) GC-MS and Extracellular Metabolite Analysis
(59) Samples for GC-MS analysis of fatty alcohol content are analyzed on an Agilent 7890A GC equipped with an Agilent 5975 MS detector and an Agilent DB-5MS column. The inlet is set to 300 C., flow at 1 mL/min; the oven to 150 C. for 2 min, then ramped at 30 C./min to 250 C., and held for 2 min. The solvent delay is set to 4 min (or as required to avoid the dodecane peak). An authentic hexadecanol standard (Sigma catalog W255408) is used to determine titer.
(60) Extracellular metabolites are analyzed on an automated photometric Gallery Analyzer following the manufacturer's instructions.
(61) Preparation of Biomass Hydrolysates using Renewable Liquids
(62) Switchgrass (Panicum virgatum) and sorghum (Sorghum bicolor) are kindly provided by Idaho National Laboratory. The air-dried biomass is milled using a 40-mesh screen, sieved to the nominal sizes of 40-60 mesh (250-400 m), and air-dried until the moisture is <10%. The resulting biomass is converted into fermentable sugars in a one-pot, two-step process consisting of biomass pretreatment using cholinium-based IL followed by enzymatic hydrolysis, modified from a previously reported procedure (Xu et al., 2016). Briefly, 20 g dry biomass is mixed with an IL solution containing 20 g IL and 160 g water. The ILs used are cholinium lysinate, cholinium alpha-ketoglutarate, or cholinium aspartate. The 200-g mixture is thoroughly mixed and loaded in a 500-mL Parr reactor and heated to 140 C. for 3 hrs. The reactor is then cooled to room temperature using cooling water, and all the pretreated biomass slurry transferred to a filter membrane for solid-liquid separation. The solid fraction is collected, mixed with distilled water, and pH-adjusted to 5 with HCl. The weight of the mixture after pH adjustment is adjusted to 200 g with distilled water, and A the content transferred into a 14, shake flask for saccharification. The saccharification is carried out at 50 C. and pH 5 using Novozymes enzyme mixtures Cellic CTec2 and HTec2, with an enzyme dosage of 20 mg protein per grain glucan and 2 mg protein per gram xylan, respectively. The resulting slurry is filtered using a 0.2-um filter and used to dissolve 10 g/L yeast extract and 20-g/L peptone, making yeast extract-peptone-biomass hydrolysate media. In the results, YPBiomass refers to sorghum treated with cholinium aspartate.
(63) Microscopy
(64) Strains for microscopy are grown in 5 ml YPD overnight, then back-diluted 1:100into the same medium and grown 3-6 hrs at 200 rpm and 30 C. Then, 1 ml of culture volume is centrifuged at 10,000g on a table-top centrifuge, washed with 1 water, and imaged using a Zeiss LSM 710 confocal system mounted on a Zeiss inverted microscope with a 63 objective and processed using Zeiss Zen software.
(65) Results and Discussion
(66) Quantitative Analysis of Metabolic Flux and Global Protein Levels in First-Generation Fatty Chemical Producer
(67) This work began with a quantitative analysis of metabolic fluxes and global protein levels to characterize this first-generation fatty chemical producer strain and identify possible strategies to improve production. In a previous report, the native promoters driving the three fatty acid biosynthetic genes ACC1, FAS1, and FAS2 was replaced with the strong TEF1 promoter and added terminal enzymes to produce 100 mg/L fatty alcohols (using a FAR from Mus musculus) and 400 mg/L free fatty acids (using the thioesterase TesA from Escherichia coli, and deleting the fatty acyl-CoA ligases encoded by FAA1 and FAA4) (Runguphan and Keasling, 2013). In this study, TesA is chromosomally integrated, expressing it from the TEF1 promoter, and analyzed the resulting strain, yL401, using metabolic flux analysis and global proteomics to identify bottlenecks in the biosynthetic pathway. Modeling metabolic fluxes allowed us to identify how substrates and cofactors involved in fatty chemical production are used and produced by other cellular processes and thus identify possible targets for genetic modification. Layering global protein expression data on top of the flux analysis allowed us to identify genes whose differential expression may provide clues into cellular responses to the fatty chemical pathway, as well as a check on expression levels of enzymes in the fatty acid biosynthetic pathway, or along metabolic routes one may wish to engineer.
(68) To quantify global protein expression, shotgun proteomics on yL401 is performed as well as its un-engineered parent, BY4741. For both strains, many of the most highly expressed proteinsdetected at between 0.5% and 1.4% of total soluble proteinare glycolytic enzymes (Eno2p, Tdh3p, Tdh2p, Eno1p, Pgk1p), heat shock proteins (Ssa1p, Ssa2p, Ssb1 p, Ssb2p), translation elongation factors (Yef3p and Tef1p), and alcohol dehydrogenase 1 (Adh1p). As expected, proteins with increased expression in yL401 included the three fatty acid biosynthetic enzymes Acc1p, Fas1p, and Fas2p (expressed chromosomally from the TEF1 promoter). Neither FAS subunit is detectable in BY4741, yet both reached 0.25% of soluble protein in yL401. Acc1p is also undetectable in BY4741, but in yL401 reached only 0.02% of soluble protein. Strain yL401 also showed increased expression of several ribosomal and translation-initiation proteins (including Rp13p, Cdc33p, Mnp1p, and Rp139p), all induced 2-7 fold relative to BY4741 but remaining under 0.05% of total soluble protein. Proteins with decreased expression in yL401 included several amino acyl-tRNA ligases (Grs1p, Gln4p) and interestingly, the retrotransposon Tyl Gag-Pol protein (which dropped by half from 0.17% of soluble protein in BY4741). Proteins expressed at intermediate levels in both strains included the cytosolic NADP-dependent acetaldehyde dehydrogenase (Ald6p); the other four ALD isoenzymestwo are cytosolic and NAD-dependent, the other two mitochondrialare either not detected or found at nominal levels (less than 0.05% of total protein). Of pentose phosphate pathway enzymes, glucose-6-phosphate dehydrogenase (Zwf1p), the first and rate-limiting enzyme in the pentose phosphate pathway, is not detected (Thomas et al., 1991), but did observe several other enzymes involved in the pathway, e.g., Gnd1p. None of the enzymes involved in the tricarboxylic acid (TCA) cycle or glyoxylate cycle are detected at appreciable levels. Of amino acid biosynthesis enzymes, glutamate dehydrogenase (GDH) isoenzyme 1 is the most highly expressed at 0.12% of total soluble protein.
(69) To model the metabolic flux distribution in yL401, metabolite levels is measured and .sup.13C labeling patterns and used the JBEI Quantitative Metabolic Modeling library (Garca Martn et al., 2015) to model flux through genome-scale model iMM904 (Mo et al., 2009), adding fatty acyl thioesterase reactions (EC number 3.1.2.2). The reconstruction shows carbon from glucose mostly following glycolysis, then the pyruvate dehydrogenase (PDH) bypass from pyruvate to acetaldehyde, and lastly to ethanol (
(70) The proteomics and flux results allowed us to identify possible bottlenecks or imbalances in the pathway. For example, that Ald6p is the predominant ALD isoform means flux through this reaction produces NADPHrather than NADH if another ALD isoenzyme are prevalent. Following the carbon flux to the product, on a basis of one acetyl-CoA, the stoichiometry is 0.5 Glucose+1.38 ATP+1.25 NADPH1 NADH=0.125 C.sub.16FOH (ADP, NADP.sup.+, NAD.sup.+, H.sup.+, and CO.sub.2 not included for simplicity). Even though ALD flux produces NADPH, the metabolic route from glucose to fatty alcohol requires additional NADPH and produces excess NADH, an imbalance sought to be remediate (discussed in a later section). First, however, increasing carbon flux into fatty alcohol production by pull-push-block engineering is focused upon: pulling on the pathway by overexpressing the terminal enzyme; pushing by overexpressing enzymes to overcome bottlenecks on the metabolic route to the product; and blocking unwanted consumption of products or intermediates by deleting genes catalyzing undesirable reactions (Tai and Stephanopoulos, 2013).
(71) TABLE-US-00002 TABLE 1 Strains. The following strains are available from the JBEI registry (webpage for: public-registry.jbei.org) Strain yL# Parent (additional genetic changes) Reference BY4741 7 MATa, his31, leu20, met150, ura30 Runguphan et al., 2013 WRY1 400 BY4741 (acc1::P.sub.TEF1-ACC1, fas1::P.sub.TEF1-FAS1, Runguphan et al., 2013 fas2::P.sub.TEF1-FAS2) TesA 401 WRY1 (208a::P.sub.TEF1-EcTesAcyt-T.sub.CYC1, faa1, faa4) MaFAR2 402 WRY1 (208a::P.sub.TEF1-MaFAR2-T.sub.CYC1) MaFAR7 403 WRY1 (208a::P.sub.TEF1-MaFAR7-T.sub.CYC1) TaFAR1 404 WRY1 (208a::P.sub.TEF1-TaFAR1-T.sub.CYC1) MmFAR1 405 WRY1 (208a::P.sub.TEF1-MmFAR1-T.sub.CYC1) FAR 406 yL405 (1622b::P.sub.GAL1-MmFAR1-T.sub.TDH1) FAR-GFP 407 yL405 (1622b::P.sub.GAL1-MmFAR1-GFP-T.sub.TDH1) MBP-FAR 408 yL405 (1622b::P.sub.GAL1-MBP-MmFAR1-T.sub.TDH1) MBP-FAR-GFP 409 yL405 (1622b::P.sub.GAL1-MBP-MmFAR1-GFP-T.sub.TDH1) ACC1** 410 yL405 (YPRCd15c::P.sub.GAL1-ACC1**-T.sub.ENO2) HFA1cyt 411 yL405 (YPRCd15c::P.sub.GAL1-HFA1cyt-T.sub.ENO2) dga1 412 yL404 (dga1) lro1 413 yL404 (lro1) are2 414 yL404 (are2) are1 415 yL404 (are1) pxa1 416 yL404 (pxa1) pox1 417 yL404 (pox1) hfd1 418 yL404 (hfd1) adh6 419 yL404 (adh6) tdh3::BcGapN 420 yL404 (tdh3::BcGapN) tdh3::KlGapDH 421 yL404 (tdh3::KlGapDH) pgi1::ZWF1 422 yL404 (pgi1::ZWF1) gdh1 423 yL404 (gdh1) OLE1 424 yL405 (1014a::P.sub.TEF2-OLE1-T.sub.ADH1) opi1::INO2 425 yL405 (opi1::P.sub.TPI1-INO2-T.sub.PGK1) rpd3 426 yL405 (rpd3) 2RA 427 yL406 (YPRCd15c::P.sub.GAL1-ACC1**-T.sub.ENO2) 2RAh 428 yL427 (hfd1) 2RAha 429 yL427 (hfd1, adh6) 2RAhag 430 yL427 (hfd1, adh6, gdh1) 3RAhag 431 yL430 (1114a::P.sub.GAL1-MmFAR1-T.sub.TDH1) 2RAhagd 432 yL430 (dga1) 2RAhagdO 433 yL430 (dga1, 1014a::P.sub.TEF2-OLE1-T.sub.ADH1) 2RAhagdOG 434 yL433 (gal80::P.sub.TDH3-GAL4)
Pull: Comparing Fatty acyl-CoA Reductase Variants
(72) To pull flux towards the product, first the only heterologous enzyme in the pathway is focused, fatty acid reductase (FAR), which converts fatty acyl-CoA produced by fatty acid biosynthesis into fatty alcohols. Besides an earlier report expressing a Mus musculus FAR in S. cerevisiae (Runguphan and Keasling, 2013), other labs have reported on heterologously expressing a FAR from Tyto alba (Feng et al., 2015) and two from Marinobacter hydrocarbonasticus (Liu et al., 2013; Wahlen et al., 2009; Willis et al., 2011). To determine the variant most effective for fatty alcohol production in S. cerevisiae, the four FAR coding sequences (MmFAR1, TaFAR1, MaFAR2, and MaFAR7 are codon-optimized for S. cerevisae) are chromosomally integrated individually into the fatty acyl-CoA-overproducing strain WRY1, and compared fatty alcohol production using GC-MS (
(73) Having determined MmFAR1 to be the best enzyme candidate for fatty alcohol production, next it is overexpressed further to investigate whether this reaction still limited production. Starting with yL405, a second MmFAR is addedin a cassette containing the strongest promoter (from GAL1) and terminator (from TDH1) reported in recent studies (Lee et al., 2015; Reider Apel et al., 2016)which increased fatty alcohol titer by 16 fold (
(74) Push: Overexpressing acetyl-CoA Carboxylase Variants
(75) To push flux through potential bottlenecks, the first committedand limiting (Tehlivets et al., 2007)step of fatty acid biosynthesis is focused upon: the production of malonyl-CoA by acetyl-CoA carboxylase (ACC), in yeast encoded by ACC1. Although in an earlier work a strong promoter to drive ACC1 is introduced, the present shotgun proteomics analysis detected much lower levels of Acc1p compared to Fas1p and Fas2p expressed from the same TEF1 promoter. It is known that the gene product of ACC1 is regulated post-transcriptionally, e.g., through phosphorylation sites that inhibit ACC1 activity. Recent work has shown that mutating two serine residues on Acc1p (S659A, 51157A) can produce high levels of malonyl-CoA-derived products (Shi et al., 2014). Therefore yL405 is introduced into a second copy of ACC1 containing these two mutations (ACC1**) expressed from the strong GAL1 promoter. In parallel, a cytosolic version of S. cerevisiae's native mitochondrial ACC is constructed, HFA1, by replacing the latter's N-terminal mitochondrial targeting signal with the ACC1 N-terminus (HFA1cyt). This fusion protein has been shown to rescue an acc1 phenotype (Hoja et al., 2004) and does not contain any Snf1p target sites, or presumably any other uncharacterized or indirect inactivation mechanisms since Hfa1p activity is required for proliferating mitochondria during respiration when Snf1p signaling is active. Both ACC proteins improved fatty alcohol production compared to yL405, with ACC1** leading to the best improvement at 2.6 fold.
(76) Block: Inhibiting Reactions Fatty Alcohols and Intermediates
(77) To block undesirable reactions, eight genes encoding enzymes that consume fatty acyl-CoA or fatty alcohols are deleted. These included enzymes that produce triacylglycerides (TAGs) for storage (DGA1 and LRO1) or steryl esters (ARE2 and ARE1), the peroxisomal importer (PXA1), the first step of beta-oxidation (PDX1), and two that dehydrogenate fatty alcohols (HFD1 and ADH6). These deletions in parallel on the base strain yL405 are performed and screened for fatty alcohol production. Of the resulting eight deletion strains, dga1 had the highest titer (at 6.8-fold higher than parent yL405 strain), followed by hfd1 (at 2.6-fold higher), then adh6 (at 1.5-fold higher). None of the other deletions led to any improvement in titer.
(78) Optimizing NADPH/NADP+ and NADH/NAD+ Cofactor Usage
(79) Besides pull-push-block engineering of carbon flux, balancing redox cofactor usage is focused upon. As discussed above, the fatty alcohol pathway produces excess NADH and requires additional NADPH. To remediate this redox cofactor imbalance in the fatty alcohol pathway, first replacing native NADH-producing GapDH with an NADPH-producing variant as has been pursued for other bioproducts is considered (Guo et al., 2011; Kildegaard et al., 2016; Zhang et al., 2011). From the proteomics results, it is found that of the three GapDH isoenzymes in yeast, Tdh3p is the most highly expressed. Thus TDH3 is replaced with either an NADPH-producing GapDH from Kluyveromyces lactis (KlGapDH) (Verho et al., 2002), or a non-phosphorylating GapDH from Bacillus cereus (BcGap1V) (Guo et al., 2011) in the baseline yL405 strain. Neither resulting strain produced more fatty alcohols than the parent (
(80) Next, it is sought to increase NADPH availability for fatty acid biosynthesis. This flux reconstruction indicated that the fatty acid pathway consumes only 5% of cellular ATP, but 40% of cellular NADPH, suggesting the latter cofactor may limit production. The quantitative analysis further showed that (1) carbon flux through the NADPH-producing pentose phosphate pathway is only 2% of that through PGI, (2) Pgilp is expressed highly, and (3) Zwflpthe first and limiting enzyme of the pentose phosphateis undetectable even though downstream pentose phosphate enzymes are detected. Thus, it is attempted to force flux through the pentose phosphate pathway by deleting PGI1 and in its place overexpressing ZWF1 (pgi1::ZWF1), also in the yL405 strain. However, the resulting strain grew slowly and barely produced any fatty alcohols (
(81) Lastly, it is attempted to minimize NADPH consumed by competing reactions. This flux analysis indicated that 60% of all NADPH is consumed to produce glutamate (from alpha-ketoglutarate and ammonia) with the two isoenzymes catabolizing this reaction, Gdh1p and Gdh3p, expressed at 0.12% and 0.034% of soluble protein, respectively. It is theorized that deleting GDH1 might slow down glutamate biosynthesis and free up NADPH for fatty acid biosynthesis, as well as carbon. It is thus introduced a gdh1 deletion into yL405, resulting in a 2.7-fold improvement in fatty alcohol production.
(82) Perturbations to Fatty Acid Regulation
(83) The fatty acid pathway is energy intensive and regulated at several levels (Tehlivets et al., 2007). Some of the strategies address known levels of regulatione.g., using a strong constitutive promoter to overexpress ACC1, FAS1, and FAS2; or abolishing post-translational phosphorylation sites on ACC11'yet additional known or unknown regulatory mechanisms may continue to limit pathway flux. A recent study showed that deleting a histone deacetylase encoded by RPD3 dramatically increased fatty alcohol production from an S. cerevisiae strain expressing TaFAR (Feng et al., 2015). In yL405, rpd4 did not yield any improvement (
(84) Lastly, a report found that (1) a correlation in mammalian tissues between lipid accumulation (as TAGs) and expression level of 9-desaturase (which produces mono-unsaturated fatty acyl-CoA), and (2) that overexpression of 9-desaturase Yarrowia lipolitica led to dramatically increased levels of TAGs in an engineered strain (Qiao et al., 2015). To explore the possibility of 9-desaturase increasing flux through the fatty alcohol pathway in S. cerevisiaeby increasing membrane fluidity and access of MmFar1p to substrate (Degreif et al., 2017), or through an indirect feedback inhibition as in other organisms (Zhang et al., 2012)the native S. cerevisiae 9-desaturase (encoded by OLE1) in yL405 is overexpressed, resulting in a 4-fold improvement in fatty alcohol titer (
(85) Combining Beneficial Genetic Edits into Highest-Producing Strain
(86) Having found several genetic modifications that improved fatty alcohol titers, beneficial changes into a high-producing strain are next stacked. Starting with the best single-edit strain containing a second copy of FAR, then ACC1 ** is added, resulting in an additional 4.6-fold improvement over yL405 (
(87) Lastly, it is sought to deregulate the GAL1 promoter driving MmFAR and ACC1 ** by deleting the negative regulator of galactose metabolism (GAL80) and in its place introducing a copy of the positive regulator (GAL4). This perturbation in galactose metabolism has the advantage of making the GAL1 promoter constitutively active in glucose, allowing us to achieve high production using this inexpensive sugar as the carbon source. The final yL427 strain, containing two copies of MmFAR, ACC1 **, deletions of dga1, hfd1, adh6, and gdh1, overexpression of OLE1, and a gal80::GAL4 replacement produced 43-fold more fatty alcohols than the original yL405 strain (
(88) Fatty alcohol production from biomass sugars released using renewable ionic liquid.
(89) Having demonstrated a high-producing strain, then production from lignocellulosic feedstocks derived from non-food bioenergy crops is evaluated. Specific combinations of anions and cations that are liquids at room temperature (termed ionic liquids, ILs) have been shown to deconstruct plant biomass, allowing for subsequent enzymatic de-polymerization to free constituent sugars (Zhu et al., 2006). However, these processes are limited by high costs of conventional ILs, water usage, and toxicity. Recently, attention has shifted to ILs derived from benign cholinium cations stabilized with readily available bio-based anions (Petkovic et al., 2010; Sun et al., 2016). A recently demonstrated one-pot process involving biomass pretreatment with ILs composed of cholinium and amino acids followed by enzymatic saccharification requires minimal water and unit operations, thus dramatically lowering process costs (Xu et al., 2016).
(90) To examine the feasibility of using lignocellulosic feedstocks to produce fatty alcohols, two types of non-food crops are pretreated (switchgrass and sorghum) with cholinium-based ILs containing three common bio-based anions (lysinate, alpha-ketoglutarate, or aspartate) in a one-pot process (see Materials and Methods). The six resulting biomass hydrolysate media all contained 1% glucose, and all produced more than 150 mg/L fatty alcohols using the baseline strain yL405. The biomass hydrolysates media derived from sorghum pretreated with cholinium aspartate produced the most at 400 mg/L, fatty alcohols, and is further referred to as YPBiomass. Then the highest producing yL434 strain in YPBiomass is grown (as well as traditional rich media YPD and YPG) in baffled flasks, finding in preliminary experiments that greater aeration lead to improved production. Fatty alcohol levels reached 0.7 g/L in YPBiomass, corresponding to 0.06 g/g-glucose, already above the highest reported titers and yields (in shake flasks) using any media (Zhou et al., 2016). In YPD medium, fatty alcohol production reached 1.2 g/L and 0.07 g/g-glucose (
(91) Fed-Batch Bioreactor Fermentations
(92) Finally, maximizing titer and demonstrating scale-up are realized in fed-batch fermentation. Previous work on S. cerevisiae has suggested maximal yields depend on a balance between feeding enough sugar to maintain high product flux, but not too much as to induce overflow metabolism (Mazzoleni et al., 2015). To that end, 2-L scale bioreactors are set up with feed strategies aimed at minimizing overflow metabolism and maximizing titer. For all four bioreactors, yL434 is cultured in an initial 1-L YPD in batch operation until glucose depletion (as indicated by O.sub.2 spike), and then added concentrated glucose following different feed strategies: bioreactor A contained half the normal glucose concentration in batch phase (1% vs. 2% for others) and is fed a constant 1.5 g/hr concentrated glucose; bioreactor B is pulse-fed 1 g /hr (as 1 g pulses of concentrated glucose upon carbon source depletion as indicated by O.sub.2 spike, occurring every 1 hr); bioreactor C a constant 3 g/hr; and bioreactor D a constant 1.5 g/hr. All four bioreactors reached ODs of 25-31 and fatty alcohol titers >3 g/L and are still climbing at the end of the allotted 9-day fermentation time (
CONCLUSIONS
(93) In this work, S. cerevisiae is engineered for high-level production of fatty alcohols guided by quantitative analysis of global protein expression and flux modeling. Four heterologous fatty acid reductases are compared, finding high activity and ER localization from a Mus musculus FAR. After screening an additional 21 single-gene edits, the following successful strategies to improve titer are identified: (1) increasing expression of MmFAR1, (2) deleting competing reactions encoded by DGA1, HFD1, and ADH6, (3) overexpressing a mutant of the bottleneck enzyme encoded by ACC1 insensitive to post-transcriptional and post-translational repression, (4) limiting NADPH and carbon flux to glutamate biosynthesis by deleting the enzyme encoded by GDH1, and (5) limiting fatty acid pathway repression by overexpressing the desaturase encoded by OLE1. The final strain containing eleven genetic modifications compared to the parent BY4741 strain produced 1.2 g/L fatty alcohols in shake flasks.
(94) High-level production from feedstocks produced from non-food crops and cholinium-based renewable bionic ILs is also demonstrated, reaching a titer of 0.7 g/L in shake flasks. Lastly, scale-up fermentation and explored alternative feeding strategies aimed at limiting overflow metabolism is demonstrated, achieving a titer of 6.0 g/L in a 2-L, fed-batch bioreactor. These titers are the highest for fatty alcohols reported to date for S. cerevisiae. To our knowledge, this is also the first report of a bioproduct produced by yeast from feedstocks derived solely from biomass.
(95) References cited are: Batth, T. S., Keasling, J. D., Petzold, C. J., 2012. Targeted Proteomics for Metabolic Pathway Optimization, in: Fungal Secondary Metabolism: Methods and Protocols, Methods in Molecular Biology, Vol. 944. pp. 47-58. doi:10.1007/978-1-62703-122-6 Brachmann, C. B., Davies, A., Cost, G. J., Caputo, E., Li, J., Hieter, P., Boeke, J. D., 1998. Designer deletion strains derived from Saccharomyces cerevisiae S288C: A useful set of strains and plasmids for PCR-mediated gene disruption and other applications. Yeast 14, 115-132. doi:10.1002/(SICI)1097-0061(19980130)14:2<115::AID-YEA204>3.0.CO;2-2 Caspeta, L., Nielsen, J., 2013. Economic and environmental impacts of microbial biodiesel. Nat. Biotechnol. 31, 789-93. doi:10.1038/nbt.2683 Clomburg, J. M., Blankschien, M. D., Vick, J. E., Chou, A., Kim, S., Gonzalez, R., 2015. Integrated engineering of -oxidation reversal and w-oxidation pathways for the synthesis of medium chain -functionalized carboxylic acids. Metab. Eng. 28, 202-212. doi:10.1016/j.ymben.2015.01.007 Connor, R., Uhlenbrook, S., 2016. The United Nations World Water Development Report 2016. Paris, France. Degreif, D., de Rond, T., Bertl, A., Keasling, J. D., Budin, I., 2017. Lipid engineering reveals regulatory roles for membrane fluidity in yeast flocculation and oxygen-limited growth. Metab. Eng. 41, 46-56. doi:10.1016/j.ymben.2017.03.002 Feng, X., Lian, J., Zhao, H., 2015. Metabolic engineering of Saccharomyces cerevisiae to improve 1-hexadecanol production. Metab. Eng. 27, 10-19. doi:10.1016/j.ymben.2014.10.001 Gaikwad, S., 2016. Fatty Alcohol Market Size, Industry Analysis Report: Forecast, 2016-2023. Ocean View, Del. Garca Martn, H., Kumar, V. S., Weaver, D., Ghosh, A., Chubukov, V., Mukhopadhyay, A., Arkin, A., Keasling, J. D., 2015. A Method to Constrain Genome-Scale Models with 13C Labeling Data. PLOS Comput. Biol. 11, e1004363. doi:10.1371/journal.pcbi.1004363 Ghosh, A., Ando, D., Gin, J., Runguphan, W., Denby, C., Wang, G., Baidoo, E. E. K., Shymansky, C., Keasling, J. D., Garca Martn, H., 2016. (13)C Metabolic Flux Analysis for Systematic Metabolic Engineering of S. cerevisiae for Overproduction of Fatty Acids. Front. Bioeng. Biotechnol. 4, 76. doi:10.3389/fbioe.2016.00076 Gietz, R. D., Woods, R. a, 2002. Transformation of yeast by lithium acetate/single-stranded carrier DNA/polyethylene glycol method. Methods Enzymol. 350, 87-96. Goh, E.-B., Baidoo, E. E. K., Keasling, J. D., Beller, H. R., 2012. Engineering of bacterial methyl ketone synthesis for biofuels. Appl. Environ. Microbiol. 78, 70-80. doi:10.1128/AEM.06785-11 Guo, Z., Zhang, L., Ding, Z., Shi, G., 2011. Minimization of glycerol synthesis in industrial ethanol yeast without influencing its fermentation performance. Metab. Eng. 13, 49-59. doi:10.1016/j.ymben.2010.11.003 Haushalter, R. W., Kim, W., Chavkin, T. A., The, L., Garber, M. E., Nhan, M., Adams, P. D., Petzold, C. J., Katz, L., Keasling, J. D., 2014. Production of anteiso-branched fatty acids in Escherichia coli; next generation biofuels with improved cold-flow properties. Metab. Eng. 26C, 111-118. doi:10.1016/j.ymben.2014.09.002 Hoja, U., Marthol, S., Hofmann, J., Stegner, S., Schulz, R., Meier, S., Greiner, E., Schweizer, E., 2004. HFA1 encoding an organelle-specific acetyl-CoA carboxylase controls mitochondrial fatty acid synthesis in Saccharomyces cerevisiae. J. Biol. Chem. 279, 21779-86. doi:10.1074/jbc.M401071200 Kalscheuer, R., Stolting, T., Steinbchel, A., 2006. Microdiesel: Escherichia coli engineered for fuel production. Microbiology 152, 2529-2536. doi:10.1099/mic.0.29028-0 Kildegaard, K. R., Jensen, N. B., Schneider, K., Czarnotta, E., Ozdemir, E., Klein, T., Maury, J., Ebert, B. E., Christensen, H. B., Chen, Y., Kim, I. K., Herrgard, M. J., Blank, L. M., Forster, J., Nielsen, J., Borodina, I., 2016. Engineering and systems-level analysis of Saccharomyces cerevisiae for production of 3-hydroxypropionic acid via malonyl-CoA reductase-dependent pathway. Microb. Cell Fact. 15, 13. doi:10.1186/s12934-016-0451-5 Lee, M. E., DeLoache, W. C., Cervantes, B., Dueber, J. E., 2015. A Highly-characterized Yeast Toolkit for Modular, Multi-part Assembly. ACS Synth. Biol. 150414151809002. doi:10.1021/sb500366v Liu, A., Tan, X., Yao, L., Lu, X., 2013. Fatty alcohol production in engineered E. coli expressing Marinobacter fatty acyl-CoA reductases. Appl. Microbiol. Biotechnol. 97, 7061-71. doi:10.1007/s00253-013-5027-2 Liu, Y., Chen, S., Chen, J., Zhou, J., Wang, Y., Yang, M., Qi, X., Xing, J., Wang, Q., Ma, Y., 2016. High production of fatty alcohols in Escherichia coli with fatty acid starvation. Microb. Cell Fact. 15, 129. doi:10.1186/s12934-016-0524-5 Mazzoleni, S., Landi, C., Carteni, F., de Alteriis, E., Giannino, F., Paciello, L., Parascandola, P., 2015. A novel process-based model of microbial growth: self-inhibition in Saccharomyces cerevisiae aerobic fed-batch cultures. Microb. Cell Fact. 14, 109. doi:10.1186/s12934-015-0295-4 Mo, M. L., Palsson, B. ., Herrgrd, M. J., 2009. Connecting extracellular metabolomic measurements to intracellular flux states in yeast. BMC Syst. Biol. 3, 37. doi:10.1186/1752-0509-3-37 Montague, T. G., Cruz, J. M., Gagnon, J. A., Church, G. M., Valen, E., 2014. CHOPCHOP: A CRISPR/Cas9 and TALEN web tool for genome editing. Nucleic Acids Res. 42, 401-407. doi:10.1093/nar/gku410 Natter, K., Leitner, P., Faschinger, A., Wolinski, H., McCraith, S., Fields, S., Kohlwein, S. D., 2005. The spatial organization of lipid synthesis in the yeast Saccharomyces cerevisiae derived from large scale green fluorescent protein tagging and high resolution microscopy. Mol. Cell. Proteomics 4, 662-72. doi:10.1074/mcp.M400123-MCP200 Petkovic, M., Ferguson, J. L., Gunaratne, H. Q. N., Ferreira, R., Leito, M. C., Seddon, K. R., Rebelo, L. P. N., Pereira, C. S., Pereira, C. S., Ferreira, R., Seddon, K. R., Rebelo, L. P. N., Pereira, C. S., 2010. Novel biocompatible cholinium-based ionic liquidstoxicity and biodegradability. Green Chem. 12, 643. doi:10.1039/b922247b Pfleger, B. F., Gossing, M., Nielsen, J., 2015. Metabolic engineering strategies for microbial synthesis of oleochemicals. Metab. Eng. 29, 1-11. doi:10.1016/j.ymben.2015.01.009 Qiao, K., Imam Abidi, S. H., Liu, H., Zhang, H., Chakraborty, S., Watson, N., Kumaran Ajikumar, P., Stephanopoulos, G., 2015. Engineering lipid overproduction in the oleaginous yeast Yarrowia lipolytica. Metab. Eng. 29, 56-65. doi:10.1016/j.ymben.2015.02.005 Reider Apel, A., D'Espaux, L., Wehrs, M., Sachs, D., Li, R. A., Tong, G. J., Garber, M., Nnadi, O., Zhuang, W., Hillson, N. J., Keasling, J. D., Mukhopadhyay, A., 2016. A Cas9-based toolkit to program gene expression in Saccharomyces cerevisiae. Nucleic Acids Res. 1-14. doi:10.1093/gbe/evw245 Runguphan, W., Keasling, J. D., 2013. Metabolic Engineering of Saccharomyces cerevisiae for Production of Fatty Acid-Derived Biofuels and Chemicals. Metab. Eng. 21, 103-113. doi:10.1016/j.ymben.2013.07.003 Shi, S., Chen, Y., Siewers, V., 2014. Improving Production of Malonyl Coenzyme A-Derived Metabolites. MBio 5, e01130-14. doi:10.1128/mBio.01130-14.Editor Stryer, L., 1988. Biochemistry. W. H. Freeman. Sun, J., Konda, N. V. S. N. M., Shi, J., Parthasarathi, R., Dutta, T., Xu, F., Scown, C. D., Simmons, B. A., Singh, S., Andre, B., Arkin, A. P., Astromoff, A., Bakkoury, M. El, Bangham, R., Benito, R., Brachat, S., Campanaro, S., Curtiss, M., Davis, K., Deutschbauer, A., Entian, K. D., Flaherty, P., Foury, F., Garfinkel, D. J., Gerstein, M., Gotte, D., Guldener, U., Hegemann, J. H., Hempel, S., Herman, Z., Jaramillo, D. F., Kelly, D. E., Kelly, S. L., Kotter, P., LaBonte, D., Lamb, D. C., Lan, N., Liang, H., Liao, H., Liu, L., Luo, C. Y., Lussier, M., Mao, R., Menard, P., Ooi, S. L., Revuelta, J. L., Roberts, C. J., Rose, M., Ross-Macdonald, P., Scherens, B., Schimmack, G., Shafer, B., Shoemaker, D. D., Sookhai-Mahadeo, S., Storms, R. K., Strathern, J. N., Valle, G., Voet, M., Volckaert, G., Wang, C. Y., Ward, T. R., Wilhelmy, J., Winzeler, E. A., Yang, Y. H., Yen, G., Youngman, E., Yu, K. X., Bussey, H., Boeke, J. D., Snyder, M., Philippsen, P., Davis, R. W., Johnston, M., 2016. CO.sub.2 enabled process integration for the production of cellulosic ethanol using bionic liquids. Energy Environ. Sci. 9, 2822-2834. doi:10.1039/C6EE00913A Tai, M., Stephanopoulos, G., 2013. Engineering the push and pull of lipid biosynthesis in oleaginous yeast Yarrowia lipolytica for biofuel production. Metab. Eng. 15, 1-9. doi:10.1016/j.ymben.2012.08.007 Tehlivets, O., Scheuringer, K., Kohlwein, S. D., 2007. Fatty acid synthesis and elongation in yeast. Biochim. Biophys. Acta 1771, 255-70. doi:10.1016/j.bbalip.2006.07.004 Thomas, D., Cherest, H., Surdin-Kerjan, Y., 1991. Identification of the structural gene for glucose-6-phosphate dehydrogenase in yeast. Inactivation leads to a nutritional requirement for organic sulfur. EMBO J. 10, 547-553. Verho, R., Richard, P., Jonson, P. H., Sundqvist, L., Londesborough, J., Penttil, M., 2002. Identification of the first fungal NADP-GAPDH from Kluyveromyces lactis. Biochemistry 41, 13833-13838. doi:10.1021/bi0265325 Wahlen, B. D., Oswald, W. S., Seefeldt, L. C., Barney, B. M., 2009. Purification, characterization, and potential bacterial wax production role of an NADPH-dependent fatty aldehyde reductase from Marinobacter aquaeolei VT8. Appl. Environ. Microbiol. 75, 2758-64. doi:10.1128/AEM.02578-08 Willis, R. M., Wahlen, B. D., Seefeldt, L. C., Barney, B. M., 2011. Characterization of a fatty acyl-CoA reductase from Marinobacter aquaeolei VT8: a bacterial enzyme catalyzing the reduction of fatty acyl-CoA to fatty alcohol. Biochemistry 50, 10550-8. doi:10.1021/bi2008646 Xu, F., Sun, J., Konda, N. V. S. N. M., Shi, J., Dutta, T., Scown, C. D., Simmons, B. A., Singh, S., 2016. Transforming biomass conversion with ionic liquids: process intensification and the development of a high-gravity, one-pot process for the production of cellulosic ethanol. Energy Environ. Sci. 9, 1042-1049. doi:10.1039/C5EE02940F Zampar, G. G., Kmmel, A., Ewald, J., Jol, S., Niebel, B., Picotti, P., Aebersold, R., Sauer, U., Zamboni, N., Heinemann, M., 2013. Temporal system-level organization of the switch from glycolytic to gluconeogenic operation in yeast. Mol. Syst. Biol. 9, 651. doi:10.1038/msb.2013.11 Zhang, F., Ouellet, M., Batth, T. S., Adams, P. D., Petzold, C. J., Mukhopadhyay, A., Keasling, J. D., 2012. Enhancing fatty acid production by the expression of the regulatory transcription factor FadR. Metab. Eng. 14, 653-660. doi:10.1016/j.ymben.2012.08.009 Zhang, L., Tang, Y., Guo, Z., Ding, Z., Shi, G., 2011. Improving the ethanol yield by reducing glycerol formation using cofactor regulation in Saccharomyces cerevisiae. Biotechnol. Lett. 33, 1375-80. doi:10.1007/s10529-011-0588-6 Zhou, Y. J., Buijs, N. A., Zhu, Z., Qin, J., Siewers, V., Nielsen, J., 2016. Production of fatty acid-derived oleochemicals and biofuels by synthetic yeast cell factories. Nat. Commun. 7, 11709. doi:10.1038/ncomms11709 Zhu, S., Wu, Y., Chen, Q., Yu, Z., Wang, C., Jin, S., Ding, Y., Wu, G., Tu, S., Xue, Y., 2006. Dissolution of cellulose with ionic liquids and its application: a mini-review. Green Chem. 8, 325. doi:10.1039/b601395c
(96) While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.