GENETIC MODIFICATION OF THE AAV CAPSID RESULTING IN ALTERED TROPISM AND ENHANCED VECTOR DELIVERY

20200032220 ยท 2020-01-30

    Inventors

    Cpc classification

    International classification

    Abstract

    Modified AAV vectors and uses thereof are provided.

    Claims

    1. An infectious recombinant adeno-associated virus (AAV) with altered tropism, comprising: a modified viral capsid that provides the altered tropism and which is capsid altered relative to a corresponding virus without the modification in the viral capsid, wherein the modified viral capsid comprises i) an insertion of one or more positively charged amino acid residues in a portion of the capsid that is exposed to the surface, or ii) a substitution of one or more non-positively charged amino acid residues with one or more positively charged amino acid residues in a portion of the capsid that is exposed to the surface, wherein at least one of the positively charged residues is a lysine.

    2. The virus of claim 1 wherein 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 20 amino acids are substituted.

    3. The virus of claim 1 wherein 5 or fewer amino acids are substituted with positively charged amino acid residues.

    4. The virus of claim 1 wherein the insertion comprises 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 20 amino acids.

    5. The virus of claim 1 wherein 5 or fewer amino acids are inserted.

    6. The virus of claim 1 wherein two or more positively charged amino acid residues are substituted or inserted.

    7. The virus of claim 6 wherein at least two of the positively charged residues are adjacent to each other.

    8. The virus of claim 1 wherein the positively charged residues further comprise arginine.

    9. The virus of claim 1 wherein the modification comprises at least two lysine residues.

    10. The virus of claim 1 wherein the AAV is AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, or AAVrh10.

    11. The virus of claim 1 wherein the AAV genome is a recombinant genome having at least one expression cassette for a prophylactic or therapeutic gene product.

    12. The virus of claim 1 wherein the modification is in loop IV or loop VIII of the capsid.

    13. A method to prevent, inhibit or treat a disorder or disease in a mammal, comprising administering to a mammal in need thereof a composition comprising an amount of the virus of claim 1 effective to prevent, inhibit or treat the disorder or disease.

    14. The method of claim 13 wherein the mammal is a human.

    15. The method of claim 13 wherein the composition is systemically administered.

    16. The method of claim 13 wherein the composition is intravenously administered.

    17. The method of claim 13 wherein one or more lysine residues are inserted at a position in loop VIII corresponding to a residue from 570 to 580 in an AAV5 capsid protein.

    18. The method of claim 13 wherein the capsid modification enhances delivery to an organ other than liver.

    19. The method of claim 13 wherein the modification enhances delivery to the lung.

    20. The method of claim 13 wherein the modification enhances delivery to an organ that is different than the virus without the modification.

    Description

    BRIEF DESCRIPTION OF FIGURES

    [0008] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

    [0009] FIGS. 1A-D. Polylysine insertion into AAV5 capsid. A) Ribbon diagram representation of AAV5 VP3 monomer. Amino acid 575 is highlighted in red and polylysine insertion site indicated with green arrow. B) 3D rendering of AAV5 capsid with amino acid 575 highlighted in red. C) AAV5-PK2-AAT construct. The expression cassette including the AAV2 inverted terminal repeats (ITR), encapsidation signal (), CAG promoter, optimized human AAT cDNA, and polyadenylation signal (A.sub.n) was packaged into AAV5 or AAV5-PK2 capsid. D) Coomassie gel showing purified AAV5-PK2-AAT virus.

    [0010] FIG. 2. Experimental protocol.

    [0011] FIGS. 3A-D. Vector DNA distribution after intravenous administration of AAV5-hAAT and AAV5-PK2-hAAT. Whole organs were homogenized and DNA extracted for quantification by qRT-PCR. A) Vector genome copies per g DNA in lung and liver. B) Vector genome copies per total tissue. C) Liver to lung ratio of vector genome copies per g DNA. D) Liver to lung ratio of vector genome copies per total tissue.

    [0012] FIGS. 4A-D. hAAT mRNA distribution after intravenous administration of AAV5-hAAT and AAV5-PK2-hAAT. Whole organs were homogenized, RNA extracted, converted to cDNA, and quantified by qRT-PCR. A) hAAT mRNA copies per g RNA in lung and liver. B) hAAT mRNA copies per total tissue. C) Liver to lung ratio of hAAT mRNA copies per g RNA. D) Liver to lung ratio of hAAT mRNA copies per total tissue.

    [0013] FIGS. 5A-C. hAAT protein in serum and BALF was quantified by ELISA after intravenous administration with AAV5-hAAT and AAV5-PK2-hAAT. A) hAAT serum levels per mg protein. B) hAAT BALF levels per mg protein. C) Ratio of BALF to serum hAAT (per mg protein).

    [0014] FIGS. 6A-B. Vector DNA distribution to other organs after intravenous administration of AAV5-hAAT and AAV5-PK2-hAAT. Whole organs were homogenized and DNA extracted for quantification by qRT-PCR. A) Vector genome copies per g DNA in lung and liver. B) Vector genome copies per total tissue.

    DETAILED DESCRIPTION

    Definitions

    [0015] A vector refers to a macromolecule or association of macromolecules that comprises or associates with a polynucleotide, and which can be used to mediate delivery of the polynucleotide to a cell, either in vitro or in vivo. Illustrative vectors include, for example, plasmids, viral vectors, liposomes and other gene delivery vehicles. The polynucleotide to be delivered, sometimes referred to as a target polynucleotide or transgene, may comprise a coding sequence of interest in gene therapy (such as a gene encoding a protein of therapeutic interest), a coding sequence of interest in vaccine development (such as a polynucleotide expressing a protein, polypeptide or peptide suitable for eliciting an immune response in a mammal), and/or a selectable or detectable marker.

    [0016] Transduction, transfection, transformation or transducing as used herein, are terms referring to a process for the introduction of an exogenous polynucleotide into a host cell leading to expression of the polynucleotide, e.g., the transgene in the cell, and includes the use of recombinant virus to introduce the exogenous polynucleotide to the host cell. Transduction, transfection or transformation of a polynucleotide in a cell may be determined by methods well known to the art including, but not limited to, protein expression (including steady state levels), e.g., by ELISA, flow cytometry and Western blot, measurement of DNA and RNA by hybridization assays, e.g., Northern blots, Southern blots and gel shift mobility assays. Methods used for the introduction of the exogenous polynucleotide include well-known techniques such as viral infection or transfection, lipofection, transformation and electroporation, as well as other non-viral gene delivery techniques. The introduced polynucleotide may be stably or transiently maintained in the host cell.

    [0017] Gene delivery refers to the introduction of an exogenous polynucleotide into a cell for gene transfer, and may encompass targeting, binding, uptake, transport, localization, replicon integration and expression.

    [0018] Gene transfer refers to the introduction of an exogenous polynucleotide into a cell which may encompass targeting, binding, uptake, transport, localization and replicon integration, but is distinct from and does not imply subsequent expression of the gene.

    [0019] Gene expression or expression refers to the process of gene transcription, translation, and post-translational modification.

    [0020] An infectious virus or viral particle is one that comprises a polynucleotide component which it is capable of delivering into a cell for which the viral species is trophic. The term does not necessarily imply any replication capacity of the virus.

    [0021] The term polynucleotide refers to a polymeric form of nucleotides of any length, including deoxyribonucleotides or ribonucleotides, or analogs thereof. A polynucleotide may comprise modified nucleotides, such as methylated or capped nucleotides and nucleotide analogs, and may be interrupted by non-nucleotide components. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The term polynucleotide, as used herein, refers interchangeably to double- and single-stranded molecules. Unless otherwise specified or required, any embodiment described herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.

    [0022] An isolated polynucleotide, e.g., plasmid, virus, polypeptide or other substance refers to a preparation of the substance devoid of at least some of the other components that may also be present where the substance or a similar substance naturally occurs or is initially prepared from. Thus, for example, an isolated substance may be prepared by using a purification technique to enrich it from a source mixture. Isolated nucleic acid, peptide or polypeptide is present in a form or setting that is different from that in which h is found in nature. For example, a given DNA sequence (e.g., a gene) is found on the host cell chromosome in proximity to neighboring genes; RNA sequences, such as a specific mRNA sequence encoding a specific protein, are found in the cell as a mixture with numerous other mRNAs that encode a multitude of proteins. The isolated nucleic acid molecule may be present in single-stranded or double-stranded form. When an isolated nucleic acid molecule is to be utilized to express a protein, the molecule will contain at a minimum the sense or coding strand (i.e., the molecule may single-stranded), but may contain both the sense and anti-sense strands (i.e., the molecule may be double-stranded). Enrichment can be measured on an absolute basis, such as weight per volume of solution, or it can be measured in relation to a second, potentially interfering substance present in the source mixture. Increasing enrichments of the embodiments may be preferred Thus, for example, a 2-fold enrichment, 10-fold enrichment, 100-fold enrichment, or a 1000-fold enrichment.

    [0023] A transcriptional regulatory sequence refers to a genomic region that controls the transcription of a gene or coding sequence to which it is operably linked. Transcriptional regulatory sequences of use generally include at least one transcriptional promoter and may also include one or more enhancers and/or terminators of transcription.

    [0024] Operably linked refers to an arrangement of two or more components, wherein the components so described are in a relationship permitting them to function in a coordinated manner. By way of illustration, a transcriptional regulatory sequence or a promoter is operably linked to a coding sequence if the TRS or promoter promotes transcription of the coding sequence. An operably linked TRS is generally joined in cis with the coding sequence, but it is not necessarily directly adjacent to it.

    [0025] Heterologous means derived from a genotypically distinct entity from the entity to which it is compared. For example, a polynucleotide introduced by genetic engineering techniques into a different cell type is a heterologous polynucleotide (and, when expressed, can encode a heterologous polypeptide). Similarly, a transcriptional regulatory element such as a promoter that is removed from its native coding sequence and operably linked to a different coding sequence is a heterologous transcriptional regulatory element.

    [0026] A terminator refers to a polynucleotide sequence that tends to diminish or prevent read-through transcription (i.e., it diminishes or prevent transcription originating on one side of the terminator from continuing through to the other side of the terminator). The degree to which transcription is disrupted is typically a function of the base sequence and/or the length of the terminator sequence. In particular, as is well known in numerous molecular biological systems, particular DNA sequences, generally referred to as transcriptional termination sequences are specific sequences that tend to disrupt read-through transcription by RNA polymerase, presumably by causing the RNA polymerase molecule to stop and/or disengage from the DNA being transcribed. Typical example of such sequence-specific terminators include polyadenylation (polyA) sequences, e.g., SV40 polyA. In addition to or in place of such sequence-specific terminators, insertions of relatively long DNA sequences between a promoter and a coding region also tend to disrupt transcription of the coding region, generally in proportion to the length of the intervening sequence. This effect presumably arises because there is always some tendency for an RNA polymerase molecule to become disengaged from the DNA being transcribed, and increasing the length of the sequence to be traversed before reaching the coding region would generally increase the likelihood that disengagement would occur before transcription of the coding region was completed or possibly even initiated. Terminators may thus prevent transcription from only one direction (uni-directional terminators) or from both directions (bi-directional terminators), and may be comprised of sequence-specific termination sequences or sequence-non-specific terminators or both. A variety of such terminator sequences are known in the art; and illustrative uses of such sequences within the context of the present disclosure are provided below.

    [0027] Host cells, cell lines, cell cultures, packaging cell line and other such terms denote higher eukaryotic cells, such as mammalian cells including human cells, useful in the present disclosure, e.g., to produce recombinant virus or recombinant fusion polypeptide. These cells include the progeny of the original cell that was transduced. It is understood that the progeny of a single cell may not necessarily be completely identical (in morphology or in genomic complement) to the original parent cell.

    [0028] Recombinant, as applied to a polynucleotide means that the polynucleotide is the product of various combinations of cloning, restriction and/or ligation steps, and other procedures that result in a construct that is distinct from a polynucleotide found in nature. A recombinant virus is a viral particle comprising a recombinant polynucleotide. The terms respectively include replicates of the original polynucleotide construct and progeny of the original virus construct.

    [0029] A control element or control sequence is a nucleotide sequence involved in an interaction of molecules that contributes to the functional regulation of a polynucleotide, including replication, duplication, transcription, splicing, translation, or degradation of the polynucleotide. The regulation may affect the frequency, speed, or specificity of the process, and may be enhancing or inhibitory in nature. Control elements known in the art include, for example, transcriptional regulatory sequences such as promoters and enhancers. A promoter is a DNA region capable under certain conditions of binding RNA polymerase and initiating transcription of a coding region usually located downstream (in the 3 direction) from the promoter. Promoters include AAV promoters, e.g., P5, P19, P40 and AAV FIR promoters, as well as heterologous promoters.

    [0030] An expression vector is a vector comprising a region which encodes a gene product of interest, and is used for effecting the expression of the gene product in an intended target cell. An expression vector also comprises control elements operatively linked to the encoding region to facilitate expression of the protein in the target. The combination of control elements and a gene or genes to which they are operably linked for expression is sometimes referred to as an expression cassette, a large number of which are known and available in the art or can be readily constructed from components that are available in the art.

    [0031] The terms polypeptide and protein are used interchangeably herein to refer to polymers of amino acids of any length. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, acetylation, phosphorylation, lipidation, or conjugation with a labeling component.

    [0032] The term exogenous, when used in relation to a protein, gene, nucleic acid, or polynucleotide in a cell or organism refers to a protein, gene, nucleic acid, or polynucleotide which has been introduced into the cell or organism by artificial or natural means. An exogenous nucleic acid may be from a different organism or cell, or it may be one or more additional copies of a nucleic acid which occurs naturally within the organism or cell. By way of a non-limiting example, an exogenous nucleic acid is in a chromosomal location different from that of natural cells, or is otherwise flanked by a different nucleic acid sequence than that found in nature, e.g., an expression cassette which links a promoter from one gene to an open reading frame for a gene product from a different gene.

    [0033] Transformed or transgenic is used herein to include any host cell or cell line, which has been altered or augmented by the presence of at least one recombinant DNA sequence. The host cells are typically produced by transfection with a DNA sequence in a plasmid expression vector, as an isolated linear DNA sequence, or infection with a recombinant viral vector.

    [0034] The term sequence homology means the proportion of base matches between two nucleic acid sequences or the proportion amino acid matches between two amino acid sequences. When sequence homology is expressed as a percentage, e.g., 50%, the percentage denotes the proportion of matches over the length of a selected sequence that is compared to some other sequence. Gaps (in either of the two sequences) are permitted to maximize matching; gap lengths of 15 bases or less are usually used, although 6 bases or less or 2 bases or less may be employed. When using oligonucleotides as probes or treatments, the sequence homology between the target nucleic acid and the oligonucleotide sequence is generally not less than 17 target base matches out of 20 possible oligonucleotide base pair matches (85%); not less than 9 matches out of 10 possible base pair matches (90% or not less than 19 matches out of 20 possible base pair matches (95%).

    [0035] Two amino acid sequences are homologous if there is a partial or complete identity between their sequences. For example, 85% homology means that 85% of the amino acids are identical when the two sequences are aligned for maximum matching. Gaps (in either of the two sequences being matched) are allowed in maximizing matching; gap lengths of 5 or less or 2 or less. Alternatively, two protein sequences (or polypeptide sequences derived from them of at least 30 amino acids in length) are homologous, as this term is used herein, if they have an alignment score of at more than 5 (in standard deviation units) using the program ALIGN with the mutation data matrix and a gap penalty of 6 or greater. The two sequences or parts thereof are more homologous if their amino acids are greater than or equal to 50% identical when optimally aligned using the ALIGN program.

    [0036] The term corresponds to is used herein to mean that a polynucleotide sequence is structurally related to all or a portion of a reference polynucleotide sequence, or that a polypeptide sequence is structurally related to all or a portion of a reference polypeptide sequence, e.g., they have at least 80%, 85%, 90%, 95% or more, e.g., 99% or 100%, sequence identity. In contradistinction, the term complementary to is used herein to mean that the complementary sequence is homologous to all or a portion of a reference polynucleotide sequence. For illustration, the nucleotide sequence TATAC corresponds to a reference sequence TATAC and is complementary to a reference sequence GTATA.

    [0037] The term sequence identity means that two polynucleotide sequences are identical (i.e., on a nucleotide-by-nucleotide basis) over the window of comparison. The term percentage of sequence identity means that two polynucleotide sequences are identical (i.e., on a nucleotide-by-nucleotide basis) over the window of comparison. The term percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base A, T, C, G, U, or I) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The terms substantial identity as used herein denote a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 85 percent sequence identity, at least 90 to 95 percent sequence identity, or at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 20 nucleotide positions, frequently over a window of at least 20-50 nucleotides, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the polynucleotide sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the window of comparison.

    [0038] Conservative amino acid substitutions are, for example, aspartic-glutamic as polar acidic amino acids; lysine/arginine/histidine as polar basic amino acids; leucine/isoleucine/methionine/valine/alanine/glycine/proline as non-polar or hydrophobic amino acids; serine/threonine as polar or uncharged hydrophilic amino acids. Conservative amino acid substitution also includes groupings based on side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. For example, it is reasonable to expect that replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the properties of the resulting polypeptide. Whether an amino acid change results in a functional polypeptide can readily be determined by assaying the specific activity of the polypeptide. Naturally occurring residues are divided into groups based on common side-chain properties: (1) hydrophobic: norleucine, met, ala, val, leu, ile; (2) neutral hydrophilic: cys, ser, thr; (3) acidic: asp, glu; (4) basic: asn, gin, his, lys, arg; (5) residues that influence chain orientation: gly, pro; and (6) aromatic; trp, tyr, phe.

    [0039] The disclosure also envisions polypeptides with non-conservative substitutions. Non-conservative substitutions entail exchanging a member of one of the classes described above for another.

    AAV Vectors with Modified Capsids

    [0040] The disclosure provides an adeno-associated virus (AAV) vector which comprises a capsid that is modified to alter viral tropism and a viral genome. Adeno-associated virus is a member of the Parvoviridae family and comprises a linear, single-stranded DNA genome of less than about 5,000 nucleotides. AAV requires co-infection with a helper virus (i.e., an adenovirus or a herpes virus), or expression of helper genes, for efficient replication. AAV vectors used for administration of therapeutic nucleic acids typically have approximately 96% of the parental genome deleted, such that only the terminal repeats (ITRs), which contain recognition signals for DNA replication and packaging, remain. This eliminates immunologic or toxic side effects due to expression of viral genes. In addition, delivering specific AAV proteins to producing cells enables integration of the AAV vector comprising AAV ITRs into a specific region of the cellular genome, if desired (see, e.g., U.S. Pat. Nos. 6,342,390 and 6,821,511). Host cells comprising an integrated AAV genome show no change in cell growth or morphology (see, for example, U.S. Pat. No. 4,797,368).

    [0041] The AAV ITRs flank the unique coding nucleotide sequences for the non-structural replication (Rep) proteins and the structural capsid (Cap) proteins (also known as virion proteins (VPs)). The terminal 145 nucleotides are self-complementary and are organized so that an energetically stable intramolecular duplex forming a T-shaped hairpin may be formed. These hairpin structures function as an origin for viral DNA replication by serving as primers for the cellular DNA polymerase complex. The Rep genes encode the Rep proteins Rep78, Rep68, Rep52, and Rep40. Rep78 and Rep68 are transcribed from the p5 promoter, and Rep 52 and Rep40 are transcribed from the p19 promoter. The Rep78 and Rep68 proteins are multifunctional DNA binding proteins that perform helicase and nickase functions during productive replication to allow for the resolution of AAV termini (see, e.g., Im et al., 1990). These proteins also regulate transcription from endogenous AAV promoters and promoters within helper viruses (see, e.g., Pereira et al., 1997). The other Rep proteins modify the function of Rep78 and Rep68. The cap genes encode the capsid proteins VP1, VP2, and VP3. The cap genes are transcribed from the p40 promoter.

    [0042] The AAV vector may be generated using any AAV serotype known in the art. Several AAV serotypes and over 100 AAV variants have been isolated from adenovirus stocks or from human or nonhuman primate tissues (reviewed in, e.g., Wu et al., 2006). Generally, the AAV serotypes have genomic sequences of significant homology at the nucleic acid sequence and amino acid sequence levels, such that different serotypes have an identical set of genetic functions, produce virions which are essentially physically and functionally equivalent, and replicate and assemble by practically identical mechanisms. AAV serotypes 1-6 and 7-9 are defined as true serotypes, in that they do not efficiently cross-react with neutralizing sera specific for all other existing and characterized serotypes. Iii contrast, AAV serotypes 6, 10 (also referred to as Rh10), and 11 are considered valiant serotypes as they do not adhere to the definition of a true serotype. AAV serotype 2 (AAV2) has been used extensively for gene therapy applications due to its lack of pathogenicity, wide range of infectivity, and ability to establish long-term transgene expression (see, e.g., Carter, 2005; and Wu et al., supra). Genome sequences of various AAV serotypes and comparisons thereof are disclosed in, for example, GenBank Accession numbers U89790, J01901, AF043303, and AF085716; Chiorini et al., 1997; Srivastava et al., 1983; Chiorini et al., 1999; Rutledge et al., 1998; and Wu et al., 2000).

    [0043] AAV rep and ITR sequences are particularly conserved across most AAV serotypes. For example, the Rep78 proteins of AAV2, AAV3A, AAV3B, AAV4, and AAV6 are reportedly about 89-93% identical (see Bantel-Schaal et al., 1999). It has been reported that AAV serotypes 2, 3A, 3B, and 6 share about 82% total nucleotide sequence identity at the genome level (Bantel-Schaal et al., supra). Moreover, the rep sequences and ITRs of many AAV serotypes are known to efficiently cross-complement functionally substitute) corresponding sequences from other serotypes during production of AAV particles in mammalian cells.

    [0044] Generally, the cap proteins, which determine the cellular tropicity of the AAV particle, and related cap protein-encoding sequences, are significantly less conserved than Rep genes across different AAV serotypes. In view of the ability Rep and ITR sequences to cross-complement corresponding sequences of other serotypes, the AAV vector can comprise a mixture of serotypes and thereby be a chimeric or pseudotyped AAV vector. A chimeric AAV vector typically comprises AAV capsid proteins derived from two or more (e.g., 2, 3, 4, etc.) different AAV serotypes. In contrast, a pseudotyped AAV vector comprises one or more ITRs of one AAV serotype packaged into a capsid of another AAV serotype. Chimeric and pseudotyped AAV vectors are further described in, for example, U.S. Pat. No. 6,723,551; Flotte, 2006; Gao et al., 2004; Gao et al., 2002; De et al., 2006; and Gao et al., 2006.

    [0045] In one embodiment, the AAV vector is generated using an AAV that infects humans (e.g., AAV2). Alternatively, the AAV vector is generated using an AAV that infects non-human primates, such as, for example, the great apes (e.g., chimpanzees), Old World monkeys (e.g., macaques), and New World monkeys (e.g., marmosets). In one embodiment, the AAV vector is generated using an AAV that infects a non-human primate pseudotyped with an AAV that infects humans. Examples of such pseudotyped AAV vectors are disclosed in, e.g., Cearley et al., Molecular Therapy, 13:528 (2006). In one embodiment, an AAV vector can be generated which comprises a capsid protein from an AAV that infects rhesus macaques pseudotyped with AAV2 inverted terminal repeats (ITRs). In a particular embodiment, the AAV vector comprises a capsid protein from AAV10 (also referred to as AAVrh.10), which infects rhesus macaques pseudotyped with AAV2 ITRs (see, e.g., Watanabe et al., 2010; and Mao et al., 2011).

    [0046] A large number of promoters may be used in the viral genome or in a helper virus free system, e.g., to express viral capsid, including constitutive, inducible, and repressible promoters, from a variety of different sources are well known in the art. Representative sources of promoters include for example, virus, mammal, insect, plant, yeast, and bacteria, and suitable promoters from these sources are readily available, or can be made synthetically, based on sequences publicly available, for example, from depositories such as the ATCC as well as other commercial or individual sources. Promoters can be unidirectional (i.e., initiate transcription in one direction) or bi-directional (i.e., initiate transcription in either a 3 or 5 direction). Non-limiting examples of promoters include, for example, the T7 bacterial expression system, pBAD (araA) bacterial expression system, the cytomegalovirus (CMV) promoter, the SV40 promoter, and the RSV promoter. Inducible promoters include, for example, the Tet system (U.S. Pat. Nos. 5,464,758 and 5,814,618), the Ecdysone inducible system (No et al., 1996), the T-REX system (invitrogen, Carlsbad, Calif.), LACSWITCH System (Stratagene, San Diego, Calif.), and the Cre-ERT tamoxifen inducible recombinase system (Indra et al., 1999; U.S. Pat. No. 7,112,715; and Kramer & Fussenegger, 2005).

    [0047] The term enhancer as used herein, refers to a DNA sequence that increases transcription of, for example, a nucleic acid sequence to which it is operably linked. Enhancers can be located many kilobases away from the coding region of the nucleic acid sequence and can mediate the binding of regulatory factors, patterns of DNA methylation, or changes in DNA structure. A large number of enhancers from a variety of different sources are well known in the art and are available as or within cloned polynucleotides (from, e.g., depositories such as the ATCC as well as other commercial or individual sources). A number of polynucleotides comprising promoters (such as the commonly-used CMV promoter) also comprise enhancer sequences. Enhancers can be located upstream, within, or downstream of coding sequences.

    [0048] Typically AAV vectors are produced using well characterized plasmids. For example, human embryonic kidney 293T cells are transfected with one of the transgene specific plasmids and another plasmid containing the adenovirus helper and AAV rep and cap genes (specific to AAVrh.10, 8 or 9 as required). After 72 hours, the cells are harvested and the vector is released from the cells by five freeze/thaw cycles. Subsequent centrifugation and benzonase treatment removes cellular debris and unencapsidated DNA. Iodixanol gradients and ion exchange columns may be used to further purify each AAV vector. Next, the purified vector is concentrated by a size exclusion centrifuge spin column to the required concentration. Finally, the buffer is exchanged to create the final vector products formulated (for example) in 1 phosphate buffered saline. The viral titers may be measured by TaqMan real-time PCR and the viral purity may be assessed by SDS-PAGE.

    Pharmaceutical Compositions and Delivery

    [0049] The disclosure provides a composition comprising, consisting essentially of, or consisting of the above-described gene transfer vector and a pharmaceutically acceptable (e.g., physiologically acceptable) carrier. When the composition consists essentially of the inventive gene transfer vector and a pharmaceutically acceptable carrier, additional components can be included that do not materially affect the composition (e.g., adjuvants, buffers, stabilizers, anti-inflammatory agents, solubilizers, preservatives, etc.). When the composition consists of the inventive gene transfer vector and the pharmaceutically acceptable carrier, the composition does not comprise any additional components. Any suitable carrier can be used within the context of the disclosure, and such carriers are well known in the art. The choice of carrier will be determined, in part, by the particular site to which the composition may be administered and the particular method used to administer the composition. The composition optionally can be sterile with the exception of the gene transfer vector described herein. The composition can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. The compositions can be generated in accordance with conventional techniques described in, e.g., Remington: The Science and Practice of Pharmacy, 21st Edition, Lippincott Williams & Wilkins, Philadelphia, Pa. (2001).

    [0050] Suitable formulations for the composition include aqueous and non-aqueous solutions, isotonic sterile solutions, which can contain anti-oxidants, buffers, and bacteriostats, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials, and can be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example, water, immediately prior to use. Extemporaneous solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. In one embodiment, the carrier is a buffered saline solution. In one embodiment, the inventive gene transfer vector is administered in a composition formulated to protect the gene transfer vector from damage prior to administration. For example, the composition can be formulated to reduce loss of the gene transfer vector on devices used to prepare, store, or administer the gene transfer vector, such as glassware, syringes, or needles. The composition can be formulated to decrease the light sensitivity and/or temperature sensitivity of the gene transfer vector. To this end, the composition may comprise a pharmaceutically acceptable liquid carrier, such as, for example, those described above, and a stabilizing agent selected from the group consisting of polysorbate 80, L-arginine, polyvinylpyrrolidone, trehalose, and combinations thereof. Use of such a composition will extend the shelf life of the gene transfer vector, facilitate administration, and increase the efficiency of the inventive method. Formulations for gene transfer vectorcontaining compositions are further described in, for example, Wright et al, 2003 and Wright et al., 2005).

    [0051] The composition also can be formulated to enhance transduction efficiency. In addition, one of ordinary skill in the art will appreciate that the inventive gene transfer vector can be present in a composition with other therapeutic or biologically-active agents. For example, factors that control inflammation, such as ibuprofen or steroids, can be part of the composition to reduce swelling and inflammation associated with in vivo administration of the gene transfer vector. Immune system stimulators or adjuvants, e.g., interleukins, lipopolysaccharide, and double-stranded RNA, can be administered to enhance or modify an immune response. Antibiotics, i.e., microbicides and fungicides, can be present to treat existing infection and/or reduce the risk of future infection, such as infection associated with gene transfer procedures.

    [0052] Injectable depot forms are made by forming microencapsule matrices of the subject compounds in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.

    [0053] In certain embodiments, a formulation may comprise a biocompatible polymer selected from the group consisting of polyamides, polycarbonates, polyalkylenes, polymers of acrylic and methacrylic esters, polyvinyl polymers, polyglycolides, polysiloxanes, polyurethanes and co-polymers thereof, celluloses, polypropylene, polyethylenes, polystyrene, polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, poly(butic acid), poly(valeric acid), poly(lactide-co-caprolactone), polysaccharides, proteins, polyhyaluronic acids, polycyanoacrylates, and blends, mixtures, or copolymers thereof.

    [0054] The composition can be administered in or on a device that allows controlled or sustained release, such as a sponge, biocompatible meshwork, mechanical reservoir, or mechanical implant. Implants (see, e.g., U.S. Pat. No. 5,443,505), devices see, e.g., U.S. Pat. No. 4,863,457), such as an implantable device, e.g., a mechanical reservoir or an implant or a device comprised of a polymeric composition, are particularly useful for administration of the inventive gene transfer vector. The composition also can be administered in the form of sustained-release formulations (see, e.g., U.S. Pat. No. 5,378,475) comprising, for example, gel foam, hyaluronic acid, gelatin, chondroitin sulfate, a polyphosphoester, such as bis-2-hydroxyethyl-terephthalate (BHET), and/or a polylactic-glycolic acid.

    [0055] Delivery of the compositions comprising the inventive gene transfer vectors may be intracerebral (including but not limited to intraparenchymal, intraventricular, or intracisternal), intrathecal (including but not limited to lumbar or cisterna magna), or systemic, including but not limited to intravenous, or any combination thereof using devices known in the art. Delivery may also be via surgical implantation of an implanted device.

    [0056] The dose of the gene transfer vector in the composition administered to the mammal will depend on a number of factors, including the size (mass) of the mammal, the extent of any side-effects, the particular route of administration, and the like. In one embodiment, the inventive method comprises administering a therapeutically effective amount of the composition comprising the inventive gene transfer vector described herein. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. The therapeutically effective amount may vary according to factors such as the extent of pathology, age, sex, and weight of the individual, and the ability of the gene transfer vector to elicit a desired response in the individual. The dose of gene transfer vector in the composition required to achieve a particular therapeutic effect typically is administered in units of vector genome copies per cell (gc/cell) or vector genome copies/per kilogram of body weight (gc/kg). One of ordinary skill in the art can readily determine an appropriate gene transfer vector dose range to treat a patient having a particular disease or disorder, based on these and other factors that are well known in the art. The therapeutically effective amount may be between 110.sup.10 genome copies to 110.sup.13 genome copies.

    [0057] In one embodiment, the composition is administered once to the mammal. It is believed that a single administration of the composition will result in persistent expression in the mammal with minimal side effects. However, in certain cases, it may be appropriate to administer the composition multiple times during a therapeutic period to ensure sufficient exposure of cells to the composition. For example, the composition may be administered to the mammal two or more times (e.g., 2, 3, 4, 5, 6, 6, 8, 9, or 10 or more times) during a therapeutic period.

    Exemplary Capsid Proteins for Modification

    [0058] In one embodiment, AAV capsid proteins, may have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity to a reference AAV capsid polypeptide sequence, e.g., have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity to an AAV capsid sequence, such as a capsid sequence of e.g., an AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, AAV-9, AAV-10, AAV-11 or AAV-12, and including pseudotyped viruses and non-natural serotypes such as AAV-DJ (Grimm et al., 2008), and AAV-PHP.eB or AAV-PHP.S (Chan et al., 2017). In one embodiment, the capsid sequence may have at least 50%, 55%, 60%, 65%, 70%, 70%, 75%, 800%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity to any of SEQ ID Nos. 17-21:

    TABLE-US-00001 AAV2VP1 (SEQIDNO:17) 1 maadgylpdwledtlsegirqwwklkpgppppkpaerhkddsrglvlpgykylgpfngld 61 kgepvneadaaalehdkaydrqldsgdnpylkynhadaefqerlkedtsfggnlgravfq 121 akkrvleplglveepvktapgkkrpvehspvepdsssgtgkagqqparkrlnfgqtgdad 181 svpdpqplgqppaapsglgtntmatgsgapmadnnegadgvgnssgnwhcdstwmgdrvi 241 ttstrtwalptynnhlykqissqsgasndnhyfgystpwgyfdfnrfhchfsprdwqrli 301 nnnwgfrpkrlnfklfniqvkevtqndgtttiannltstvqvftdseyqlpyvlgsahqg 361 clppfpadvfmvpqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfedvpf 421 hssyahsqsldrlmnplidqylyylsrtntpsgtttqsrlqfsqagasdirdqsrnwlng 481 pcyrqqrvsktsadnnnseyswtgatkyhlngrdslvnpgpamashkddeekffpqsgvl 541 ifgkqgsektnvdiekvmitdeeeirttnpvateqygsvstnlqrgnrqaatadvntqgv 601 lpgmvwqdrdvylqgpiwakiphtdghthpsplmggfglkhpppqilikntpvpanpstt 661 fsaakfasfitqystgqvsveiewelqkenskrwnpeiqytsnynksvnvdftvdtngvy 721 seprpigtryltrnl AAV8VP1 (SEQIDNO:18) 1 maadgylpdwlednlsegirewwalkpgapkpkanqqkqddgrglvlpgykylgpfngld 61 kgepvnaadaaalehdkaydqqlqagdnpylrynhadaefqerlqedtsfggnlgravfq 121 akkrvleplglveegaktapgkkrpvepspqrspdsstgigkkgqqparkrlnfgqtgds 181 esvpdpqplgeppaapsgvgpntmaagggapmadnnegadgvgsssgnwhcdstwlgdrv 241 ittstrtwalptynnhlykqisngtsggatndntyfgystpwgyfdfnrfhchfsprdwq 301 rlinnnwgfrpkrlsfklfniqvkevtqnegtktiannltstiqvftdseyqlpyvlgsa 361 hqgclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnfqftytfed 421 vpfhssyahsqsldrlmnplidqylyylsrtqttggtantqtlgfsqggpntmanqaknw 481 lpgpcyrqqrvstttgqnnnsnfawtagtkyhlngrnslanpgiamathkddeerffpsn 541 gilifgkqnaardnadysdvmltseeeikttnpvateeygivadnlqqqntapqigtvns 601 qgalpgmvwqnrdvylqgpiwakiphtdgnfhpsplmggfglkhpppqilikntpvpadp 661 pttfnqsklnsfitqystgqvsveiewelqkenskrwnpeiqytsnyykstsvdfavnte 721 gvyseprpigtryltrnl AAV7VP1 (SEQIDNO:19) 1 maadgylpdwlednlsegirewwdlkpgapkpkanqqkqdngrglvlpgykylgpfngld 61 kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq 121 akkrvleplglveegaktapakkrpvepspqrspdsstgigkkgqqparkrlnfgqtgds 181 esvpdpqplgeppaapssvgsgtvaagggapmadnnegadgvgnasgnwhcdstwlgdrv 241 ittstrtwalptynnhlykqissetagstndntyfgystpwgyfdfnrfhchfsprdwqr 301 linnnwgfrpkklrfklfniqvkevttndgvttiannltstiqvfsdseyqlpyvlgsah 361 qgclppfpadvfmipqygyltlnngsqsvgrssfycleyfpsqmlrtgnnfefsysfedv 421 pfhssyahsqsldrlmnplidqylyylartqsnpggtagnrelqfyqggpstmaeqaknw 481 lpgpcfrqqrvsktldqnnnsnfawtgatkyhlngrnslvnpgvamathkddedrffpss 541 gvlifgktgatnkttlenvlmtneeeirptnpvateeygivssnlqaantaaqtqvvnnq 601 galpgmvwqnrdvylqgpiwakiphtdgnfhpsplmggfglkhpppqilikntpvpanpp 661 evftpakfasfitqystgqvsveiewelqkenskrwnpeiqytsnfekqtgvdfavdsqg 721 vyseprpigtryltrnl AAV-5VP1 (SEQIDNO:20) 1 msfvdhppdwleevgeglreflgleagppkpkpnqqhqdqarglvlpgynylgpgngldr 61 gepvnradevarehdisyneqleagdnpylkynhadaefqekladdtsfggnlgkavfqa 121 kkrvlepfglveegaktaptgkriddhfpkrkkarteedskpstssdaeagpsgsqqlqi 181 paqpasslgadtmsaggggplgdnnqgadgvgnasgdwhcdstwmgdrvvtkstrtwvlp 241 synnhqyreiksgsvdgsnanayfgystpwgyfdfnrfhshwsprdwqrlinnywgfrpr 301 slrvkifniqvkevtvqdstttiannltstvqvftdddyqlpyvvgngtegclpafppqv 361 ftlpqygyatlnrdntenptersstfcleyfpskmlrtgnnfeftynfeevpfhssfaps 421 qnlfklanplvdqylyrfvstnntggvqfnknlagryantyknwfpgpmgrtqgwnlgsg 481 vnrasvsafattnrmelegasyqvppqpngmtnnlqgsntyalentmifnsqpanpgtta 541 tylegnmlitsesetqpvnrvaynvggqmatnnqssttapatgtynlqeivpgsvwmerd 601 vylqgpiwakipetgahfhpspamggfglkhpppmmlikntpvpgnitsfsdvpvssfit 661 qystgqvtvemewelkkenskrwnpeiqytnnyndpqfvdfapdstgeyrttrpigtryl 721 trpl AAV-5 (SEQIDNO:21) 1 msfvdhppdwleevgeglreflgleagppkpkpnqqhqdqarglvlpgynylgpgngldr 61 gepvnradevarehdisyneqleagdnpylkynhadaefqekladdtsfggnlgkavfqa 121 kkrvlepfglveegaktaptgkriddhfpkrkkarteedskpstssdaeagpsgsqqlqi 181 paqpasslgadtmsaggggplgdnnqgadgvgnasgdwhcdstwmgdrvvtkstrtwvlp 241 synnhqyreiksgsvdgsnanayfgystpwgyfdfnrfhshwsprdwqrlinnywgfrpr 301 slrvkifniqvkevtvqdstttiannltstvqvftdddyqlpyvvgngtegclpafppqv 361 ftlpqygyatlnrdntenpterssffcleyfpskmlrtgnnfeftynfeevpfhssfaps 421 qnlfklanplvdqylyrfvstnntggvqfnknlagryantyknwfpgpmgrtqgwnlgsg 481 vnrasvsafattnrmelegasyqvppqpngmtnnlqgsntyalentmifnsqpanpgtta 541 tylegnmlitsesetqpvnrvaynvggqmatnnqssttapatgtynlqeivpgsvwmerd 601 vylqgpiwakipetgahfhpspamggfglkhpppmmlikntpvpgnitsfsdvpvssfit 661 qystgqvtvemewelkkenskrwnpeiqytnnyndpqfvdfapdstgeyrttrpigtryl 721 trpl.

    Dosages, Formulations and Routes of Administration

    [0059] Administration of the recombinant viruses may be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The administration of the recombinant viruses may be essentially continuous over a preselected period of time or may be in a series of spaced doses. Both local and systemic administration is contemplated. When the recombinant viruses are employed for prophylactic purposes, recombinant viruses are amenable to chronic use, e.g., by systemic administration.

    [0060] One or more suitable unit dosage forms comprising the recombinant viruses, can be administered by a variety of routes including oral, or parenteral, including by rectal, transdermal, subcutaneous, intravenous, intramuscular, intraperitoneal, intrathoracic, intrapulmonary and intranasal routes. For example, for administration to the liver, intravenous administration may be employed. For administration to the lung, airway administration may be employed. The formulations may, where appropriate, be conveniently presented in discrete unit dosage forms and may be prepared by any of the methods well known to pharmacy. Such methods may include the step of bringing into association the recombinant viruses with liquid carriers, solid matrices, semi-solid carriers, finely divided solid carriers or combinations thereof, and then, if necessary, introducing or shaping the product into the desired delivery system.

    [0061] When the recombinant viruses are prepared for oral administration, they may be combined with a pharmaceutically acceptable carrier, diluent or excipient to form a pharmaceutical formulation, or unit dosage form. The total active ingredients in such formulations comprise from 0.1 to 99.9% by weight of the formulation. By pharmaceutically acceptable it is meant the carrier, diluent, excipient, and/or salt must be compatible with the other ingredients of the formulation, and not deleterious to the recipient thereof. The active ingredient for oral administration may be present as a powder or as granules; as a solution, a suspension or an emulsion; or in achievable base such as a synthetic resin for ingestion of the active ingredients from a chewing gum. The active ingredient may also be presented as a bolus, electuary or paste.

    [0062] Pharmaceutical formulations containing the recombinant viruses can be prepared by procedures known in the art using well known and readily available ingredients. For example, the recombinant viruses can be formulated with common excipients, diluents, or carriers, and formed into tablets, capsules, suspensions, powders, and the like. Examples of excipients, diluents, and carriers that are suitable for such formulations include the following fillers and extenders such as starch, sugars, mannitol, and silicic derivatives; binding agents such as carboxymethyl cellulose, HPMC and other cellulose derivatives, alginates, gelatin, and polyvinyl-pyrrolidone; moisturizing agents such as glycerol; disintegrating agents such as calcium carbonate and sodium bicarbonate; agents for retarding dissolution such as paraffin; resorption accelerators such as quaternary ammonium compounds; surface active agents such as cetyl alcohol, glycerol monostearate; adsorptive carriers such as kaolin and bentonite; and lubricants such as talc, calcium and magnesium stearate, and solid polyethyl glycols.

    [0063] The recombinant viruses can also be formulated as elixirs or solutions for convenient oral administration or as solutions appropriate for parenteral administration, for instance by intramuscular, subcutaneous or intravenous routes.

    [0064] The pharmaceutical formulations of the recombinant viruses can also take the form of an aqueous or anhydrous solution or dispersion, or alternatively the form of an emulsion or suspension.

    [0065] Thus, the recombinant viruses may be formulated for parenteral administration (e.g., by injection, for example, bolus injection or continuous infusion) and may be presented in unit dose form in ampules, pre-filled syringes, small volume infusion containers or in multi-dose containers with an added preservative. The active ingredients may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredients may be in powder form, obtained by aseptic isolation of sterile solid or by lyophilization from solution, for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water, before use.

    [0066] These formulations can contain pharmaceutically acceptable vehicles and adjuvants which are well known in the prior art. It is possible, for example, to prepare solutions using one or more organic solvent(s) that is/are acceptable from the physiological standpoint, chosen, in addition to water, from solvents such as acetone, ethanol, isopropyl alcohol, glycol ethers such as the products sold under the name Dowanol, polyglycols and polyethylene glycols, C.sub.1-C.sub.4 alkyl esters of short-chain acids, e.g., ethyl or isopropyl lactate, fatty acid triglycerides such as the products marketed under the name Miglyol, isopropyl myristate, animal, mineral and vegetable oils and polysiloxanes.

    [0067] For administration to the upper (nasal) or lower respiratory tract by inhalation, the recombinant viruses are conveniently delivered from an insufflator, nebulizer or a pressurized pack or other convenient means of delivering an aerosol spray. Pressurized packs may comprise a suitable propellant such as dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount.

    [0068] Alternatively, for administration by inhalation or insufflation, the composition may take the form of a dry powder, for example, a powder mix of the agent and a suitable powder base such as lactose or starch. The powder composition may be presented in unit dosage form in, for example, capsules or cartridges, or, e.g., gelatine or blister packs from which the powder may be administered with the aid of an inhalator, insufflator or a metered-dose inhaler.

    [0069] For intra-nasal administration, the recombinant viruses may be administered via nose drops, a liquid spray, such as via a plastic bottle atomizer or metered-dose inhaler. Typical of atomizers are the Mistometer (Wintrop) and the Medihaler (Riker).

    [0070] The local delivery of the recombinant viruses can also be by a variety of techniques which administer the agent at or near the site of disease. Examples of site-specific or targeted local delivery techniques are not intended to be limiting but to be illustrative of the techniques available. Examples include local delivery catheters, such as an infusion or indwelling catheter, e.g., a needle infusion catheter, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct applications.

    [0071] Drops, such as eye drops or nose drops, may be formulated with an aqueous or non-aqueous base also comprising one or more dispersing agents, solubilizing agents or suspending agents. Liquid sprays are conveniently delivered from pressurized packs. Drops can be delivered via a simple eye dropper-capped bottle, or via a plastic bottle adapted to deliver liquid contents dropwise, via a specially shaped closure.

    [0072] The formulations and compositions described herein may also contain other ingredients such as antimicrobial agents, or preservatives. Furthermore, the active ingredients may also be used in combination with other agents, for example, bronchodilators.

    [0073] The recombinant viruses may be administered to a mammal alone or in combination with pharmaceutically acceptable carriers. As noted above, the relative proportions of active ingredient and carrier are determined by the solubility and chemical nature of the compound, chosen route of administration and standard pharmaceutical practice.

    [0074] The dosage of the recombinant viruses will vary with the form of administration, the particular compound chosen and the physiological characteristics of the particular patient under treatment. Generally, small dosages will be used initially and, if necessary, will be increased by small increments until the optimum effect under the circumstances is reached.

    Exemplary Doses

    [0075] An effective amount of virus is administered, depending on the objectives of treatment. An effective amount may be given in single or divided doses. Where a low percentage of transduction can cure a genetic deficiency, then the objective of treatment is generally to meet or exceed this level of transduction. In some instances, this level of transduction can be achieved by transduction of only about 1 to 5% of the target cells, but is more typically 20% of the cells of the desired tissue type, usually at least about 50%, at least about 80%, at least about 95?, or at least about 99% of the cells of the desired tissue type. As a guide, the number of vector particles present in a single dose given by bronchoscopy will generally be at least about 110.sup.12, e.g., about 110.sup.13, 110.sup.14, 110.sup.15 or 110.sup.16 particles, including both DNAse-resistant and DNAse-susceptible particles. In terms of DNAse-resistant particles, the dose will generally be between 110.sup.12 and 110.sup.16 particles, more generally between about 110.sup.12 and 110.sup.15 particles.

    Exemplary Gene Products

    [0076] In one embodiment, the gene product is a therapeutic gene product, e.g., GM-CSF, CD40L, IL-2, CD80, MDA-7, or TNF-alpha. In one embodiment, the gene product is a prophylactic gene product, e.g. kallikrein or is pathogen-derived protein fragments (Pestisvirus E2, C. psittaci MOMP, S. aureus FnBP, S. aureus ClfA, Avian paramyxovirus HN, B. melitensis OMP-31, S. japonicum Sj23). In one embodiment, the gene product is a catalytic RNA. In one embodiment the gene product is a guide RNA. In one embodiment the gene is a donor for homologous recombination. In one embodiment the gene product is a nuclease suitable for genome editing, e.g. TALENS, S. pyogenes Cas9, S. aureus Cas9. In one embodiment, the gene product is a cytotoxic gene product, e.g., suicide genes such as rexin-G or HSVtk in combination with ganciclovir, an apoptosis inducer, e.g., p53, p27Kip1, p21Waf1, p16INK4A, Ad5IkB, or cyclin-dependent kinase inhibitors, or an angiogenesis inhibitor. In one embodiment, the gene product is a chimeric T-cell receptor (anti-CD19 scfv/CD28/CD3 CAR, anti-BCMA scfv/4-1BB/CD3 CAR).

    [0077] In one embodiment, the gene to be delivered includes but is not limited to cystic fibrosis transmembrane conductance regulator, -antitrypsin, -globin, -globin, tyrosine hydroxylase, glucocerebrosidase, aryl sulfatase A, factor VIII, dystrophin or erythropoietin, a viral, bacterial, tumor or fungal antigen, or an immune response modulator, e.g., a cytokine including but not limited to IFN-alpha, IFN-gamma, TNF, IL-1, IL-17, or IL-6.

    Exemplary Insertions or Substitutions

    [0078] In one embodiment, the insertion includes 1, 2, 3, or 4 lysines. In one embodiment, the insertion has formula (I): X1-X2-X3-X4 (SEQ ID NO:22), and wherein at least one of X1-X4 is lysine (K) and at least one of the other residues is A, G, V, T, I, S or M; wherein at least two of X1-X4 are lysine (K) and the other residues are A, G, V, T, I, S or M; wherein at least one of X1-X4 is lysine (K) and at least one of the other residues is C, S, D, E, N, Q, or R; wherein at least two of X1-X4 are lysine (K) and the other residues are C, S, M, D, E, Q, or R; wherein at least one of X1-X4 is lysine (K) and at least one of the other residues is H, P, Y, W or F; or wherein at least two of X1-X4 are lysine (K) and the other residues are H, P, Y, W or F. In one embodiment, the insertion is 5 or fewer residues. In one embodiment, the insertion is 4 or fewer residues. In one embodiment, the insertion does not have R. In one embodiment, the insertion does not have F. In one embodiment, the insertion does not have N. In one embodiment, the insertion does not have Q.

    [0079] In one embodiment, the substitution includes 1, 2, 3, 4 or 5 lysines. In one embodiment, the substitution results in formula (II): Z1-Z2-Z3-Z4-Z5-Z6-Z7-Z8-Z9-Z10-Z11-Z12-Z13 (SEQ ID NO:23), and wherein at least one of Z1-Z13 is lysine (K) and the other residues include A, G, V, T, I, S, M, C, D, E, N, Q, H, P, Y, W or F; wherein at least two of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, E, N, Q, H, P, Y, W or F; wherein at least three of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, M, C, D, E, N, Q, H, P, Y, W or F; or wherein at least four of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, C, Q, H, P, Y, W or F.

    [0080] In one embodiment, the substitution includes 1, 2, 3, 4 or 5 lysines. In one embodiment, the substitution results in formula (ii): Z1-Z2-Z3-Z4-Z5-Z6-Z7-Z8-Z9-Z10-Z11-Z12-Z13, and wherein at least one of Z1-Z13 is lysine (K) and the other residues include A, G, V, T, I, S, M, D, E, N, Q, H, P, or Y; wherein at least two of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, M, D, E, N, Q, H, P, or Y; wherein at least three of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, M, D, E, N, Q, H, P, or Y; or wherein at least four of Z1-Z13 are lysine (K) and the other residues include A, G, V, T, I, S, M, D, E, N, Q, H, P, or Y.

    [0081] The invention will be further described by the following non-limiting example.

    Example

    [0082] Intravenous administration of all naturally occurring adeno-associated virus (AAV) vectors are liver tropic, with the majority of the total vector dose mediating gene expression in liver hepatocytes. Specificity and transduction levels are serotype dependent. To design an AAV vector to de-target liver but enhance delivery to lung following intravenous administration, modifications were made to the AAV capsid to direct the tropism of the virus, e.g., adding additional positively charged lysine residues to the AAV capsid would enhance the ability of the virus to adhere to negatively charged cell surface molecules such as heparan sulfate proteoglycans, leading to enhanced transduction of the organ representing the first capillary bed encountered. To test this hypothesis, using site directed mutagenesis, two lysine residues were inserted into variable loop VIII of the AAV serotype 5 capsid of a vector coding for human 1-antitrypsin (AAV5-PK2-hAAT). The site for insertion was at position 575 (see Hida et al., 2010), which is located on a loop with variable amino acid sequence and is exposed on the surface of the capsid. For example, two lysine residues were inserted after residue 575. That insertion results in an additional 120 lysine residues on the AAV5 capsid.

    [0083] Distribution of the vector and vector expression was quantified following administration of 10.sup.11 genome copies (gc) of AAV5-PK2-hAAT or the identical vector with the AAV5 wild-type capsid (AAV5-hAAT) by the intravenous route to C57B1/6 male mice. Four wk post-administration, organs were harvested, and vector DNA and mRNA quantified by TagMan. Consistent with the experience for all naturally occurring AAV vectors, intravenous administration of AAV5-hAAT resulted in the highest vector DNA levels in the liver (ratio of vector DNA in liver to lung 15071; liver to heart 452169; and liver to skeletal muscle 42601800). hAAT mRNA levels in the various organs paralleled the vector DNA distribution. In striking contrast, following intravenous administration of the AAV5-PK2-hAAT vector, the liver to lung vector DNA ratio was 0.170.06 (p=0.03, compared to the wild type capsid), liver to heart 8448, (p=0.03) and liver to skeletal muscle 671319, p=(0.04). The lysine-modified vector was de-targeted from the liver, resulting in 61-fold lower (p=0.003) liver and 2.3-fold higher (p=0.03) lung vector DNA levels compared to the wild-type capsid (lung to liver DNA ratio 276-fold higher, p=0.04). The hAAT mRNA levels paralleled the vector DNA levels. Serum AAT levels were 8420 g/ml for AAV5-hAAT and only 0.570.15 g/ml for AAV5-PK2-hAAT supporting the de-targeting of AAV5-PK2-hAAT to the liver, the main producer of secreted proteins such as hAAT.

    [0084] Thus, with the identical dose administered iv, for AAV5 there was 80-fold more vector DNA in liver than lung per g DNA, and 59-fold more vector DNA in liver than lung per total tissue, and AAV5-PK2 had 2.6-fold more vector DNA in lung than liver per g DNA, and 1.8-fold more vector DNA in lung than liver per total tissue. Therefore, the liver was de-targeted. Moreover, serum levels of hAAT from mice administered AAV5-PK2-hAAT were 152-fold lower than AAV5-hAAT but BAL levels were only 70-fold lower, confirming enhanced hAAT expression from AAV5-PK2-hAAT in the lung.

    [0085] For AAV5 there was 197-fold more hAAT mRNA in liver than lung per g RNA, and 242-fold more in liver than lung per total tissue. In contrast, AAV5-PK2 had 1.3-fold more hAAT mRNA in lung than liver per g DNA, and 1.2-fold more hAAT mRNA in lung than liver per total tissue.

    [0086] In summary, genetic modification of the AAV capsid with lysine residues results in a sticky vector that transduces the organ containing the first capillary bed encountered following intravenous administration (the lung), thus shifting the targeting of the vector away from the liver. This capsid modification strategy with lysine residues should be applicable to all AAV vectors, and depending on the administration route, useful for targeting AAV vectors to specific organs, and also useful from a safety viewpoint for limiting spill of vector to the systemic circulation and other organs, thereby targeting specific organs via the route of administration.

    [0087] After intravenous administration, the AAV5-PK2 vector was also de-targeted from the spleen and ileum. With the identical dose administered iv, AAV5-hAAT had 32-fold more vector DNA in the spleen and 75-fold more vector DNA in the ileum than AAV5-PK2-hAAT.

    REFERENCES

    [0088] Bantel-Schaal et al., J. Virol., 73(2):939 (1999). [0089] Carter, Hum. Gene Ther., 16:541 (2005); [0090] Cearley et al., Molecular Therapy, 13:528 (2006). I [0091] Chan et al., Nat. Neurosci., 20:1174 (2017). [0092] Chiorini et al., J. Virol., 71:6823 (1997). [0093] Chiorini et al., J. Virol., 73:1309 (1999). [0094] Dalkara et al. 2013. Sci Transl Med 5, 189ra76 [0095] De et al., Mol. Ther., 13:67 (2006). [0096] Flotte, Mol. Ther., 13(1):1 (2006). [0097] Gao et al., J. Virol., 78:6381 (2004). [0098] Gao et al., Mol. Ther., 13:77 (2006). [0099] Gao et al., Proc. Natl. Acad. Sci. USA, 99:11854 (2002). [0100] Govindasamy et al. 2013. J. Virol. 87(20): 11187-99. [0101] Grimm et al., J. Virol., 82:5887 (2008). [0102] Hida et al., 2010 Arch. Biochem. Biophys., 496:1. [0103] Im et al., Cell, 61:447 (1990)). [0104] Indra et al, Nuc. Acid. Res., 27:4324 (1999). [0105] Indra et al, Nuc. Acid. Res., 28:e99 (2000). [0106] Judd et al. 2012. Mol Ther-Nuc Acids 1, e54 [0107] Khabou et al. 2016. Biotechnol Bioeng 113(12):2717-2724). [0108] Kramer &. Fussenegger, Methods Mol. Biol., 308:123 (2005)). [0109] Mao et al., Hunt. Gene Therapy, 22:1525 (2011). [0110] No et al., Proc. Natl. Acad. Sci., 93:3346 (1996)). [0111] Pereira et al., J. Virol., 71:1079 (1997)). [0112] Rutledge et al., J. Virol., 72:309 (1998). [0113] Srivastava et al., J. Virol., 45:555 (1983). [0114] Watanabe et al., Gene Ther., 17(8):1042 (2010). [0115] Wright et at, Curr. Opin. Drug Discov. Devel., 6(2): 174-178 (2003). [0116] Wright et al., Molecular Therapy, 12: 171-178 (2005).). [0117] Wu et al., J. Virol., 74:8635 (2000)). [0118] Wu et al., Molecular Therapy, 14(3): 316 (2006)).

    [0119] All publications, patents and patent applications are incorporated herein by reference. While in the foregoing specification this invention has been described in relation to certain preferred embodiments thereof, and many details have been set forth for purposes of illustration, it will be apparent to those skilled in the art that the invention is susceptible to additional embodiments and that certain of the details described herein may be varied considerably without departing from the basic principles of the invention.