CHIMERIC GENE FOR HETEROLOGOUS EXPRESSION WHICH ENCODES FOR PEPTIDES WITH ANTIMICROBIAL ACTIVITY
20200040046 · 2020-02-06
Inventors
- Eduardo Andrés Tapia Rodríguez (Santiago, CL)
- Christian Fernando Montes Serey (Santiago, CL)
- Humberto Godofredo Prieto Encalada (Santiago, CL)
- Fabiola Alejandra Altamira Passalacqua (Santiago, CL)
- Gloria María Arenas Díaz (Santiago, CL)
Cpc classification
International classification
Abstract
The present invention relates to a chimeric nucleotide sequence encoding peptides with antimicrobial activity, to be expressed on plants as bioreactors, plant cell or transformed plant material and E. coli, where plants and bacteria were used for scale-up production of antimicrobial peptide and that produces the peptide sequence derived from SEQ ID No. 1, SEQ ID No. 6 and SEQ ID No. 12. It includes a method for obtaining the amino acids sequence SEQ ID No. 9 derived from a chimeric nucleotide sequence which encodes to antimicrobial peptides, wherein said amino acids sequence is derived from the synthetic DNA sequence SEQ ID No. 1, obtained from a back-translation of the amino acid sequence of the peptide Ap-S of Argopecten purpuratus scallop.
Claims
1. A method for obtaining the amino acids sequence SEQ ID No. 9 derived from a chimeric nucleotide sequence which encodes antimicrobial peptides, wherein said amino acids sequence is derived from the synthetic DNA sequence SEQ ID No. 1, obtained from a back-translation of the amino acid sequence of the peptide Ap-S of Argopecten purpuratus scallop.
2. A method for obtaining amino acids sequence SEQ ID No. 9 according to claim 1 to confer resistance or tolerance to plant pathogenic fungi or bacteria on a plant, wherein said amino acids sequence is obtained from a protein extraction of inclusion body from recombinant E. coli.
3. A method for obtaining antimicrobial peptide, SEQ ID No. 9 according to claim 2, wherein said antimicrobial peptide fraction is separated in one step with a size exclusion chromagraphy column of the peptide after an enzymatic hydrolysis and refolding of the encoded protein of the gene SEQ ID No. 12, avoiding their treatment with ionic chromatographical columns or with hplc methods.
4. A method for obtaining antimicrobial peptide, SEQ ID No. 9 according to claims 1-3 wherein said antimicrobial peptide obtained from E. coli correspond to a method for mass purification and production.
5. A method for obtaining the amino acids sequence SEQ ID No. 9 according to claim 1 by means of the plant as a bioreactor, plant cell or transformed plant material that produces the peptide sequence derived from the synthetic DNA sequence SEQ ID No. 1, wherein said antimicrobial peptide obtained from N. tabacum is a method for mass production.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
DETAILED DESCRIPTION OF THE INVENTION
[0014] The present invention relates to the generation of a nucleotide sequence encoding for antimicrobial peptides.
[0015] The technical basis of the present invention is that, despite knowing the existence of peptides with antimicrobial activity for eukaryotic organisms such as shellfish, it is only possible to extract only a small amount of peptide from animal tissue; this forces us to look for alternative techniques of production, such as chemical synthesis, which despite allowing generate greater amounts of peptide, it is limited by its high cost. An alternative is the use of genetic engineering and the use of heterologous expression systems to produce appropriate amounts in recombinant organisms. The advantage of this alternative technique is that through it greater amounts of peptide can be produced that will allow a more complete characterization and the actual evaluation of their biotechnological potential. However, this developmental pathway has some difficulties presented by the fact that there are many possible combinations of nucleotides derived from uses of codons, to correctly define a final active peptide.
[0016] The invention provides a synthetic gene for the AMP, Ap-S, which allows obtaining large amounts and raise its projection to the use in various industrial problems, such as agriculture.
[0017] In order to obtain adequate amounts of rAp-S peptide, we proceeded to design the synthetic gene and establishing a cloning strategy of synthetic sequence in an expression vector, in order to provide synthetic peptides that are suitable for controlling fungi and bacteria, and also provide synthetic peptides in quantities sufficient to be used as antipathogenic agents for activities such as agriculture, veterinary and/or medicine.
EXAMPLES
Example 1
[0018] Design of the Synthetic Gene: The Ap-S cDNA was designed using the reverse-translation of the sequence of 31 amino acids (MPVGIVIAPKKSPFTAKKPGPVLSGVKAGPG) (SEQ ID No. 9) previously described based on Argopecten purpuratus hemocytes. Using GCUA software (Fuhrmann et al., 2004) and codons from E. coli and N. tabacum, a synthetic gene for rAp-S (SEQ ID No. 1) was obtained. A recognition site for the TEV-protease in the 5 end was added. Two full oligonucleotide sequences, TEV/rAp-S and TEV/rAp-Sx2 [TEV/rAp-S::TEV/rAp-S] were synthetized at Integrated DNA Technologies, Inc. (Iowa, U.S.A.) and cloned into a pSMART vector (Lucigen, Middletown, Wis.), generating the vectors pSMART-TEV/rAp-S and pSMART-TEV/rAp-Sx2 (
Example 2
[0019] Generation of the Donor-gene Vector for Expression in E. coli: Using pSMART-TEV/rAp-S and pSMART-TEV/rAp-Sx2 as templates, additional attB recombination sequences were flanked at TEV/rAp-S and TEV/rAp-Sx2 ends using a double PCR amplification strategy. In the first step (pre-amplification), adapter-primers adpF (SEQ ID No. 2) and apdR (SEQ ID No. 3) were used to amplify a fragment of 147 bps [adpF::TEV/rAp-S::adpR] and 261 bps [adpF::TEV/rAp-Sx2::adpR]. The PCR reaction was performed in a total volume of 50 L containing 5 L of Accuprime Pfx reaction mix 10 times. (Invitrogen, Carlsbad, Calif.), 1 L of each primer (10 mM), 0.5 L AccuPrime Pfx DNA polymerase (2.5 U/L; Invitrogen), 0.5 L of pSMART-TEV/rAp-S (1:100 diluted) and pSMART-TEV/rAp-Sx2 (1:100 diluted) and 42 L of H.sub.2O for each reaction. The thermal profile was a starting denaturation step at 95 C. for 2 min followed by 10 cycles of 94 C. for 15 s, 55 C. for 30 s and 68 C. for 135 s. A second round of PCR was performed on 10 L of the pre-amplified product using the primers attB1 (SEQ ID No. 4) and attB2 (SEQ ID No. 5) resulting in the synthesis of a 181 bps fragment (SEQ ID No. 6) [attB1::TEV/rAp-S::attB2] (
[0020] A Gateway LR recombination reaction was performed between pDNOR207-TEV/rAp-Sx2 and pDEST17 (Invitrogen, U.S.A.) (
Example 3
[0021] Expression and purification of AMP in E. coli BL21 (DE3): A strain of E. coli BL21 was inoculated into 5 mL of LB medium containing 100 mg/L carbenicillin and grown overnight at 37 C. under agitation at 180 rpm. Then the 5 mL were used as inoculum for 100 mL of LB medium and grown for 3 h, with the same concentration of antibiotic and growth described conditions. After this period, the culture medium was supplemented with isopropyl-b-D-thio-galactopyranoside (IPTG) 1 mM for induction of protein.
[0022] Cultivation was continued for 3 more hours and finally centrifuged at 5000 rpm for 10 min to form a pellet of bacteria and the supernatant was carefully removed. The pellet was mixed by vortexing and pipetting the solution B-PER (Thermo Scientific) in a ratio of 4 mL of B-PER per gram of pellet, adding 2 L of Lysozyme (Thermo Scientific) and 2 mL of DNase I (Thermo Scientific) per mL of B-pER used. The mixture was incubated under constant stirring for 15 min. Then the lysate was centrifuged at 15,000 x g for 5 min to separate the soluble fraction from the insoluble which was removed carefully with pipette. The insoluble fraction was again suspended in the solution Solubilization Inclusion Body Reagent (Thermo Scientific) at a ratio of 8 mL of solution per g of insoluble pellet. The mixture was homogenized under constant agitation for 30 min at room temperature. Once homogenized, it was centrifuged at 27,000g for 15 min and the supernatant containing the re-solubilized fraction is collected. Then proteolysis of 100 g of recombinant protein with protease ProTEV Plus (Promega) was performed at 30 C. overnight under manufacturer's instructions. Fractions of peptides released from proteolysis are re-naturalized with a dialysis cassette Slide-A-Lyzer Dialysis Cassette G2 2.0 MWCO (Thermo Scientific) and protease inhibitor decreasing the concentration of 6M UREA with Tris 25 mM, pH=5.0 each 8 h during 5 d to final 25 mM Tris solution, 150 mM NaCl pH=5.0. Finally, the peptides released by proteolysis and re-naturalized are passed through the 0.5 mL Pierce Concentrator 10K MWCO PES column (Thermo Scientific) where the eluate from the column contain the peptides discarding E. coli proteins. The visual confirmation was made with TTS gel for the resolution of peptides (Schagger, 2006).
Example 4:
[0023] Mass Spectrometry Analysis of Purified pre-TEV/rAp-S and rAp-S: Re-purified samples of the peptides were automatically analyzed in an ABi4800 MALDI TOF/TOF mass spectrometer (Applied Biosystems, Framingham, Mass., U.S.A.) under positive ion reflector mode (ion acceleration voltage of 25 kV for MS acquisition and 1 kV for MSMS) or linear mode for peptides 4 kDa. The resulting spectra were stored in the ABi4000 Series Explorer Spot Set Manager. The MS and MSMS fragment ion spectra were smoothed and corrected to zero-baseline using routines embedded in the ABi4000 Series Explorer Software v3.6. External calibration was used to reach a typical mass measurement accuracy of <25 ppm.
Example 5
[0024] Recombinant Peptide Expression in Nicotiana tabacum
[0025] a) Construction of input vector with pDONRP4-P 1 R and pDONR221. The ankyrin promoter sequence was amplified with the primers attB4 (5-GGGGACAACTTTGTATAGAAAAGTTGTC-NNN-3) (SEQ ID No. 7) and attB1r (5-GGGGACTGCTTTTTTGTACAAACTTGC-NNN-3) (SEQ ID No. 8), and the rAp-S sequence was amplified with attB1 (5-NNN3 GGGGACAAGTTTGTACAAAAAAGCAGGCTTC-3) (SEQ ID No. 10) and attB2 (5-GGGGACCACTTTGTACAAGAAAGCTGGGTC-NNN-3) (SEQ ID No. 11), where NNN represents the specific nucleotide sequence. The following PCR conditions were used: 5 L of Reaction Mix 10 AccuPrime Pfx (Invitrogen), 4 L of each primer (10 mM each), 0.5 L of AccuPrime Pfx DNA Polymerase (2.5 U/L; Invitrogen), 0.5 L of vine genomic DNA and 36 L of ddH2O. The thermal profile was initial denaturation at 95 C. for 2 min, followed by 29 cycles with denaturation at 94 C. for 15 sec, annealing at 55 C. for 30 sec and extension at 68 C. for 2 min 15 sec. The results of the amplifications were visualized by electrophoresis on a 1% agarose gel with ethidium bromide staining (Sambrook et al., 1989). The bands corresponding to the expected size were cut and purified with Qiaexll Gel Extraction Kit (Qiagen, Germany) according to the manufacturer's instructions. The purified fragments of this reaction were used for recombination with the pDONRP4-P1 R and pDONR221 vectors (Invitrogen) with BP Clonase (Invitrogen) following the manufacturer's instructions. The vectors were cloned in E. coli DHSa grown in LB medium supplemented with 50 mg/L kanamycin.
[0026] b) Construction of expression vector with R4pGWB401. For the construction of the plant expression vector, the vectors pDONRP4-P1R-Ankyrin and pDONR221-rAp-S containing the regulatory and coding sequences, respectively, were recombined with vector R4pGWB401 (Nakagawa et al., 2009) using LR Clonase (Invitrogen). The resulting vector was cloned in E. coli DH5 grown in LB medium supplemented with 50 mg/L spectinomycin.
[0027] c) Construction of expression vector with pGWB502. For the construction of the plant expression vector, the pDONR207-TEV/rAp-S vector containing the chimeric gene and the target vector pGWB502 (Nakagawa et al., 2007) were recombined using LR Clonase (Invitrogen). The resulting vector was cloned in E. coli DH5 and grown in LB medium supplemented with 50 mg/L spectinomycin.
[0028] d) Transformation of tobacco: For obtaining genetically modified tobacco plants with the expression vector, the protocol of Sparkes et al. (2006) was used. Young leaves of approximately 4-6 weeks were infiltrated with a solution containing acetosyringone 1 M, sodium orthophosphate dodeca-hydrate (Na.sub.3PO.sub.4.12H.sub.2O) 2 mM, IVIES (2-[N-morpholin]-ethanesulfonic acid; Phytotechnology Labs) 50 mM, D-glucose 25 mM and A. tumefaciens 3101 (OD.sub.600=0.3) harboring the vector to evaluate the plant material. After 72 hours of infiltration, the leaves of the plant were removed, sterilized with a 10% solution of sodium hypochlorite, washed with sterile ddH.sub.2O and cut into square pieces of approximately 1 cm.sup.2. The fragments were cultured in Petri dishes containing 4.43 g/L germination medium (MS-S) of Murashige and Skoog (1962), supplemented with vitamins (Phytotechnology Labs, U.S.A.), 0.8% (w/v) agar TC (Phytotechnology Labs), 3.0% (w/v) sucrose (Phytotechnology Labs), 0.1 mg/L indole butyric acid (IBA, Sigma Aldrich, U.S.A.), 0.8 mg/L 6-benzylaminopurine (BAP; Sigma Aldrich), 200 mg/L carbenicillin (Sigma Aldrich), 200 mg/L timentin (Phytotechnology Labs) and 300 mg/L kanamycin (Phytotechnology Labs). The explants were maintained in MS-S to sprout, which occurred in approximately 3 weeks. Subsequently, the shoots were excised and cultured for two weeks in Petri dishes with 4.43 g/L rooting medium (MS-R) of Murashige and Skoog supplemented with vitamins, 0.8% (w/v) TC agar, 3.0% (w/v) sucrose, 0.5 mg/L indole butyric acid (IBA), 200 mg/L carbenicillin, 200 mg/L timentin and 300 mg/L kanamycin. Finally, regenerated plantlets were planted separately in flasks (150 mL) containing base MS medium (4.43 g/L of Murashige and Skoog supplemented with vitamins, 0.8% [w/v] national agar (Veronica Sepulveda, Chile) and 3.0% [w/v] sucrose). The plants were maintained in this medium until evaluation.
Example 6
[0029] Functionality Tests of Peptides Produced in Bacteria and Plants:
[0030] a) Evaluation of Peptides obtained in E. coli: Isolates from Botrytis cinerea, Fusarium oxysporum, Trichoderma harzianum and Alternaria spp. were treated with the purified fractions of the digested and non-digested peptides (pre-TEV/rAp-S and rAp-S) derived from the selected recombinant clone of E. coli (Example 3).
[0031] The potential antifungal abilities of both peptides were evaluated by analysis of the growth patterns of these fungi on agar PDA (potato-dextrose) in Petri dishes supplemented with protein extracts at 500 g/L (162 nM) and 250 g/L (81 nM), respectively.
[0032] The control growth assays were performed on PDA dishes without peptides. The growth patterns were evaluated according the amount of time required for the fungi to reach the dish walls in the control plates (10 days after inoculation in darkness at room temperature). Structural images of the fungi hyphae patterns were obtained using a Olympus microscope (Center Valley, Pa., U.S.A.), and spores were counted using a Neubauer camcorder (Brand, Wertheim, Germany) at 40. The data were subjected to analyses of variance, and averages were separated by the least significant difference test (LSD) at the 5% level of significance using Statgraphics Centurion XV (Manigistics Inc., Rockville, Md., U.S.A.). Petri dishes containing grown fungi were scanned and digitalized for statistical processing. The area of the mycelia was quantified using Gel-Pro Analyzer 4.0 (Media Cybernetics, Minneapolis, Minn., U.S.A.), and surface values in pixels were transferred to Excel (Microsoft Corporation, U.S.A.) for analysis. The average value of the colored haloes was calculated using scanned images of five repetitions on the tenth day after inoculation. The collected data were subjected to variance analysis, and the averages separated by LSD at the 5% level of significance. The confrontation results of the peptides are shown in tables 1 and 2. Table 1 shows the spore count. Table 2 shows the quantification of the area of the mycelium in pixels.
TABLE-US-00001 TABLE 1 The spore count Spore count Purified Trichoderma Botrytis Alternaria Fusarium peptide harzianum cinerea sp oxysporum fraction average DE LSD average DE LSD average DE LSD average DE LSD rApS 5.0 10.sup.6 1.0 10.sup.5 a 1.02 10.sup.6 2.31 10.sup.5 A 0 0 a 7.6 10.sup.5 8.98 10.sup.4 a Spore count Purified Trichaderma Botrytis Alternaria Fusarium peptide harzlanum cinerea sp oxysporum fraction Average SD LSD Average SD LSD Average SD LSD Average SD LSD rAp-S 5.0 10.sup.6 1.0 10.sup.5 a 1.02 10.sup.6 2.31 10.sup.5 a 0 0 a 7.6 10.sup.5 8.98 10.sup.4 a Pre-TEV/rAp-S 1.40 10.sup.7 1.55 10.sup.6 b 5.98 10.sup.5 8.92 10.sup.4 a 1.82 10.sup.6 2.33 10.sup.5 b 1.17 10.sup.6 7.27 10.sup.4 b Control 2.14 10.sup.7 1.57 10.sup.6 c 9.17 10.sup.6 4.93 10.sup.5 b 3.15 10.sup.6 9.29 10.sup.4 c 1.76 10.sup.6 .sup.1.31 10.sup.5 c
TABLE-US-00002 TABLE 2 Quantification of the area of the mycelium in pixels Central Area (pixels) Petri Trichoderma Botrytis Alternaria Fusarium dish/agar harzianum cinerea sp oxysporum PDA plus: average DE LSD average DE LSD average DE LSD average DE LSD rApS 85718 12155 a 170781 69412 A 412403 14385 a 511699 55046 a Pre-TEV/rApS 623533 95785 b 235089 24328 A 430672 7665 a 498691 78927 a Control 820412 42611 c 824804 53429 B 460848 18115 b 670810 98093 b Central area (pixeles) Petri Trichoderma Botrytis Alternaria Fusarium dish/agar harzianum cinerea sp oxysporum PDA plus: Average SD LSD Average SD LSD Average SD LSD Average SD LSD rAp-S 85718 12155 a 170781 69412 a 412403 14385 a 511699 55046 a Pre-TEV/rAp-S 623533 95785 b 235089 24328 a 430672 7665 a 498691 78927 a Control 820412 42611 c 824804 53429 b 460848 18115 b 670810 98093 b
Example 7
[0033] Growth Inhibition Assays at Different Concentrations of Peptide rAp-S: The inoculation of 5 mL of LB was performed with 100 L of bacteria (Xanthomona campestris and Clavibacter michiganensis), followed by overnight culturing. The absorbance was quantified at OD600. Once the Abs was quantified, dilutions were made to obtain an Abs to inoculate each tube with the same concentration of bacteria with an initial OD600 of 0.04. Different peptide concentrations were used. Each tube was inoculated with an rAp-S peptide concentration, as shown in Tables 3 and 4. A final volume of 10 mL in a 50 mL tube was used. In addition, a control without peptide was used for each bacterium. The kinetics of the process was followed for 8 h from time zero, determining the Abs every 2 h. The sample was 1 mL, as shown in
TABLE-US-00003 TABLE 3 Specific growth rate for Xanthomona campestris, and its comparison to LSD Xanthomona campestris Tube (h.sup.1) SD LSD Control 0.385 0.011 a 1 g/L 0.371 0.011 a 10 g/L 0.375 0.012 a 100 g/L 0.386 0.007 a 1 mg/L 0.329 0.014 b 2 mg/L 0.015 0.002 c 3 mg/L 0.012 0.002 a 4 mg/L 0.019 0.002 a
TABLE-US-00004 TABLE 4 Specific growth rate for Clavibacter michiganensis, and its comparison to LSD Clavibacter michiganensis Tube (h.sup.1) SD LSD Control 0.072 0.011 a 1 g/L 0.070 0.008 a 10 g/L 0.069 0.010 a 100 g/L 0.075 0.010 a 1 mg/L 0.069 0.006 a 2 mg/L 0.069 0.009 a 3 mg/L 0.073 0.009 a 4 mg/L 0.066 0.009 a 12.5 mg/L 0.009 0.001 b 15.5 mg/L 0.003 0.0003 b
[0034] b) Evaluation of the rAp-S Produced in Nicotiana tabacum
[0035] For the evaluation of the rAp-S produced in Nicotiana tabacum, total protein was extracted from 14 transgenic lines, and 30 g of total protein from each plant was spread on a Petri plate containing PDA. Each plate was inoculated with a suspension of 210.sup.9 spores of T. harzianum as the growth inhibition indicator. After 7 d, the growth inhibition was determined visually, and no biological or statistical analysis was performed if there was any plaque inhibition. The three top lines that generated some degree of growth inhibition were selected, and a further test was performed with 60, 90 and 120 g of total protein in the same plate. The plate was divided into four equal areas, and in each area, a Whatman paper disk was placed on the edge with the required peptide amount or a water control. All peptide amounts (60, 90 and 120 g) were added to a volume of 100 L to ensure that the experiment was more homogeneous. Each plate was inoculated with a spore suspension of 210.sup.9 of T. harzianum in the center. After 3 days, the inhibition area was determined with the program Pro Analyzer Gel using the disk peptide areas where the fungus did not grow (
TABLE-US-00005 TABLE 5 Inhibition area of Trichoderma harzianum, in pixels Petri dish Inhibition area of Trichoderma harzianum (pixeles) PDA Control Nt LT Nt 9 LT Nt 12 LT Nt 15 plus Average SD LSD Average SD LSD Average SD LSD Average SD LSD water * * ** * * ** * * ** * * ** 60 g * * ** 221.67 0.47 a 3416.5 94.5 a 1048.67 26.4 a 90 g * * ** 516 108 b 3340 37 a 1930.5 36.5 b 120 g * * ** 605 169.41 b 4185.5 271.5 b 2741 20 c Inhibition of T. harzianum with total protein Extracts from Transgenic lines (LT) of Nicotiania tabacum (NT) at increasing amounts (60, 90 and 120 g) and a water control. The control Nt was a non transgenic plant. * No inhibition; ** No statistical analysis
[0036] These experimental examples were exemplifying and not limiting. Although the yields obtained and the activity of the recombinant peptide were successful in their objective of producing rAp-S active against economically relevant pathogens using bacteria and plants as sources of expression, the present invention does not exclude the potential use of this chimeric gene to express the said AMP in additional expression systems, such as yeast. The use of a medium/large scale of such peptides is desirable for the control of plant pests.
[0037] Optionally and as a non-limiting method, the methodology to be used for the implementation of the total protein extract of N. tabacum can be performed together with a suitable carrier.
[0038] Protein extraction was performed with a basic extraction buffer consisting of 1 M sodium chloride, 0.1 M sodium acetate, 1% PVP, 10 mM -mercaptoethanol, 0.25% v/v Triton X-100, and 20% glycerol. This total extract can be diluted to the required concentration in ddH.sub.2O (pH between 4 and 5) and sprayed onto the plants. The plants can also be treated using alternative means.
[0039] The extracts of total protein from E. coli were prepared from the method described in Example 3 and then diluted in ddH2O (pH between 4 and 5) to the concentration required for spraying.
[0040] These preparations are suitable for the direct application to crops, plants, plant parts, roots and/or soil that is healthy or infested with fungi and/or phytopathogenic bacteria.
[0041] After obtaining the protein extracts from both E. coli and N. tabacum, a lyophilization step can be incorporated, which gives stability to the extract and allows storage at room temperature. Additionally, this step will facilitate the commercialization of the product.
[0042] In short, if the extract is obtained by synthesis in E. coli the process is scaled to high volume bioreactors, ball or disc grinder, continuous or cake centrifuge, extract stripper column and a final lyophilizer to process this volume.
[0043] In the case that the process selected for obtaining the extract uses N. tabacum, an extension of cropland that allows the required demand to be met, ball grinder, continuous or cake centrifuge and a lyophilizer able to process the final high volume should be considered.
Example 8
[0044] In the original method of producing TEV-rAp-S incubation periods between 16 h to 18 h were used at 80 C. in 8M urea buffer for the re-suspended pellet of E. coli BL21, collected from 100 mL of culture. After the incubation and thawing of the mixture, the sample was centrifuged at 23000g for 15 min, the supernatant was collected and submitted to the process of purification through affinity columns with immobilized metals, a process that takes approximately 5 h including regeneration of the column according to the manufacturer instructions for the Kit (QIAexpress Ni-NTA Fast Start, QIAGEN, U.S.A.). The new method for the production of TEV-rAP-Sx2, now does not require incubation at low temperatures, long times and neither the use of affinity chromatography columns. The new methodology is based on generating cell disruption with buffer B-PER (bacterial protein extraction reagent with enzymes; Thermos Fisher Scientific, Meridian, Rockford, U.S.A.), separating the soluble fraction from the insoluble by centrifugation, removing this fraction tube and finally re-suspend the insoluble fraction with the buffer Inclusion Boby Solubilization Reagent (Thermo Fisher Scientific). Subsequently, resuspension is centrifuged at 23,000g during 15 min and the supernatant is collected in which there is an enriched protein fraction of TEV-rApS by 80% (Thermo Scientific Manual) in this case. The values obtained in each case regarding the production of TEV-rAp-S and TEV-rAp-Sx2 are presented in Table 6, associated with their time and yields. After this process, for better purification, TEV-rApSx2 protein is digested by the ProTEV (Promega, U.S.A.) protease obtaining the release of two peptides rAp-S. The obtained rAp-S peptides, according to its low molecular weights are separated from other proteins by exclusion columns for a molecular weight cutoff (MWCO) of 10 kDa (Thermos Fisher Scientific, Meridian, Rockford, U.S.A.), where the eluted from the column is the fraction containing the peptides, being separated from other proteins and protease. This process decreases the times from 24 to 2 h and increases the yield from 185 g/mL to 2.448 g/mL equivalent to an increase of 13 times.
TABLE-US-00006 TABLE 6 Different times and yields for each methodology, for purified proteins TEV-rAp-S and TEV-rAp-Sx2 Purification Original Method New Method Parameters (TEV-rAp-S) (TEV-rAp-Sx2) Time 24 hrs 2 hrs Yield 185 g/mL 2.448 g/mL
[0045] It can be observed from table 6, that the new method and protein TEV-rAp-Sx2 gives a yield up to 13 times more efficient that the one with TEV-rAp-S.
TABLE-US-00007 SEQUENCELISTINGOFTHECHIMERICGENE SEQIDNo.1oftheSyntheticGenerAp-S 5-ATGAAAAATCTTTATTTTCAAGGTATGCCT GTTGGTATTGTTATTGCT5CCTAAAAAATCT CCTTTTACAGCTAAAAAACCTGGTCCTGTT CTGTCTGGTGTTAAAGCTGGTCCTGGTTAA-3 SEQIDNo.2ADPF: 5-AAAAAGCAGGCTTCATGGAAAATCTTTATT TTCAAGGTA-3 SEQIDNo.3ADPR: 5-AGAAAGCTGGGTCTTAACCAGGACCAGCTT TAACACCA-3 SEQIDNo.4ATTB1: 5-GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGAAAATCTTTATTTTC-3 SEQIDNo.5ATTB2: 5-GGGGACCACTTTGTACACGAAAGCTGGGTC TTAACCAGGACCAGCTTTAA-3 SEQIDNo.6: 5-GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGAAAATCTTTATTTTCAAGGTATGCCTGT TGGTATTGTTATTGCTCCTAAAAAATCTCCTTT TACAGCTAAAAAACCTGGTCCTGTTCTGTCTGG TGTTAAAGCTGGTCCTGGTTAAGACCCAGCTTT CTTGTACAAAGTGGTCCCC-3 SEQIDNo.7: GGGGACAACTTTGTATAGAAAAGTTGTCNNN SEQIDNo.8: GGGGACTGCTTTTTTGTACAAACTTGCNNN SEQIDNo.9: MetProValGlyIleValIleAlaProLysLys 1510 SerProPheThrAlaLysLysProGlyProVal 1520 LeuSerGlyValLysAlaGlyProGly 2530 SEQNo.12: GGGGACAAGTTTGTACAAAAAAGCAGGCTTCATGGAAAATCTTTATTTTC AAGGTATGCCTGTTGGTATTGTTATTGCTCCTAAAAAATCTCCTTTTACA GCTAAAAAACCTGGTCCTGTTCTGTCTGGTGTTAAAGCTGGTCCTGGTGA AAATCTTTATTTTCAAGGTATGCCTGTTGGTATTGTTATTGCTCCTAAAA AATCTCCTTTTACAGCTAAAAAACCTGGTCCTGTTCTGTCTGGTGTTAAA GCTGGTCCTGGTTAAGACCCAGCTTTCTTGTACAAAGTGGTCCCC