Lysosomal targeting of enzymes, and uses thereof

10556015 ยท 2020-02-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides compositions and methods for effective lysosomal targeting mediated by PCSK9. In particular, the compositions and methods provided by the invention may be used to treat lysosomal storage diseases such as Pompe Disease and Sanfilippo Syndrome Type B, and they may be used for targeting lysosomal enzymes to the various muscles of the human body.

Claims

1. A targeted therapeutic fusion protein comprising a lysosomal enzyme fused to a lysosomal targeting moiety comprising a proprotein convertase subtilisin kexin type 9 (PCSK9) protein comprising amino acid substitutions S386A and F379A.

2. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal enzyme is an acid alpha glucosidase (GAA) protein, comprising an amino acid sequence at least 80% identical to SEQ ID NO: 1.

3. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal enzyme is an alpha-N-acetylglucosaminidase (Naglu) protein comprising an amino acid sequence at least 80% identical to SEQ ID NO: 4.

4. The targeted therapeutic fusion protein of claim 1, wherein the lysosomal targeting moiety and the lysosomal enzyme are fused via a linker.

5. The targeted therapeutic fusion protein of claim 4, wherein the linker comprises a sequence of GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPG GGGGAAAAAGGGGGGAP, which is SEQ ID NO: 13.

Description

DETAILED DESCRIPTION

(1) The present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g., a lysosomal enzyme) based on a lysosomal targeting moiety that comprises PCSK9 (proprotein convertase subtilisin kexin type 9). In some embodiments, the present invention provides a targeted therapeutic comprising a lysosomal enzyme and a lysosomal targeting moiety that binds to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and/or Annexin A2.

(2) Various aspects of the invention are described in further detail in the following subsections. The use of subsections is not meant to limit the invention. Each subsection may apply to any aspect of the invention. In this application, the use of or means and/or unless stated otherwise.

(3) Lysosomal Enzymes

(4) The present invention may be used to target any therapeutic protein to a lysosome. In particular, the present invention may be used to target a lysosomal enzyme to a lysosome for the treatment of a lysosomal storage disease. According to the present invention, a lysosomal enzyme is contemplated to encompass any enzyme or protein that, when targeted to the lysosome, is suitable for the treatment of a lysosomal storage disease. As non-limiting examples, particularly suitable lysosomal enzymes are acid alpha-glucosidase (GAA) protein, which is deficient in Pompe disease, and alpha-N-acetylglucosaminidase (Naglu) protein, which is deficient in Sanfilippo Syndrome Type B disease. Additional exemplary lysosomal enzymes are shown in Table 3.

(5) GAA Protein

(6) A suitable GAA protein according to the present invention can be any molecule that can substitute for naturally-occurring GAA protein activity or rescue one or more phenotypes or symptoms associated with GAA-deficiency. In some embodiments, a GAA protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human GAA protein.

(7) Typically, human GAA is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 27 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form including the 27 amino acid signal peptide is also referred to as Full-Length GAA protein, which contains 952 amino acids. The N-terminal 27 amino acids are cleaved as the Full-Length GAA protein enters the endoplasmic reticulum, resulting in the Precursor Form GAA Protein. The Precursor Form GAA Protein is then subsequently cleaved to remove a N-terminal propeptide sequence of 42 amino acids, to produce the Mature Form GAA protein (aa 70-952). Thus, it is contemplated that the N-terminal 27 amino acids that constitute the signal peptide and the N-terminal 42 amino acids that constitute the propeptide are generally not required for GAA protein activity. However, the use of the Full-Length GAA Protein (aa 1-952) and of the Precursor Form GAA Protein (aa 28-952) are also contemplated within the scope of the instant invention. The amino acid sequences of the Mature Form GAA Protein (SEQ ID NO:1); Precursor Form GAA Protein (SEQ ID NO:2) and Full-Length GAA Protein (SEQ ID NO:3) of a typical wild-type or naturally-occurring human GAA protein are shown in Table 1 below.

(8) TABLE-US-00001 TABLE1 MatureandPrecursorGAAProtein MatureFormGAA AHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMG Protein QPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETEN RLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVL LNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAP TPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDV YIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTR AHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAIS SSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWED MVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAA TICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRY AGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQ LGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAH VAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGT WYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIP LQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFL ARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTK VLDICVSLLMGEQFLVSWC(SEQIDNO:1) PrecursorForm GHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQAHPGRPRAVPTQ GAAProtein CDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPS YKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANR RYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFAD QFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPF YLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVV QQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDL DYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYD EGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFD GMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFLST HYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSW EQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHN SLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFL EFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEAL GSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESR QQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVR VTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGE QFLVSWC(SEQIDNO:2) Full-LengthGAA MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHP Protein AHQQGASRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGC CYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPK DILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEE PFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLS TSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQP SPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGY SSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELH QGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTA FPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTR PFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCG FLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLR YALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVL QAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAP LDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGES LEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLS NGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC(SEQIDNO:3)

(9) Thus, in some embodiments, GAA protein suitable for the present invention is a human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a suitable GAA protein may be a homologue or an orthologue of human Mature Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In other embodiments, a suitable GAA protein may be a functional variant of human Mature Form GAA Protein. A functional variant Mature Form GAA Protein may be a modified human Mature Form GAA Protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Mature Form GAA Protein (e.g., SEQ ID NO:1), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:1. In some embodiments, a GAA protein suitable for the present invention is substantially identical to human Mature Form GAA Protein (SEQ ID NO:1). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:1. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Mature Form GAA Protein.

(10) Alternatively, a GAA protein suitable for the present invention is a human Precursor Form GAA Protein (SEQ ID NO:2). In some embodiments, a GAA protein suitable may be a homologue or an orthologue of human Precursor Form GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable GAA protein is a functional variant of a human Precursor Form GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring human Precursor Form GAA Protein (e.g., SEQ ID NO:2), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Precursor Form GAA Protein (SEQ ID NO:2). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:2. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Precursor Form GAA Protein. As used herein, a Precursor Form GAA Protein typically contains a propeptide sequence.

(11) Alternatively, a GAA protein suitable for the present invention is a human Full-Length GAA Protein (SEQ ID NO:3). In some embodiments, a GAA protein suitable may be a homologue or an orthologue of Full-Length GAA Protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable GAA protein is a functional variant of human Full-Length GAA Protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full length GAA protein (e.g., SEQ ID NO:3), while retaining substantial GAA protein activity. Thus, in some embodiments, a GAA protein suitable for the present invention is substantially homologous to human Full-Length GAA Protein (SEQ ID NO:3). In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention is substantially identical to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:3. In some embodiments, a GAA protein suitable for the present invention contains a fragment or a portion of human Full-Length GAA Protein. As used herein, a Full-Length GAA Protein typically contains a signal peptide sequence and a propeptide sequence.

(12) Naglu Protein

(13) A suitable Naglu protein according to the present invention can be any molecule that can substitute for naturally-occurring Naglu protein activity or rescue one or more phenotypes or symptoms associated with Naglu-deficiency. In some embodiments, a Naglu protein suitable for the invention is a polypeptide having an N-terminus and C-terminus and an amino acid sequence substantially similar or identical to mature human Naglu protein.

(14) Typically, human Naglu is produced as a precursor molecule that is processed to a mature form. This process generally occurs by removing the 23 amino acid signal peptide as the protein enters the endoplasmic reticulum. Typically, the precursor form is also referred to as full-length precursor or full-length Naglu protein, which contains 743 amino acids. The N-terminal 23 amino acids are cleaved as the precursor protein enters the endoplasmic reticulum, resulting in a mature form. Thus, it is contemplated that the N-terminal 23 amino acids is generally not required for the Naglu protein activity. However, the use of the full-length precursor of the Naglu protein is also contemplated within the scope of the instant invention. The amino acid sequences of the mature form (SEQ ID NO:4) and full-length precursor (SEQ ID NO:5) of a typical wild-type or naturally-occurring human Naglu protein are shown in Table 2 below.

(15) TABLE-US-00002 TABLE2 MatureandPrecursorNagluProtein MatureFormof DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRV Naglu RGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRY YQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLT QAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMT PVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVW LLQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQP FIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVY SLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEAC RGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDL TRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFL LGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYY TPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVD LAKKIFLKYYPRWVAGSW(SEQIDNO:4) Full-Length MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVER Precursor/Full- ALAAKPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQL LengthNaglu RLPRPLPAVPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGI Protein NLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPP SWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGH FNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSEP SYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRGRL LVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARL FPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVS HPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAW RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRA GGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVF QLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSW (SEQIDNO:5)

(16) Thus, in some embodiments, Naglu protein suitable for the present invention is a mature human Naglu protein (SEQ ID NO:4). In some embodiments, a suitable Naglu protein may be a homologue or an orthologue of the mature human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In other embodiments, a suitable Naglu protein may be a functional variant of the mature human Naglu protein. A functional variant of the mature human Naglu protein may be a modified mature human Naglu protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring Naglu protein (e.g., SEQ ID NO:4), while retaining substantial Naglu protein activity. Thus, in some embodiments, a Naglu protein suitable for the present invention is substantially homologous to mature human Naglu protein (SEQ ID NO:4). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:4. In some embodiments, a Naglu protein suitable for the present invention is substantially identical to mature human Naglu protein (SEQ ID NO:4). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:4. In some embodiments, a Naglu protein suitable for the present invention contains a fragment or a portion ofa mature Naglu protein.

(17) Alternatively, a Naglu protein suitable for the present invention is a full-length Naglu protein (SEQ ID NO:5). In some embodiments, a Naglu protein suitable may be a homologue or an orthologue of the full-length human Naglu protein from a different species (e.g., mouse, rat, sheep, pig, dog, etc.). In some embodiments, a suitable Naglu protein is a functional variant of the full-length human Naglu protein, containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring full-length Naglu protein (e.g., SEQ ID NO:5), while retaining substantial Naglu protein activity. Thus, in some embodiments, a Naglu protein suitable for the present invention is substantially homologous to full-length human Naglu protein (SEQ ID NO:5). In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention is substantially identical to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:5. In some embodiments, a Naglu protein suitable for the present invention contains a fragment or a portion of a full-length Naglu protein. As used herein, a full-length Naglu protein typically contains a signal peptide sequence.

(18) Additional Lysosomal Enzymes

(19) The present invention may be used to deliver any lysosomal enzymes that can be used to treat any lysosomal storage diseases, in particular those lysosomal storage diseases having skeletal muscle, kidney and/or CNS etiology and/or symptoms, including, but are not limited to, aspartylglucosaminuria, cholesterol ester storage disease, Wolman disease, cystinosis, Danon disease, Fabry disease, Farber lipogranulomatosis, Farber disease, fucosidosis, galactosialidosis types I/II, Gaucher disease types I/II/III, globoid cell leukodystrophy, Krabbe disease, glycogen storage disease II, Pompe disease, GM1-gangliosidosis types I/II/III, GM2-gangliosidosis type I, Tay Sachs disease, GM2-gangliosidosis type II, Sandhoff disease, GM2-gangliosidosis, -mannosidosis types I/II, .beta.-mannosidosis, metachromatic leukodystrophy, mucolipidosis type I, sialidosis types I/II, mucolipidosis types II/III, I-cell disease, mucolipidosis type IIIC pseudo-Hurler polydystrophy, mucopolysaccharidosis type I, mucopolysaccharidosis type II, mucopolysaccharidosis type MA, Sanfilippo syndrome, mucopolysaccharidosis type IIIB, mucopolysaccharidosis type IIIC, mucopolysaccharidosis type HID, mucopolysaccharidosis type IVA, Morquio syndrome, mucopolysaccharidosis type IVB, mucopolysaccharidosis type VI, mucopolysaccharidosis type VII, Sly syndrome, mucopolysaccharidosis type IX, multiple sulfatase deficiency, neuronal ceroid lipofuscinosis, CLN1 Batten disease, CLN2 Batten diseae, Niemann-Pick disease types A/B, Niemann-Pick disease type C1, Niemann-Pick disease type C2, pycnodysostosis, Schindler disease types I/II, Gaucher disease and sialic acid storage disease.

(20) A detailed review of the genetic etiology, clinical manifestations, and molecular biology of the lysosomal storage diseases are detailed in Scriver et al., eds., The Metabolic and Molecular Basis of Inherited Disease, 7.sup.th Ed., Vol. II, McGraw Hill, (1995). Thus, the enzymes deficient in the above diseases are known to those of skill in the art, some of these are exemplified in Table 3 below:

(21) TABLE-US-00003 TABLE 3 Enzymes Associated With Lysosomal Storage Disease Disease Name Enzyme Deficiency Substance Stored Pompe Disease Acid-a1, 4-Glucosidase Glycogen -1-4 linked Oligosaccharides GM1 Gangliodsidosis -Galactosidase GM.sub.1 Gangliosides Tay-Sachs Disease -Hexosaminidase A GM.sub.2 Ganglioside GM2 Gangliosidosis: AB GM.sub.2 Activator Protein GM.sub.2 Ganglioside Variant Sandhoff Disease -Hexosaminidase A&B GM.sub.2 Ganglioside Fabry Disease -Galactosidase A Globosides Gaucher Disease Glucocerebrosidase Glucosylceramide Metachromatic Arylsulfatase A Sulphatides Leukodystrophy Krabbe Disease Galactosylceramidase Galactocerebroside Niemann Pick, Types A & B Acid Sphingomyelinase Sphingomyelin Niemann-Pick, Type C Cholesterol Esterification Sphingomyelin Defect Niemann-Pick, Type D Unknown Sphingomyelin Farber Disease Acid Ceramidase Ceramide Wolman Disease Acid Lipase Cholesteryl Esters Hurler Syndrome -L-Iduronidase Heparan & Dermatan (MPS IH) Sulfates Scheie Syndrome -L-Iduronidase Heparan & Dermatan, Sulfates (MPS IS) Hurler-Scheie -L-Iduronidase Heparan & Dermatan (MPS IH/S) Sulfates Hunter Syndrome Iduronate Sulfatase Heparan & Dermatan (MPS II) Sulfates Sanfilippo A Heparan N-Sulfatase Heparan Sulfate (MPS IIIA) Sanfilippo B -N- Heparan Sulfate (MPS IIIB) Acetylglucosaminidase Sanfilippo C Acetyl-CoA- Heparan Sulfate (MPS IIIC) Glucosaminide Acetyltransferase Sanfilippo D N-Acetylglucosamine-6- Heparan Sulfate (MPS IIID) Sulfatase Morquio B -Galactosidase Keratan Sulfate (MPS IVB) Maroteaux-Lamy Arylsulfatase B Dermatan Sulfate (MPS VI) Sly Syndrome -Glucuronidase (MPS VII) -Mannosidosis -Mannosidase Mannose/Oligosaccharides -Mannosidosis -Mannosidase Mannose/Oligosaccharides Fucosidosis -L-Fucosidase Fucosyl/Oligosaccharides Aspartylglucosaminuria N-Aspartyl-- Aspartylglucosamine Glucosaminidase Asparagines Sialidosis (Mucolipidosis I) -Neuraminidase Sialyloligosaccharides Galactosialidosis Lysosomal Protective Sialyloligosaccharides (Goldberg Syndrome) Protein Deficiency Schindler Disease -N-Acetyl- Galactosaminidase Mucolipidosis II (I-Cell N-Acetylglucosamine-1- Heparan Sulfate Disease) Phosphotransferase Mucolipidosis III (Pseudo- Same as ML II Hurler Polydystrophy) Cystinosis Cystine Transport Protein Free Cystine Salla Disease Sialic Acid Transport Free Sialic Acid and Glucuronic Protein Acid Infantile Sialic Acid Sialic Acid Transport Free Sialic Acid and Glucuronic Storage Disease Protein Acid Infantile Neuronal Ceroid Palmitoyl-Protein Lipofuscins Lipofuscinosis Thioesterase Mucolipidosis IV Unknown Gangliosides & Hyaluronic Acid Prosaposin Saposins A, B, C or D
In some embodiments, a suitable lysosomal enzyme may be a naturally occurring lysosomal enzyme. In some embodiments, a suitable lysosomal enzyme may be a recombinant version of a naturally occurring lysosomal enzyme.

(22) In some embodiments, a lysosomal enzyme suitable for the invention may have a wild-type or naturally occurring sequence. In some embodiments, a lysosomal enzyme suitable for the invention may have a modified sequence having substantial homology or identify to the wild-type or naturally-occurring sequence (e.g., having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% sequence identity to the wild-type or naturally-occurring sequence).

(23) Lysosomal Targeting Moiety

(24) According to the present invention, a lysosomal targeting moiety refers to any agent that can facilitate lysosomal delivery via binding to a protein other than the CI-M6PR receptor. In some embodiments, the lysosomal targeting moiety is able to bind, directly or indirectly, to one or more membrane proteins via a cis-his rich domain (CHRD) to form a protein complex. In some embodiments, the lysosomal targeting moiety binds, directly or indirectly, to one or more secondary binding proteins selected from the group consisting of the low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), or combinations thereof. In some embodiments, the lysosomal targeting moiety comprises a proprotein convertase, or fragment thereof. In some embodiments, the proprotein convertase is a mammalian proprotein convertase.

(25) Proprotein Convertase

(26) Mammalian proprotein convertases are members of a secretory serine protease family composed of nine members related to bacterial subtilisin and yeast kexin. The catalytic domains of seven members of this family (PC1/3; PC2; Furin; PC4; PC5/6; PACE4 and PC7) exhibit homology to the catalytic domain of yeast kexin, and they are known to cleave after basic residues in target proteins. The eighth member, SKI-1/S1P, shows strong homology to bacterial pyrolysin and, similar to the other 7 family members, is known to cleave after basic residues in target proteins. Finally, the last member, PCSK9, shows homology to fungal proteinase K and undergoes autoproteolytic cleavage at the (V/I)FAQ motif in the endoplasmic reticulum. Like many other proteases, these proprotein convertases are synthesized as inactive zymogens that carry an N-terminal propeptide. It is thought that this propeptide facilitates proper folding of the convertase, and that it functions as a natural inhibitor of the enzyme until it is cleaved off.

(27) Among the nine family members, five PCs (Furin, PC5/6; PACE4, SKI-1/S1P and PCSK9) have been shown to play a central role in regulating sterols and/or lipid metabolism. This is especially true for PCSK9, whose over-activity/gain-of-function results in Familial Hypercholesterolemia (FH). PCSK9 is highly expressed in the liver and produced as a preprotein that undergoes autoproteolytic cleavage during passage through the secretory pathyway. During this process, the C-terminus of the N-terminal propeptide occupies PCSK9's catalytic pocket, inhibiting its proteolytic activity and blocking access to other exogenous substrates.

(28) PCSK9 binds to the EGF-A domain of the LDL receptor through part of its catalytic domain to form a non-covalent protein complex, which is internalized by endocytosis and targeted for degradation in the acidic compartment of the lysosome.

(29) Data suggest, that while the PCSK9-LDLR complex is necessary for LDL receptor (LDLR) recycling and removal of LDL from the extracellular space, it is not required for PCSK9 endocytosis to the lysosome. Several studies have shown that disruption of PCSK9 binding to LDLR, through mutations within its catalytic domain or via the use of blocking antibodies does not impede PCSK9 internalization. This suggests that alternative mechanisms exist by which PCSK9 is internalized. In particular, it has been suggested that lysosomal targeting and function of PCSK9 relies on its C-terminal Cys-His-rich domain (CHRD), a region which allows for non-covalent binding with various membrane bound protein such as: amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A2 (LoSurdo et al., EMBO 12:1300-1305 (2011); Ni et al., J. Biol. Chem. 285:12882-12891 (2010); Saavedra et al., J. Biol. Chem. 287:43492-43501 (2012); DeVay et al., J. Biol. Chem. 288:10805-10818 (2013); and Chaparro-Riggers et al., J. Biol. Chem. 287:11090-11097 (2012); the contents of all of which are hereby incorporated by reference.)

(30) Exemplary Lysosomal Targeting Moieties

(31) In some embodiments, a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g., a motif or domain) capable of endocytosis to the lysosome. In some embodiments, the proprotein convertase molecule or fragment thereof, comprises a CHRD motif. In some embodiments, the proprotein convertase is a mammalian proprotein convertase. In some embodiments, the proprotein convertase is selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some specific embodiments, the proprotein convertase is PCSK9.

(32) In some embodiments, a suitable lysosomal targeting moiety may be any proprotein convertase molecule, fragment or portion thereof (e.g. a motif or domain) capable of binding, directly or indirectly, to the LDL receptor (LDLR). In some embodiments, the proprotein convertase molecule or fragment thereof, is capable of binding, directly or indirectly, to a secondary binding protein selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A. As used herein, binding to LDLR or secondary binding protein typically refers to a physiologically meaningful binding. For example, a physiologically meaningful binding typically has a dissociation constant (Kd) no greater than 10.sup.7 under physiological conditions (e.g., pH 6-8, and in particular, pH 7.4).

(33) In some embodiments, the lysosomal targeting moiety comprises the PCSK9 preprotein (including the PCSK9 signal peptide {N-terminal 30 amino acids} and propeptide {N-terminal amino acids from position 31 to 122}) (SEQ ID NO:6). In some embodiments, the lysosomal targeting moiety comprises the PCSK9 protein without the N-terminal signal and propeptide, i.e., PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a peptide fragment derived from human PCSK9 preprotein (SEQ ID NO:6). The amino acid sequences of a typical wild-type or naturally-occurring human PCSK9 preprotein and an auto-proteolytically cleaved human mature PCSK9 protein are shown in Table 4 below.

(34) TABLE-US-00004 TABLE4 HumanPCSK9Sequences PCSK9 MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAE Preprotein APEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYL TKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERIT PPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRF HRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEF IRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACL YSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTC FVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPED QRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSC SSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREA SIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAY AVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ (SEQIDNO:6) PCSK9Mature SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFE Protein NVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGT VSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTA AGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDI IGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKD VINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQ PNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSAL PGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ (SEQIDNO:7)

(35) In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety has a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the sequence of PCSK9 Mature Protein (SEQ ID NO:7). In some embodiments, a lysosomal targeting moiety is a fragment of human PCSK9 Preprotein. In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of human PCSK9 Preprotein (SEQ ID NO:6). In some embodiments, a lysosomal targeting moiety contains one or more N-terminal, C-terminal or internal deletions, or combinations thereof, in the sequence of the human PCSK9 Mature Protein (SEQ ID NO:7).

(36) In some embodiments, a lysosomal targeting moiety is a modified human PCSK9 sequence (preprotein or mature form) containing amino acid substitutions, insertions or deletions. In some embodiments, the lysosomal targeting moiety has one or more amino acid substitutions, deletions or insertions within the catalytic domain of the preprotein or mature form of PCSK9. In some specific embodiments, the lysosomal targeting moiety has one or more mutations within the PCSK9 catalytic domain that diminish or enhance auto proteolytic cleavage. In some embodiments, the one more mutations within the catalytic domain comprise a S386A substitution.

(37) In some embodiments, the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the LDLR binding region that diminish or enhance binding to the LDL receptor. In some embodiments, the mutation within the LDLR binding region comprises a F379A substitution.

(38) In some embodiments, the lysosomal targeting moiety has one or more mutations (amino acid substitutions, insertions or deletions) within the CHRD region of the protein. In some embodiments, the lysosomal targeting moiety has one or more mutations within the CHRD region that enhance binding to one or more secondary binding proteins selected from the group consisting of amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A.

(39) In some embodiments, the lysosomal targeting moiety has one or more mutations, substitutions, deletions or insertions within a region selected from the group consisting of the catalytic domain, propeptide, CHRD region, LDLR binding region and combinations thereof. In some embodiments, the one or more mutations are selected from the group consisting of S386A, F379A and combinations thereof. In some embodiments, the one or more mutations are selected from the group consisting of amino acid substitutions at positions R194 (elimination of LDL receptor binding), D186 and/or H226 (both elimination of protease activity); the substitution in these three cases may be A, as well as other amino acids such as L, G, V, and others.

(40) Lysosomal Targeting Moiety Complex

(41) In some embodiments, a suitable lysosomal targeting moiety is a protein complex comprising a proprotein convertase, or fragment thereof, and one or more auxiliary proteins. As used herein, the term auxiliary protein is used to describe a protein (i.e., full length, fragment, peptide or motif) non-covalently bound to the catalytic domain of a proprotein convertase, or fragment thereof, which is capable of inhibiting enzyme activity and/or of enhancing cellular uptake of the proprotein convertase.

(42) In some embodiments, a suitable lysosomal targeting moiety is a protein complex comprising human PCSK9 and one or more auxiliary proteins. In some embodiments, the auxiliary protein comprises a protein (i.e., full length, fragment, peptide or motif) which binds within the catalytic domain of a human proprotein convertase. In some embodiments, the auxiliary protein partially occludes the catalytic site of PCSK9 or any other proprotein convertase when bound. In some embodiments, the auxiliary protein completely occludes the catalytic site of PCSK9 when bound. In some embodiments, the auxiliary protein binds within the catalytic domain of PCSK9 or any other proprotein convertase and reduces enzyme activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely blocks enzyme activity when bound within the catalytic site of PCSK9 or any other proprotein convertase.

(43) In some embodiments, the auxiliary protein binds the LDLR receptor binding site within the catalytic domain of PCSK9 or any other proprotein convertase.

(44) In some embodiments, the auxiliary protein reduces binding between PCSK9, or any other proprotein convertase, and LDLR by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%. In some embodiments, the auxiliary protein completely reduces binding of PCSK9, or any other proprotein convertase, to LDLR.

(45) In some embodiments, the auxiliary protein enhances cellular uptake of PCSK9, or any other proprotein convertase, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95%.

(46) In some embodiments, an auxiliary protein comprises a proprotein convertase propeptide, or fragment thereof. In some embodiments, the propeptide or fragment thereof is derived from a proprotein convertase protein selected from the group consisting of PC1/3; PC2; Furin; PC4; PC5/6; PACE4, PC7, SKI-1/S1P and PCSK9. In some embodiments, the propeptide or fragment thereof is derived from PCSK9.

(47) In some embodiments, the propeptide is derived from the PCSK9 preprotein (SEQ ID NO:6). In some embodiments, the propeptide comprises an amino acid sequence at least 50%, 60%, 70%, 80%, 85%, 90% or 95% identical SEQ ID NO:8. In some embodiments, the propeptide is identical to SEQ ID NO:8. The amino acid sequences of a propeptide derived from a typical wild-type or naturally-occurring human PCSK9 preprotein is shown in Table 5 below.

(48) TABLE-US-00005 TABLE5 HumanPCSK9PropeptideSequence PCSK9 QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD Pro- PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTK peptide ILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF AQ(SEQIDNO:8)
Association Between Lysosomal Enzyme and Lysosomal Targeting Moiety

(49) A lysosomal enzyme and a targeting moiety can be associated, directly or indirectly. In some embodiments, a lysosomal enzyme and a targeting moiety are non-covalently associated. The association is typically stable at or about pH 7.4. For example, a targeting moiety can be biotinylated and bind avidin associated with a lysosomal enzyme. In some embodiments, a targeting moiety and a lysosomal enzyme are crosslinked to each other (e.g., using a chemical crosslinking agent).

(50) In some embodiments, a targeting moiety is fused to a lysosomal enzyme as a fusion protein. The targeting moiety can be at the amino-terminus of the fusion protein, the carboxy-terminus, or can be inserted within the sequence of the lysosomal enzyme at a position where the presence of the targeting moiety does not unduly interfere with the therapeutic activity of the enzyme. Where a lysosomal enzyme is a heteromeric protein, one or more of the subunits can be associated with a targeting moeity.

(51) Linker or Spacer

(52) A lysosomal targeting moiety can be fused to the N-terminus or C-terminus of a lysosomal enzyme polypeptide, or inserted internally. The lysosomal targeting moiety can be fused directly to the lysosomal enzyme polypeptide or can be separated from the lysosomal enzyme polypeptide by a linker or a spacer. An amino acid linker or spacer is generally designed to be flexible or to interpose a structure, such as an alpha-helix, between two protein moieties. A linker or spacer can be relatively short, such as a GGG or a poly GAG sequence GGGGGAAAAAGGGGG (SEQ ID NO:9), a GAP sequence of GAP (SEQ ID NO:10), a PolyGP sequence of GGGGGP (SEQ ID NO:11), or can be longer, such as, for example, 10-50 (e.g., 10-20, 10-25, 10-30, 10-35, 10-40, 10-45, 10-50) amino acids in length. In some embodiments, various short linker sequences can be present in tandem repeats. For example, a suitable linker may contain the GAG amino acid sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9) present in tandem repeats. In some embodiments, such a linker may further contain one or more GAP sequences, that frame the GAG sequence of GGGGGAAAAAGGGGG (SEQ ID NO:9). For example, in some embodiments a GAG2 linker may be used, which contains two tandem GAG repeats, each framed by a GAP sequence, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAP (SEQ ID NO:12). In some embodiments a GAG3 linker may be used, which contains three tandem GAG repeats, each framed by two GAP sequences, such as GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGG GAP (SEQ ID NO:13).

(53) In some embodiments, a suitable linker or spacer may contain a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to any of the linker sequences described herein, including, but not limited to, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, or SEQ ID NO:13.

(54) Additional linkers or spacers suitable for the invention are known in the art including those described in WO 2012122042, entitled PEPTIDE LINKERS FOR POLYPEPTIDE COMPOSITIONS AND METHODS FOR USING SAME, which is incorporated by reference in its entirety.

(55) It is contemplated that the association between a lysosomal enzyme and a lysosomal targeting moiety according to the present invention does not substantially alter enzyme activity. In some embodiments, the targeted therapeutic has an enzyme activity that is substantially similar or enhanced when compared to the corresponding native enzyme. In some embodiments, the enzyme activity of a targeted therapeutic retains at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% enzymatic activity as compared to the native enzyme. In some embodiments, the enzyme activity of a targeted therapeutic is enhanced by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 70%, 80%, 90% or 100% compared to the native enzyme.

(56) In some embodiments, a targeted therapeutic of the present invention comprises a GAA or Naglu protein fused to a lysosomal targeting moiety. In some embodiments, the GAA or Naglu protein has a Km for a known substrate of at least about 0.10 nM (e.g., at least about 0.15 nM, 0.20 nM, 0.25 nM, 0.30 nM, or 0.35 nM).

(57) It is also contemplated that in some embodiments, the targeted therapeutic of the present invention permits substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8), LDLR and Annexin A. In some embodiments, the targeted therapeutic of the present invention may be engineered to permit substantial binding between the lysosomal targeting moiety and a secondary binding protein, such as, but not limited to amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, low density lipoprotein receptor-related protein 8 (Lrp8) and Annexin A, but shows a reduction or complete block in LDLR binding. In some embodiments, the level of LDLR or secondary binding protein binding of the targeted therapeutic may be tested using any of a variety of well-known binding assays, such as, but not limited to, radiolabeled run on assay, radiolabeled binding assay, ELISA, Surface Plasmone Resonance and Isothermal Titration calorimetry. In some embodiments, the level of LDLR or secondary binding protein binding of the targeted therapeutics of the invention may be evaluated by cellular uptake studies.

(58) In some embodiments, the cellular uptake of a targeted therapeutic according to the present invention has a Kd of at least about 1.0e+2 nM (e.g., at least about 1.0e+3 nM, 1.0e+4 nM, or 1.0e+5 nM).

(59) Production of Targeted Therapeutics

(60) Targeted therapeutics according to the present invention may be produced via various methods known in the art. In some embodiments, a targeted therapeutic is a fusion protein comprising a lysosomal targeting moiety and a therapeutic protein (e.g., a lysosomal enzyme). In some embodiments, the fusion protein further comprises one or more auxiliary proteins. It is contemplated in accordance with the invention, that the targeted therapeutic, alone or further comprising an auxiliary binding protein, may be produced recombinantly. For example, a fusion protein according to the invention may be engineered using standard recombinant technology and produced using a cell culture system. In some embodiments, it is envisioned that the addition of an auxiliary protein may be achieved by co-expression of each component (fusion protein and auxiliary binding protein) to facilitate formation of the protein complex in vivo. Alternatively, in some embodiments, the auxiliary protein and the fusion protein may be recombinantely produced separately and brought together in vitro (e.g., following purification) to facilitate formation of the protein complex. In some embodiments, it is envisioned that a fusion protein is engineered and expressed that comprises a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) and at the N-terminus, separated by a proteolytic cleavage site (e.g., for Furin), a signal peptide and propeptide of a proprotein convertases (e.g., PCSK9). This proteolytic site will be cleaved intracellularly and the fusion comprising a lysosomal targeting moiety (e.g., PCSK9) and a therapeutic protein (e.g., GAA) will form a complex with the released propeptide (from which the signal peptide is removed within the ER).

(61) Various prokaryotic and eukaryotic cells may be used for producing fusion proteins including, without limitation, cell lines derived from bacteria strains, yeast strains, insect cells, animal cells, mammalian cells and human cells. Aspects of the present invention also provide for expression constructs and the generation of recombinant stable cell lines useful for expressing fusion proteins which are disclosed in the present specification. In addition, aspects of the present invention also provide methods for producing cell lines that express fusion proteins using the disclosed nucleic acid sequences of the present specification.

(62) Nucleic Acids Encoding Recombinant Fusion Proteins

(63) In some embodiments, nucleic acid molecules are provided comprising nucleic acid sequences encoding for a recombinant fusion protein (herein referred to as a transgene), such as GAA and Naglu fusion proteins described in various embodiments herein. In some embodiments, the nucleic acid encoding a transgene may be modified to provide increased expression of the fusion protein, which is also referred to as codon optimization. For example, the nucleic acid encoding a transgene can be modified by altering the open reading frame for the coding sequence. As used herein, the term open reading frame is synonymous with ORF and means any nucleotide sequence that is potentially able to encode a protein, or a portion of a protein. An open reading frame usually begins with a start codon (represented as, e.g. AUG for an RNA molecule and ATG in a DNA molecule in the standard code) and is read in codon-triplets until the frame ends with a STOP codon (represented as, e.g. UAA, UGA or UAG for an RNA molecule and TAA, TGA or TAG in a DNA molecule in the standard code). As used herein, the term codon means a sequence of three nucleotides in a nucleic acid molecule that specifies a particular amino acid during protein synthesis; also called a triplet or codon-triplet. For example, of the 64 possible codons in the standard genetic code, two codons, GAA and GAG encode the amino acid Glutamine whereas the codons AAA and AAG specify the amino acid Lysine. In the standard genetic code three codons are stop codons, which do not specify an amino acid. As used herein, the term synonymous codon means any and all of the codons that code for a single amino acid. Except for Methionine and Tryptophan, amino acids are coded by two to six synonymous codons. For example, in the standard genetic code the four synonymous codons that code for the amino acid Alanine are GCA, GCC, GCG and GCU, the two synonymous codons that specify Glutamine are GAA and GAG and the two synonymous codons that encode Lysine are AAA and AAG.

(64) In some embodiments, a nucleic acid encoding the open reading frame of fusion protein may be modified using standard codon optimization methods. Various commercial algorithms for codon optimization are available and can be used to practice the present invention. Typically, codon optimization does not alter the encoded amino acid sequences. In some embodiments, codon optimization may lead to amino acids alteration such as substitution, deletion or insertion. Typically, such amino acid alteration does not substantially alter the protein activity.

(65) Exemplary nucleic acid sequences encoding PCSK9-GAA, Naglu-PCSK9 and the PCSK9 propeptide are each respectively shown in SEQ ID NO:14, 15 and 16 below.

(66) SEQ ID NO:14 Exemplary nucleic acid sequence encoding PCSK9-GAA.

(67) TABLE-US-00006 ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCGAGCATCCCGT GGAACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAG CCCCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCAT ACAGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCG AGAATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAG TGTGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGC CGGCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCC AAGGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGG AAAAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCT GGCGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGA GGGCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCC TGCCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCAC CAATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTG GCCGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCC AGCGACTGCAGCACCTGCGCTGTGTCACAGAGTGGGACAGCACAGGCTGC TGCCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGC TCACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGAT GTCATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAA CCTGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGT TTTGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACA GCCGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTT CTCCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCA AGCTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCC ATTGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGC TCCACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGG GCCACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGC ACCCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGT GGGCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTC TGGAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTG ACCGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCC TGGGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAG TCAGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTG ACAGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCA embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image
(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 Mature Protein (except nucleotide sequences encoding mutations F379A and S386A, which are underlined) is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding Mature Form GAA Protein amino acid sequence (aa70-952) is bold and in italics.

(68) SEQ ID NO:15 Exemplary nucleic acid sequence encoding Naglu-PCSK9.

(69) TABLE-US-00007 ATGGAGGCGGTGGCGGTGGCCGCGGCGGTGGGGGTCCTTCTCCTGGCCGG GGCCGGGGGCGCGGCAGGCGACGAGGCCCGGGAGGCGGCGGCCGTGCGGG CGCTCGTGGCCCGGCTGCTGGGGCCAGGCCCCGCGGCCGACTTCTCCGTG TCGGTGGAGCGCGCTCTGGCTGCCAAGCCGGGCTTGGACACCTACAGCCT GGGCGGCGGCGGCGCGGCGCGCGTGCGGGTGCGCGGCTCCACGGGCGTGG CGGCCGCCGCGGGGCTGCACCGCTACCTGCGCGACTTCTGTGGCTGCCAC GTGGCCTGGTCCGGCTCTCAGCTGCGCCTGCCGCGGCCACTGCCAGCCGT GCCGGGGGAGCTGACCGAGGCCACGCCCAACAGGTACCGCTATTACCAGA ATGTGTGCACGCAAAGCTACTCCTTCGTGTGGTGGGACTGGGCCCGCTGG GAGCGAGAGATAGACTGGATGGCGCTGAATGGCATCAACCTGGCACTGGC CTGGAGCGGCCAGGAGGCCATCTGGCAGCGGGTGTACCTGGCCTTGGGCC TGACCCAGGCAGAGATCAATGAGTTCTTTACTGGTCCTGCCTTCCTGGCC TGGGGGCGAATGGGCAACCTGCACACCTGGGATGGCCCCCTGCCCCCCTC CTGGCACATCAAGCAGCTTTACCTGCAGCACCGGGTCCTGGACCAGATGC GCTCCTTCGGCATGACCCCAGTGCTGCCTGCATTCGCGGGGCATGTTCCC GAGGCTGTCACCAGGGTGTTCCCTCAGGTCAATGTCACGAAGATGGGCAG TTGGGGCCACTTTAACTGTTCCTACTCCTGCTCCTTCCTTCTGGCTCCGG AAGACCCCATATTCCCCATCATCGGGAGCCTCTTCCTGCGAGAGCTGATC AAAGAGTTTGGCACAGACCACATCTATGGGGCCGACACTTTCAATGAGAT GCAGCCACCTTCCTCAGAGCCCTCCTACCTTGCCGCAGCCACCACTGCCG TCTATGAGGCCATGACTGCAGTGGATACTGAGGCTGTGTGGCTGCTCCAA GGCTGGCTCTTCCAGCACCAGCCGCAGTTCTGGGGGCCCGCCCAGATCAG GGCTGTGCTGGGAGCTGTGCCCCGTGGCCGCCTCCTGGTTCTGGACCTGT TTGCTGAGAGCCAGCCTGTGTATACCCGCACTGCCTCCTTCCAGGGCCAG CCCTTCATCTGGTGCATGCTGCACAACTTTGGGGGAAACCATGGTCTTTT TGGAGCCCTAGAGGCTGTGAACGGAGGCCCAGAAGCTGCCCGCCTCTTCC CCAACTCCACCATGGTAGGCACGGGCATGGCCCCCGAGGGCATCAGCCAG AACGAAGTGGTCTATTCCCTCATGGCTGAGCTGGGCTGGCGAAAGGACCC AGTGCCAGATTTGGCAGCCTGGGTGACCAGCTTTGCCGCCCGGCGGTATG GGGTCTCCCACCCGGACGCAGGGGCAGCGTGGAGGCTACTGCTCCGGAGT GTGTACAACTGCTCCGGGGAGGCCTGCAGGGGCCACAATCGTAGCCCGCT GGTCAGGCGGCCGTCCCTACAGATGAATACCAGCATCTGGTACAACCGAT CTGATGTGTTTGAGGCCTGGCGGCTGCTGCTCACATCTGCTCCCTCCCTG GCCACCAGCCCCGCCTTCCGCTACGACCTGCTGGACCTCACTCGGCAGGC AGTGCAGGAGCTGGTCAGCTTGTACTATGAGGAGGCAAGAAGCGCCTACC TGAGCAAGGAGCTGGCCTCCCTGTTGAGGGCTGGAGGCGTCCTGGCCTAT GAGCTGCTGCCGGCACTGGACGAGGTGCTGGCTAGTGACAGCCGCTTCTT GCTGGGCAGCTGGCTAGAGCAGGCCCGAGCAGCGGCAGTCAGTGAGGCCG AGGCCGATTTCTACGAGCAGAACAGCCGCTACCAGCTGACCTTGTGGGGG CCAGAAGGCAACATCCTGGACTATGCCAACAAGCAGCTGGCGGGGTTGGT GGCCAACTACTACACCCCTCGCTGGCGGCTTTTCCTGGAGGCGCTGGTTG ACAGTGTGGCCCAGGGCATCCCTTTCCAACAGCACCAGTTTGACAAAAAT GTCTTCCAACTGGAGCAGGCCTTCGTTCTCAGCAAGCAGAGGTACCCCAG CCAGCCGCGAGGAGACACTGTGGACCTGGCCAAGAAGATCTTCCTCAAAT ATTACCCCCGCTGGGTGGCCGGCTCTTGGGGAGGTGGAAGCATCCCGTGG AACCTGGAGCGGATTACCCCTCCACGGTACCGGGCGGATGAATACCAGCC CCCCGACGGAGGCAGCCTGGTGGAGGTGTATCTCCTAGACACCAGCATAC AGAGTGACCACCGGGAAATCGAGGGCAGGGTCATGGTCACCGACTTCGAG AATGTGCCCGAGGAGGACGGGACCCGCTTCCACAGACAGGCCAGCAAGTG TGACAGTCATGGCACCCACCTGGCAGGGGTGGTCAGCGGCCGGGATGCCG GCGTGGCCAAGGGTGCCAGCATGCGCAGCCTGCGCGTGCTCAACTGCCAA GGGAAGGGCACGGTTAGCGGCACCCTCATAGGCCTGGAGTTTATTCGGAA AAGCCAGCTGGTCCAGCCTGTGGGGCCACTGGTGGTGCTGCTGCCCCTGG CGGGTGGGTACAGCCGCGTCCTCAACGCCGCCTGCCAGCGCCTGGCGAGG GCTGGGGTCGTGCTGGTCACCGCTGCCGGCAACTTCCGGGACGATGCCTG CCTCTACTCCCCAGCCTCAGCTCCCGAGGTCATCACAGTTGGGGCCACCA ATGCCCAAGACCAGCCGGTGACCCTGGGGACTTTGGGGACCAACTTTGGC CGCTGTGTGGACCTCTTTGCCCCAGGGGAGGACATCATTGGTGCCTCCAG CGACTGCAGCACCTGCGCTGTGTCACAGAGTGGGACAGCACAGGCTGCTG CCCACGTGGCTGGCATTGCAGCCATGATGCTGTCTGCCGAGCCGGAGCTC ACCCTGGCCGAGTTGAGGCAGAGACTGATCCACTTCTCTGCCAAAGATGT CATCAATGAGGCCTGGTTCCCTGAGGACCAGCGGGTACTGACCCCCAACC TGGTGGCCGCCCTGCCCCCCAGCACCCATGGGGCAGGTTGGCAGCTGTTT TGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATGGCCACAGC CGTCGCCCGCTGCGCCCCAGATGAGGAGCTGCTGAGCTGCTCCAGTTTCT CCAGGAGTGGGAAGCGGCGGGGCGAGCGCATGGAGGCCCAAGGGGGCAAG CTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGAGGGTGTCTACGCCAT TGCCAGGTGCTGCCTGCTACCCCAGGCCAACTGCAGCGTCCACACAGCTC CACCAGCTGAGGCCAGCATGGGGACCCGTGTCCACTGCCACCAACAGGGC CACGTCCTCACAGGCTGCAGCTCCCACTGGGAGGTGGAGGACCTTGGCAC CCACAAGCCGCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGTGG GCCACAGGGAGGCCAGCATCCACGCTTCCTGCTGCCATGCCCCAGGTCTG GAATGCAAAGTCAAGGAGCATGGAATCCCGGCCCCTCAGGAGCAGGTGAC CGTGGCCTGCGAGGAGGGCTGGACCCTGACTGGCTGCAGTGCCCTCCCTG GGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGTAGTC AGGAGCCGGGACGTCAGCACTACAGGCAGCACCAGCGAAGGGGCCGTGAC AGCCGTTGCCATCTGCTGCCGGAGCCGGCACCTGGCGCAGGCCTCCCAGG AGCTCCAGTAG
(1) The nucleotide sequence encoding Naglu signal peptide is underlined.
(2) The nucleotide sequence encoding Mature Form of Naglu is not underlined, bold or in italics.
(3) The nucleotide sequence encoding the amino acid sequence of the GlyGlyGly linker is underlined.
(4) The nucleotide sequence encoding PCSK9 Mature Protein (except the nucleotide sequences encoding mutations F379A and S386A, which are additionally underlined) is in italics.

(70) SEQ ID NO:16 Exemplary nucleic acid sequence encoding PCSK9 propeptide and PCSK9 N-terminal signal peptide.

(71) TABLE-US-00008 ATGGGCACCGTCAGCTCCAGGCGGTCCTGGTGGCCGCTGCCACTGCTGCT GCTGCTGCTGCTGCTCCTGGGTCCCGCGGGCGCCCGTGCGCAGGAGGACG AGGACGGCGACTACGAGGAGCTGGTGCTAGCCTTGCGTTCCGAGGAGGAC GGCCTGGCCGAAGCACCCGAGCACGGAACCACAGCCACCTTCCACCGCTG CGCCAAGGATCCGTGGAGGTTGCCTGGCACCTACGTGGTGGTGCTGAAGG AGGAGACCCACCTCTCGCAGTCAGAGCGCACTGCCCGCCGCCTGCAGGCC CAGGCTGCCCGCCGGGGATACCTCACCAAGATCCTGCATGTCTTCCATGG CCTTCTTCCTGGCTTCCTGGTGAAGATGAGTGGCGACCTGCTGGAGCTGG CCTTGAAGTTGCCCCATGTCGACTACATCGAGGAGGACTCCTCTGTCTTT GCCCAGTGA
(1) The nucleotide sequence encoding PCSK9 signal peptide is underlined.
(2) The nucleotide sequence encoding PCSK9 propeptide is in italics.

(72) In some embodiments, a nucleotide change may alter a synonymous codon within the open reading frame in order to agree with the endogenous codon usage found in a particular heterologous cell selected for expression. Alternatively or additionally, a nucleotide change may alter the G+C content within the open reading frame to better match the average G+C content of open reading frames found in endogenous nucleic acid sequence present in the heterologous host cell. A nucleotide change may also alter a polymononucleotide region or an internal regulatory or structural site found within a protein sequence. Thus, a variety of modified or optimized nucleotide sequences are envisioned including, without limitation, nucleic acid sequences providing increased expression of a fusion protein in a prokaryotic cell; yeast cell; insect cell; and in a mammalian cell.

(73) Thus, in some embodiments, a nucleic acid encoding a PCSK9-GAA fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:14. In some embodiments, a nucleic acid encoding a Naglu-PCSK9 fusion protein suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:15. In some embodiments, a nucleic acid encoding a PCSK9 propeptided suitable for the present invention comprises a nucleotide sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO:16. A modified nucleic acid may or may not result in amino acid sequence alterations in a fusion protein. In the event there is amino acid alteration, such alteration typically does not substantially alter the biological activity of the protein.

(74) Expression Vectors

(75) A nucleic acid sequence encoding a fusion protein or auxiliary binding protein as described in the present application, can be molecularly cloned (inserted) into a suitable vector for propagation or expression in a host cell. A wide variety of expression vectors can be used to practice the present invention, including, without limitation, a prokaryotic expression vector; a yeast expression vector; an insect expression vector and a mammalian expression vector. Exemplary vectors suitable for the present invention include, but are not limited to, viral based vectors (e.g., AAV based vectors, retrovirus based vectors, plasmid based vectors). Typically, a nucleic acid encoding a fusion protein is operably linked to various regulatory sequences or elements.

(76) Regulatory Sequences or Elements

(77) Various regulatory sequences or elements may be incorporated in an expression vector suitable for the present invention. Exemplary regulatory sequences or elements include, but are not limited to, promoters, enhancers, repressors or suppressors, 5 untranslated (or non-coding) sequences, introns, 3 untranslated (or non-coding) sequences.

(78) As used herein, a Promoter or Promoter sequence is a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter bound proteins or substances) and initiating transcription of a coding sequence. A promoter sequence is, in general, bound at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at any level. The promoter may be operably associated with or operably linked to the expression control sequences, including enhancer and repressor sequences or with a nucleic acid to be expressed. In some embodiments, the promoter may be inducible. In some embodiments, the inducible promoter may be unidirectional or bio-directional. In some embodiments, the promoter may be a constitutive promoter. In some embodiments, the promoter can be a hybrid promoter, in which the sequence containing the transcriptional regulatory region is obtained from one source and the sequence containing the transcription initiation region is obtained from a second source. Systems for linking control elements to coding sequence within a transgene are well known in the art (general molecular biological and recombinant DNA techniques are described in Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989, which is incorporated herein by reference). Commercial vectors suitable for inserting a transgene for expression in various host cells under a variety of growth and induction conditions are also well known in the art.

(79) In some embodiments, a specific promoter may be used to control expression of the transgene in a mammalian host cell such as, but are not limited to, SR-promoter (Takebe et al., Molec. and Cell. Bio. 8:466-472 (1988)), the human CMV immediate early promoter (Boshart et al., Cell 41:521-530 (1985); Foecking et al., Gene 45:101-105 (1986)), human CMV promoter, the human CMV5 promoter, the murine CMV immediate early promoter, the EF1--promoter, a hybrid CMV promoter for liver specific expression (e.g., made by conjugating CMV immediate early promoter with the transcriptional promoter elements of either human -1-antitrypsin (HAT) or albumin (HAL) promoter), or promoters for hepatoma specific expression (e.g., wherein the transcriptional promoter elements of either human albumin (HAL; about 1000 bp) or human -1-antitrypsin (HAT, about 2000 bp) are combined with a 145 long enhancer element of human -1-microglobulin and bikunin precursor gene (AMBP); HAL-AMBP and HAT-AMBP); the SV40 early promoter region (Benoist at al., Nature 290:304-310 (1981)), the Orgyia pseudotsugata immediate early promoter, the herpes thymidine kinase promoter (Wagner at al., Proc. Natl. Acad. Sci. USA 78:1441-1445 (1981)); or the regulatory sequences of the metallothionein gene (Brinster et al., Nature 296:39-42 (1982)). In some embodiments, the mammalian promoter is a constitutive promoter such as, but not limited to, the hypoxanthine phosphoribosyl transferase (HPTR) promoter, the adenosine deaminase promoter, the pyruvate kinase promoter, the beta-actin promoter as well as other constitutive promoters known to those of ordinary skill in the art.

(80) In some embodiments, a specific promoter may be used to control expression of a transgene in a prokaryotic host cell such as, but are not limited to, the -lactamase promoter (Villa-Komaroff et al., Proc. Natl. Acad. Sci. USA 75:3727-3731 (1978)); the tac promoter (DeBoer et al., Proc. Natl. Acad. Sci. USA 80:21-25 (1983)); the T7 promoter, the T3 promoter, the M13 promoter or the M16 promoter; in a yeast host cell such as, but are not limited to, the GAL1, GAL4 or GAL10 promoter, the ADH (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, glyceraldehyde-3-phosphate dehydrogenase III (TDH3) promoter, glyceraldehyde-3-phosphate dehydrogenase II (TDH2) promoter, glyceraldehyde-3-phosphate dehydrogenase I (TDH1) promoter, pyruvate kinase (PYK), enolase (ENO), or triose phosphate isomerase (TPI).

(81) In some embodiments, the promoter may be a viral promoter, many of which are able to regulate expression of a transgene in several host cell types, including mammalian cells. Viral promoters that have been shown to drive constitutive expression of coding sequences in eukaryotic cells include, for example, simian virus promoters, herpes simplex virus promoters, papilloma virus promoters, adenovirus promoters, human immunodeficiency virus (HIV) promoters, Rous sarcoma virus promoters, cytomegalovirus (CMV) promoters, the long terminal repeats (LTRs) of Moloney murine leukemia virus and other retroviruses, the thymidine kinase promoter of herpes simplex virus as well as other viral promoters known to those of ordinary skill in the art.

(82) In some embodiments, the gene control elements of an expression vector may also include 5 non-transcribing and 5 non-translating sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, Kozak sequence and the like. Enhancer elements can optionally be used to increase expression levels of a polypeptide or protein to be expressed. Examples of enhancer elements that have been shown to function in mammalian cells include the SV40 early gene enhancer, as described in Dijkema et al., EMBO J. (1985) 4: 761 and the enhancer/promoter derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus (RSV), as described in Gorman et al., Proc. Natl. Acad. Sci. USA (1982b) 79:6777 and human cytomegalovirus, as described in Boshart et al., Cell (1985) 41:521. Genetic control elements of an expression vector will also include 3 non-transcribing and 3non-translating sequences involved with the termination of transcription and translation. Respectively, such as a poly polyadenylation (polyA) signal for stabilization and processing of the 3 end of an mRNA transcribed from the promoter. Poly A signals included, for example, the rabbit beta globin polyA signal, bovine growth hormone polyA signal, chicken beta globin terminator/polyA signal, or SV40 late polyA region.

(83) Selectable Markers

(84) Expression vectors will preferably but optionally include at least one selectable marker. In some embodiments, the selectable maker is a nucleic acid sequence encoding a resistance gene operably linked to one or more genetic regulatory elements, to bestow upon the host cell the ability to maintain viability when grown in the presence of a cyctotoxic chemical and/or drug. In some embodiments, a selectable agent may be used to maintain retention of the expression vector within the host cell. In some embodiments, the selectable agent is may be used to prevent modification (i.e. methylation) and/or silencing of the transgene sequence within the expression vector. In some embodiments, a selectable agent is used to maintain episomal expression of the vector within the host cell. In some embodiments, the selectable agent is used to promote stable integration of the transgene sequence into the host cell genome. In some embodiments, an agent and/or resistance gene may include, but is not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017, ampicillin, neomycin (G418), zeomycin, mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos. 5,122,464; 5,770,359; 5,827,739) for eukaryotic host cell; tetracycline, ampicillin, kanamycin or chlorampenichol for a prokaryotic host cell; and URA3, LEU2, HIS3, LYS2, HIS4, ADE8, CUP1 or TRP1 for a yeast host cell.

(85) Expression vectors may be transfected, transformed or transduced into a host cell. As used herein, the terms transfection, transformation and transduction all refer to the introduction of an exogenous nucleic acid sequence into a host cell. In some embodiments, expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein is transfected, transformed or transduced into a host cell. In some embodiments, one or more expression vectors containing nucleic acid sequences encoding a fusion therapeutic glycoprotein are transfected, transformed or transduced into a host cell sequentially. For example, a vector encoding a first fusion therapeutic glycoprotein protein may be transfected, transformed or transduced into a host cell, followed by the transfection, transformation or transduction of a vector encoding a second fusion therapeutic glycoprotein, and vice versa. Examples of transformation, transfection and transduction methods, which are well known in the art, include liposome delivery, i.e., Lipofectamine (Gibco BRL) Method of Hawley-Nelson, Focus 15:73 (1193), electroporation, CaPO.sub.4 delivery method of Graham and van der Erb, Virology, 52:456-457 (1978), DEAE-Dextran medicated delivery, microinjection, biolistic particle delivery, polybrene mediated delivery, cationic mediated lipid delivery, transduction, and viral infection, such as, e.g., retrovirus, lentivirus, adenovirus adeno-associated virus and Baculovirus (Insect cells). General aspects of cell host transformations have been described in the art, such as by Axel in U.S. Pat. No. 4,399,216; Sambrook, supra, Chapters 1-4 and 16-18; Ausubel, supra, chapters 1, 9, 13, 15, and 16. For various techniques for transforming mammalian cells, see Keown et al., Methods in Enzymology (1989), Keown et al., Methods in Enzymology, 185:527-537 (1990), and Mansour et al., Nature, 336:348-352 (1988).

(86) Once introduced inside cells, expression vectors may be integrated stably in the genome or exist as extra-chromosomal constructs. Vectors may also be amplified and multiple copies may exist or be integrated in the genome. In some embodiments, cells of the invention may contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more copies of nucleic acids encoding a fusion therapeutic glycoprotein. In some embodiments, cells of the invention may contain multiple copies (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more) of nucleic acids encoding one or more fusion therapeutic glycoproteins.

(87) Mammalian Cell Lines

(88) Any mammalian cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell. Non-limiting examples of mammalian cells that may be used in accordance with the present invention include HT1080 cells (Rasheed S, Nelson-Rees W A, Toth E M, Arnstein P, Gardner M B. Characterization of a newly derived human sarcoma cell line (HT1080). Cancer 33:1027-1033, 1974), human embryonic kidney 293 cells (HEK293), HeLa cells; BALB/c mouse myeloma line (NSO/l, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci., 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). In some embodiments, a suitable mammalian cell is not a endosomal acidification-deficient cell.

(89) Additionally, any number of commercially and non-commercially available hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present invention. One skilled in the art will appreciate that hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.

(90) Non-Mammalian Cell Lines

(91) Any non-mammalian derived cell or cell type susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell. Non-limiting examples of non-mammalian host cells and cell lines that may be used in accordance with the present invention include cells and cell lines derived from Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosacccharomyces pombe, Saccharomyces cerevisiae, and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila melangoster and Manduca sexta for insects; and Escherichia coli, Salmonella typhimurium, Bacillus subtilis, Bacillus lichenifonnis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile for bacteria; and Xenopus Laevis from amphibian.

(92) In other embodiments, transgenic nonhuman mammals have been shown to produce therapeutic glycoproteins (e.g., lysosomal enzymes) in their milk. Such transgenic nonhuman mammals may include mice, rabbits, goats, sheep, porcines or bovines. See U.S. Pat. Nos. 6,118,045 and 7,351,410, each of which are hereby incorporated by reference in their entirety.

(93) Any and all methods suitable for producing recombinant protein can be used to produce therapeutic protein of the present invention.

(94) Pharmaceutical Compositions and Administration

(95) The present invention further provides pharmaceutical compositions containing targeted therapeutics according to the present invention. Typically, suitable pharmaceutical compositions contain at least one pharmaceutically acceptable excipient and are formulated for administration to humans.

(96) For example, pharmaceutical compositions provided herein may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous, intravenous, or intrathecal injection). For example, in some embodiments, pharmaceutical compositions are provided in a liquid dosage form that is suitable for injection. In some embodiments, pharmaceutical compositions are provided as powders (e.g., lyophilized and/or sterilized), optionally under vacuum, which are reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection. In some embodiments, pharmaceutical compositions are diluted and/or reconstituted in water, sodium chloride solution, sodium acetate solution, benzyl alcohol solution, phosphate buffered saline, etc. In some embodiments, powder should be mixed gently with the aqueous diluent (e.g., not shaken).

(97) In some embodiments, provided pharmaceutical compositions comprise one or more pharmaceutically acceptable excipients (e.g., preservative, inert diluent, dispersing agent, surface active agent and/or emulsifier, buffering agent, etc.). In some embodiments, pharmaceutical compositions comprise one or more preservatives. In some embodiments, pharmaceutical compositions comprise no preservative.

(98) Compositions of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In some embodiments, such preparatory methods include the step of bringing active ingredient into association with one or more excipients and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.

(99) A pharmaceutical composition in accordance with the invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a unit dose is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.

(100) Relative amounts of active ingredient, pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention may vary, depending upon the identity, size, and/or condition of the subject treated and/or depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.

(101) Pharmaceutical compositions of the present invention may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, may be or comprise solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro, (Lippincott, Williams & Wilkins, Baltimore, Md., 2006) discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof. Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.

(102) Targeted therapeutics described herein (or a composition or medicament containing a targeted therapeutics described herein) can be administered by any appropriate route generally known in the art. In some embodiments, a targeted therapeutic or a pharmaceutical composition containing the same is administered systemically. Systemic administration may be intravenous, intramuscular, intradermal, by inhalation, transdermal (topical), intraocular, subcutaneous, oral and/or transmucosal. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered by intramuscular injection. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered subcutaneously. Administration may be performed by injecting a composition into areas including, but not limited to, the thigh region, abdominal region, gluteal region, or scapular region. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered intravenously. In some embodiments, a targeted therapeutics or a pharmaceutical composition containing the same is administered orally. More than one route can be used concurrently, if desired. All of the administration routes disclosed herein are generally known in the art, and the skilled artisan would know how to administer targeted therapeutics of the present invention by these routes.

(103) In some embodiments, pharmaceutical compositions according to the present invention can be used for CNS delivery via various techniques and routes including, but not limited to, intraparenchymal, intracerebral, intravetricular cerebral (ICV), intrathecal (e.g., IT-Lumbar, IT-cisterna magna) administrations and any other techniques and routes for injection directly or indirectly to the CNS and/or CSF.

(104) In some embodiments, pharmaceutical compositions according to the present invention can be used for intrathecal administration. As used herein, intrathecal administration (also referred to as intrathecal injection or intrathecal delivery) refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various formulations for intrathecal administration are described in WO/2011/163652, the contents of which are incorporated herein by reference.

(105) According to the present invention, a pharmaceutical composition containing a targeted therapeutics may be injected at any region surrounding the spinal canal. In some embodiments, a pharmaceutical composition containing a targeted therapeutics is injected into the lumbar area or the cisterna magna or intraventricularly into a cerebral ventricle space. As used herein, the term lumbar region or lumbar area refers to the area between the third and fourth lumbar (lower back) vertebrae and, more inclusively, the L2-S1 region of the spine. Typically, intrathecal injection via the lumbar region or lumber area is also referred to as lumbar IT delivery or lumbar IT administration.

(106) Various devices may be used for intrathecal delivery according to the present invention. In some embodiments, a device for intrathecal administration contains a fluid access port (e.g., injectable port); a hollow body (e.g., catheter) having a first flow orifice in fluid communication with the fluid access port and a second flow orifice configured for insertion into spinal cord; and a securing mechanism for securing the insertion of the hollow body in the spinal cord. As a non-limiting example, a suitable securing mechanism contains one or more nobs mounted on the surface of the hollow body and a sutured ring adjustable over the one or more nobs to prevent the hollow body (e.g., catheter) from slipping out of the spinal cord. In various embodiments, the fluid access port comprises a reservoir. In some embodiments, the fluid access port comprises a mechanical pump (e.g., an infusion pump). In some embodiments, an implanted catheter is connected to either a reservoir (e.g., for bolus delivery), or an infusion pump. The fluid access port may be implanted or external

(107) In some embodiments, intrathecal administration may be performed by either lumbar puncture (i.e., slow bolus) or via a port-catheter delivery system (i.e., infusion or bolus). In some embodiments, the catheter is inserted between the laminae of the lumbar vertebrae and the tip is threaded up the thecal space to the desired level (generally L3-L4).

(108) For injection, formulations of the invention can be formulated in liquid solutions. In addition, the enzyme may be formulated in solid form and re-dissolved or suspended immediately prior to use. Lyophilized forms are also included. The injection can be, for example, in the form of a bolus injection or continuous infusion (e.g., using infusion pumps) of the enzyme.

(109) Treatment of Pompe Disease, San B and Other Lysosomal Storage Diseases

(110) The present invention may be used to effectively treat Pompe Disease, Sanfilippo Syndrome Type B and other lysosomal storage diseases.

(111) Pompe disease, or Glycogen Storage Disease Type II, is an autosomal recessive metabolic disorder resulting from a deficiency or dysfunction of the lysosomal hydrolase acid alpha-glucosidase (GAA). GAA is localized to lysosomes and plays an important role in the catabolism of glycogen into glucose. In the absence of the enzyme, these glycogen accumulates within the cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due the widespread expression of the enzyme, multiple cell types and organ systems are affected in Pompe patients.

(112) Unlike San B, which displays CNS degeneration as the predominant defining clinical feature, Pompe disease is characterized by a degeneration within the peripheral tissues of the body. In particular, glycogen build-up results in progressive muscle weakness (myopathy) throughout the body, specifically affecting the tissues of the heart, skeletal muscles, as well as liver and kidneys. Typical findings are those of enlarged heart with non-specific conduction defects, along with several indicators of kidney disease, such as high levels of serum creatine kinase, aldolase, aspartate transaminase and lactic dehydrogenase. The disease typically manifests itself in the first several month of life, with cardiomegaly, hypotonia, cardiomyopathy, respiratory distress and muscle weakness. Some affected individuals experience a progressive loss of skeletal muscle, cardiac or kidney function, with most affected individuals dying of disease-associated complications in their first or second decade.

(113) Sanfilippo Syndrome Type B (San B), or Mucopolysaccharidosis III B (MPS III B), is a heritable metabolic disorder resulting from a deficiency of the enzyme Naglu. Naglu is localized to lysosomes and plays an important role in the catabolism of glycosaminoglycans (GAGs) heparan- and dermatan-sulfate. In the absence of enzyme, these substrates accumulate within cells, ultimately causing engorgement, followed by cellular death and tissue destruction. Due to the widespread expression of Naglu, multiple cell types and organ systems are affected in MPS III B patients.

(114) A defining clinical feature of San B is central nervous system (CNS) degeneration, however, which typically results in cognitive impairment (e.g., decrease in IQ). Additionally, MRI scans of affected individuals have revealed white matter lesions, dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and brainstem; atrophy; and ventriculomegaly (Wang et al. Molecular Genetics and Metabolism, 2009). The disease typically manifests itself in the first years of life with organomegaly and skeletal abnormalities. Some affected individuals experience a progressive loss of cognitive function, with most affected individuals dying of disease-associated complications in their first or second decade.

(115) Compositions and methods of the present invention may be used to effectively treat individuals suffering from or susceptible to Pompe Disease or San B. The terms treat or treatment, as used herein, refer to amelioration of one or more symptoms associated with the disease, prevention or delay of the onset of one or more symptoms of the disease, and/or lessening of the severity or frequency of one or more symptoms of the disease.

(116) In some embodiments, treatment refers to partial or complete alleviation, amelioration, relief, inhibition, delay of onset, reduction of severity and/or incidence of impairment in a Pompe Disease or San B patient. As used herein, the term impairment includes various symptoms in various organ systems commonly associated with Pompe Disease and/or San B (e.g., in the brain and spinal cord or skeletal or heart muscle). Symptoms of neurological impairment may include, for example, e.g., cognitive impairment; white matter lesions; dilated perivascular spaces in the brain parenchyma, ganglia, corpus callosum, and/or brainstem; atrophy; and/or ventriculomegaly, among others. Symptoms often associated with Pompe Disease include, for example, weakness of skeletal muscle and heart failure and respiratory weakness.

(117) The terms, improve, increase or reduce, as used herein, indicate values that are relative to a control. In some embodiments, a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein. A control individual is an individual afflicted with a lysosomal storage disease (e.g., San B, Pompe Disease), who is about the same age and/or gender as the individual suffering from the same lysosmal storage disease, who is being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).

(118) The individual (also referred to as patient or subject) being treated is an individual (fetus, infant, child, adolescent, or adult human) having a lysosomal storage disease or having the potential to develop a lysosmal storage disease. In some embodiments, the lysosmal storage disease is Pompe Disease or Sanfilippo Syndrome. In some specific embodiments the lysosomal storage disease is San B. The individual can have residual endogenous GAA or Naglu expression and/or activity, or no measurable activity. For example, the individual having Pompe Disease may have GAA expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal GAA expression levels. For example, the individual having San B may have Naglu expression levels that are less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 0.1-5% of normal Naglu expression levels.

(119) In some embodiments, the individual is an individual who has been recently diagnosed with the disease. Typically, early treatment (treatment commencing as soon as possible after diagnosis) is important to minimize the effects of the disease and to maximize the benefits of treatment.

(120) All references cited herein are incorporated herein by reference in their entirety.

(121) The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention.

EXAMPLES

Example 1: Generation of Components for PCSK9 Fusion Proteins

(122) The present invention provides, among other things, methods and compositions for lysosomal targeting of a therapeutic protein (e.g. a lysosmal enzyme) based on a lysosomal targeting moiety. The current example, discloses a general method for producing one or more targeted therapeutic proteins, by generating a translational fusion protein between a lysosmal enzyme and a lysosomal targeting moiety. It will be understood from the teachings within the specification, that in some embodiments, one or more auxiliary proteins may also be produced to form a protein complex with the lysosmal targeting moiety.

(123) The lysosomal enzymes acid alpha-glucosidase (GAA) and N-acetylglucosaminidase (Naglu) were chosen as candidate proteins, since it has been demonstrated that deficiency of each individual protein plays a central role in the development of Pompe disease and Sanpfilippo Syndrome (Mucopolysaccharidosis III) Type B, respectively. However, it will be understood by one skilled in the art, that such an approach is broadly applicable in generating fusion therapeutics for conditions associated with any lysosomal storage disease. It is contemplated that suitable fusion therapeutics of the current invention facilitate cellular uptake and lysosomal targeting and have an enzyme activity substantially similar to the native enzyme.

(124) A lysosomal targeting moiety may be associated with a suitable therapeutic enzyme (e.g., lysosomal enzyme) covalently or non-covalently. For example, a lysosomal targeting moiety may be chemically conjugated to a therapeutic enzyme. Alternatively, a lysosomal targeting moiety may be fused to a therapeutic enzyme as a fusion protein. In yet further embodiments, a lysosomal targeting moiety (lysosomal targeting moiety) may be coupled, and or bound, to an auxiliary protein, to form a protein complex. In this example, a series of two constructs was created, each designed to express GAA or Naglu, fused to PCSK9. While PCSK9 is used as the representative lysosomal targeting moiety, it will be understood by one skilled in the art, that any lysosomal targeting moiety such as, PC proteins, proteins with a CHRD domain, proteins capable of binding to low density lipoprotein receptor (LDLR), amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, or low density lipoprotein receptor-related protein 8 (Lrp8)) or fragment thereof, may be used. For the example, a construct was also generated, encoding an auxiliary protein capable of forming a protein complex with a lysosmal targeting moiety.

(125) PCSK9-GAA

(126) An exemplary PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleid acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker (SEQ ID NO:14). The amino acid sequence resulting from the ranslation of (SEQ ID NO:14) is shown below (SEQ ID NO:17).

(127) TABLE-US-00009 (SEQIDNO:17) MGTVSSRRSWWPLPLLLLLLLLLGPAGARASIPWNLERITPPRYRADEYQPPDGGSLVEV YLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGV AKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCV DLFAPGEDIIGASSDCSTCAVSQSGTAQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFS AKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCA PDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVH TAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASI HASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCV embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image
(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9

(128) An exemplary Naglu-PCSK9 fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding Naglu to a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations via an intervening GlyGlyGly-encoding linker (SEQ ID NO:15). The amino acid sequence resulting from the translation of (SEQ ID NO:15) is shown below (SEQ ID NO:18).

(129) TABLE-US-00010 (SEQIDNO:18) MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAA KPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPA VPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEA IWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQ MRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGS LFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGW LFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGG NHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPD LAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTS IWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELA SLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTL WGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQ AFVLSKQRYPSQPRGDTVDLAKKIFLKYYPRWVAGSWGGGSIPWNLERITPPRYRADEYQ PPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVV SGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVL NAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD embedded image EAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSS FSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRV HCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKV KEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTA VAICCRSRHLAQASQELQ
(1) The amino acid sequence of Naglu signal peptide is underlined.
(2) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(3) The amino acid sequence of the GlyGlyGly linker is underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)

(130) To facilitate formation of a lysosmal targeting moiety protein complex, a suitable auxiliary protein was created by generating a nucleic acid encoding PCSK9 signal peptide and PCSK9 propeptide (SEQ ID NO:16). The amino acid sequence resulting from the translation of (SEQ ID NO:16) is shown below (SEQ ID NO:19).

(131) TABLE-US-00011 (SEQIDNO:19) MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEED GLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQA QAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVF AQ
The amino acid sequence of PCSK9 signal peptide is underlined.
Sig/Pro-PCSK9-GAA

(132) An exemplary Sig/Pro-PCSK9-GAA fusion protein comprising S386A and F379A point mutations was created by connecting a nucleic acid encoding PCSK9 comprising S386A and F379A point mutations to a nucleic acid encoding GAA via an intervening GlyGlyGly-encoding linker. The amino acid sequence resulting from the translation of this DNA is shown below (SEQ ID NO:20).

(133) TABLE-US-00012 MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFL VKMSGDLLELALKLPHVDYIEEDSSVFAQRRRRRSIPWNLERITPPRYRADEYQPPDGGSLV EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDA GVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLN AACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGR CVDLFAPGEDIIGASSDCSTCAVSQSGTAQAAAHVAGIAAMMLSAEPELTLAELRQRLIH FSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVAR CAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCS VHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHRE ASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNT embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image
(1) The amino acid sequence of PCSK9 signal peptide is underlined.
(2) The amino acid sequence of PCSK9 propeptide is in italics.
(3) The amino acid sequence of a Furin proteolytic cleavage site is bolded and underlined.
(4) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(5) The amino acid sequence of the GlyGlyGly linker is underlined.
(6) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.

(134) Nucleic acids encoding a fusion protein and an auxiliary protein can be individually subcloned into mammalian expression vectors of choice. These expression constructs may then be transfected into a human cell line, and the cell line may be screened to generate over-expressing cell clones. To produce functional targeted therapeutics, a fusion protein is co-espressed with an auxiliary protein, for example PCSK9 propeptide, to ensure proper association between the two, which ensures endocytosis of the complex.

(135) SEQ ID NO:17-19 are amino acid sequences which still contain the amino acids of PCSK9 or Naglu N-terminal signal peptides. These signal peptides are typically removed during intracellular processing and and are typically not present in the final targeted therapeutic drug product. Below are depitcted the amino acid sequences of targeted therapeutics resulting from, in order, expression of proteins defined by SEQ ID NO:17-19:

(136) PCSK9-GAA

(137) TABLE-US-00013 (SEQIDNO:21) SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDG TRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIR KSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAP EVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCAVSQSGTAQAAAH VAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVC RAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWE VEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVAC EEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQ embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image 0embedded image embedded image embedded image embedded image embedded image embedded image embedded image embedded image
(1) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold) is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of Mature Form GAA Protein (aa70-952) is bold and in italics.
Naglu-PCSK9

(138) TABLE-US-00014 (SEQIDNO:22) DEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRVRGST GVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSY SFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAF LAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRV FPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEM QPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQFWGPAQIRAVLGAVPRG RLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPN STMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGA AWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLA TSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLA SDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANY YTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKK IFLKYYPRWVAGSWGGGSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEG RVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKG TVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDAC embedded image AAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGA GWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHN AFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTH KPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCS ALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
(1) The amino acid sequence of Mature Form of Naglu is not underlined, bold or in italics.
(2) The amino acid sequence of the GlyGlyGly linker is underlined.
(3) The amino acid sequence of PCSK9 Mature Protein (except mutations F379A and S386A, which are underlined and bold as well) is in italics.
PCSK9-Propeptide (PPP)

(139) TABLE-US-00015 (SEQIDNO:23) QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL LELALKLPHVDYIEEDSSVFAQ

(140) SEQ ID NO:20 is an amino acid sequences which still contains the amino acids of the PCSK9 N-terminal signal peptide and propeptide. It is envisioned that the signal peptide is typically removed during intracellular processing and is typically not present in the final targeted therapeutic drug product. The Furin proteolytic cleavage site will be cleaved intracellularly and the fusion comprising PCSK9 and GAA will form a complex with the released propeptide.

(141) For protein based assays and receptor binding experiments, recombinant protein may be produced in a wave bioreactor, using a mammalian cell culture expressing system. Following expression, protein/protein complexes may be purified using conventional protein purification methods.

Example 2: Activity Assay

(142) Following purification, each fusion protein can be evaluated for proper function, by examining its specific activity and enzyme kinetics using a well-defined cleavable substrate. Based on this analysis, PSK9-GAA- and Naglu-PCSK9 binding constants and specificity for the enzyme substrate can be compared to each respective wildtype lysosomal enzyme, to ensure enzyme function is similar to the native protein.

Example 3: Fusion Protein Binding Studies

(143) Studies will also be carried out to determine the binding properties of PCSK9-GAA and Naglu-PCSK9 fusion proteins, and evaluate their specificity for various cognate protein binding partners. For the approach, a surface plasmone resonance (SPR) assay will be employed using standard techniques.

(144) There are four possible scenarios of carrying out this SPR assay. Firstly, the binding protein (such as, but not limited to this listed in Table 6 below) serving as ligand are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. A solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the analyte, is then injected into the device. Secondly, the PCSK9-GAA or Naglu-PCSK9 protein, serving as ligand, are diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. A solution containing the binding proteins (such as, but not limited to this listed in Table 6 below), serving as the analyte, is then injected into the device. Thirdly, a capturing molecule, such as an anti-PCSK9-GAA or anti-Naglu-PCSK9 antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing PCSK9-GAA or Naglu-PCSK9, serving as the ligand, is injected into the microflow system and run over surface to bind the antibody to form a capture complex. A solution containing binding protein, serving as the analyte, is then injected into the device.

(145) Fourthly, a capturing molecule, such as anti-binding protein antibody, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant binding protein (such as, but not limited to, those listed in Table 6 below), serving as the ligand, is injected into the microflow system and run over surface to bind the antibody to form a capture complex. A solution containing purified PCSK9-GAA or Naglu-PCSK9 protein, serving as the analyte, is then injected into the device.

(146) In all four scenarios, as the solution runs over the SPR sensor chip, the analyte binds to the ligant and/or capture complex, and an increase in SPR signal (expressed in response units, RU) is observed. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, resulting in dissociation of the interaction between analyte and ligant and/or capture complex, inn turn resulting in a decrease in SPR signal.

(147) TABLE-US-00016 TABLE 6 Potential PCSK9 Secondary Binding Proteins Low Density Lipoprotein Receptor (LDLR) Amyloid Precursor-like Protein 2 (APLP2) Dynamin Amyloid Precursor Protein (APP) Autosomal Recessive Hypercholesterolemia (ARH)

(148) Proposed experimental conditions for use with the surface plasmone resonance (SPR) assay are described in Table 7 below.

(149) TABLE-US-00017 TABLE 7 Experimental Design For Exemplary Surface Plasmone Resonance Assay (Scenario 4) Capturing Analyte Flow Association Dissociation Molecule Ligand Analyte Conc. Rate Time Time anti- Protein Naglu-PCSK9 0 nM 30 l/min 300 sec 300 sec binding from Naglu-PCSK9 0.625 nM protein Table 6 Naglu-PCSK9 1.25 nM.sup. antibody Naglu-PCSK9 2.5 nM Naglu-PCSK9 5 nM Naglu-PCSK9 10 nM Naglu-PCSK9 20 nM anti- Protein PCSK9-GAA- 0 nM 30 l/min 300 sec 300 sec binding from PCSK9-GAA 0.625 nM protein Table 6 PCSK9-GAA 1.25 nM.sup. antibody PCSK9-GAA 2.5 nM PCSK9-GAA 5 nM PCSK9-GAA 10 nM PCSK9-GAA 20 nM

(150) To evaluate the overall specificity of each PCSK9 fusion protein, a competitive inhibition study may also be performed using a SPR assay. For the study, a purified protein comprising one or more human CHRD domains, referred to as an inhibitor protein, can be used. Since it is suggested that PCSK9 binds to cognate proteins via it's CHRD domain, the protein can competitively inhibit binding between PCSK9 and the potential target binding partner. Alternatively, an antibody that binds to the PCSK9 binding site on the human LDLR, referred to as an LDLR blocker, may also be used. Briefly, anti-binding protein antibody, the capturing molecule, is diluted in immobilization buffer and bound to the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant protein (such as, but not limited to, amyloid precursor-like protein 2 (APLP2), Dynamin, amyloid precursor protein (APP), autosomal recessive hypercholesterolemia (ARH) protein, and low density lipoprotein receptor-related protein 8 (Lrp8)) or LDLR, serving as the Ligand, is injected into the microflow system and run over the surface to bind the antibody to form a capture complex. A solution containing purified Naglu-PCSK9 or PCSK9-GAA protein with or without 20 M inhibitor protein is injected into the device and analyzed for binding. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal. The experimental conditions used for the assay are described in Table 8 below.

(151) TABLE-US-00018 TABLE 8 Experimental Design For Exemplary Surface Plasmone Resonance Assay Capturing Analyte Inhibitor Flow Assoc. Dissoc. Molecule Ligand Analyte (Conc.) (Conc.) Rate Time Time anti- protein Naglu-PCSK9 0.0 nM 0.0 M 30 l/ 300 sec 300 sec binding from Naglu-PCSK9 0.0 nM 20 M min protein table 6 Naglu-PCSK9 0.625 nM 20 M antibody Naglu-PCSK9 1.25 nM 20 M Naglu-PCSK9 2.5 nM 20 M Naglu-PCSK9 .sup.5 nM 20 M Naglu-PCSK9 10 nM 20 M Naglu-PCSK9 20 nM 20 M anti- protein PCSK9-GAA 0.0 nM 0.0 M 30 l/ 300 sec 300 sec binding from PCSK9-GAA 0.0 nM 20 M min protein table 6 PCSK9-GAA 0.625 nM 20 M antibody PCSK9-GAA 1.25 nM 20 M PCSK9-GAA 2.5 nM 20 M PCSK9-GAA .sup.5 nM 20 M PCSK9-GAA 10 nM 20 M PCSK9-GAA 20 nM 20 M

(152) The inverse study can also be performed to evaluate competitive inhibition of Naglu-PCSK9 and PCSK9-GAA by an inhibitor protein or LDLR blocker (an antibody that blocks PCSK9 binding to the LDLR), in which the concentration of each PCSK9 fusion protein is held constant and assayed against varying concentrations of inhibitor protein or LDLR blocker. Briefly, anti-binding protein antibody capturing molecule is diluted in immobilization buffer and bound on the dextran surface of a SPR sensor chip housed in a microfluidic system. Next, a solution containing recombinant protein, serving as the ligand, is injected into the microflow system and run over surface to bind the antibody to form a capture complex. A solution containing each purified PCSK9 fusion protein at 20 nM, along with 0-1.5 uM of inhibitor protein or LDLR blocker, is injected into the device and analyzed for binding. After a predetermined period of time, a solution without the analyte is injected into the microfluidic device, dissociating any possible interaction between the analyte and the capture complex, and resulting in a decrease in SPR signal. The experimental conditions for use in performing the assay are described in Table 9 below.

(153) TABLE-US-00019 TABLE 9 Experimental Design For Exemplary Surface Plasmone Resonance Assay Capturing Analyte Inhibitor Flow Assoc. Dissoc. Molecule Ligand Analyte (Conc.) (Conc.) Rate Time Time anti- protein Naglu-PCSK9 20 nM 0.0 nM 30 l/ 300 sec 300 sec binding from Naglu-PCSK9 20 nM 25 nM min protein table 6 Naglu-PCSK9 20 nM 50 nM Naglu-PCSK9 20 nM 100 nM Naglu-PCSK9 20 nM 200 nM Naglu-PCSK9 20 nM 400 nM Naglu-PCSK9 20 nM 600 nM Naglu-PCSK9 20 nM 1.0 M Naglu-PCSK9 20 nM 1.5 M anti- protein PCSK9-GAA 20 nM 0.0 nM 30 l/ 300 sec 300 sec binding from PCSK9-GAA 20 nM 25 nM min protein table 6 PCSK9-GAA 20 nM 50 nM PCSK9-GAA 20 nM 100 nM PCSK9-GAA 20 nM 200 nM PCSK9-GAA 20 nM 400 nM PCSK9-GAA 20 nM 600 nM PCSK9-GAA 20 nM 1.0 M PCSK9-GAA 20 nM 1.5 M

Example 4: In Vitro Studies

(154) Cellular Uptake Assays

(155) Studies may also be performed to assess lysosomal targeting and cellular uptake of lysosomal targeted therapeutics, in accordance with the claimed invention. In this particular representative example, a lysosmal targeting assay is described that uses PCSK9-GAA and Naglu-PCSK9 fusion proteins. However, one skilled in the art will appreciate that Example 4 teaches a general assay method that may be used to evaluate any lysosomal targeted therapeutic in accordance with the teachings of the instant application. The cell line of choice for this assay is C2C12 cell, which is a mouse myoblast cell lines (Yaffe D. and Saxel O; Serial passaging and differentiation of myogenic cells isolated from dystrophic mouse muscle; Nature 270 (5639): 725-727 (1977)) that has been utilized by scientists estimating the cellular uptake of GAA into muscle cells. The C2C12 cells are grown to confluence and treated with a solution of recombinant Naglu-PCSK9 or PCSK9-GAA, which is complexed with recombinant PCSK9-Propeptide (PPP). After a specified period of time, supernatant is removed, cells washed repeatedly; and following lysis each sample is assayed for Naglu and/or GAA enzyme activity.

(156) Visualization of Lysosomal Targeting and Entry of Naglu-PCSK9 and PCSK9-GAA

(157) Studies may also be carried out to evaluate cellular lysosomal targeting and entry using fluorescent immunomicroscopy. For the study, C2C12 cell lines, as described above, are treated with or without recombinant Naglu-PCSK9 or PCSK9-GAA which has been complexed with PPP. Following treatment, the cells are fixed and prepared for staining. Both control and treated cells are stained using antibodies specific for each lysosomal protein (GAA or Naglu) along with Lamp-1, a lysosome specific protein biomarker. Cells are assayed for cellular internalization of each fusion protein by immunofluroescent microscopy.