SILENCING OF DUX4 BY RECOMBINANT GENE EDITING COMPLEXES
20200017842 ยท 2020-01-16
Assignee
Inventors
- Peter L. Jones (Carson City, NV, US)
- Charis L. Himeda (Reno, NV, US)
- Takako Jones (Carson City, NV, US)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
C12N9/22
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
International classification
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
A61K9/00
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
Abstract
The disclosure relates to methods and compositions for regulating expression of DUX4. Specifically, the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression. In some aspects, methods described by the disclosure are useful for treating a disease associated with aberrant DUX4 expression (e.g., facioscapulohumeral muscular dystrophy, FSHD).
Claims
1. A recombinant gene editing complex comprising: (i) a recombinant gene editing protein; and, (ii) a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
2. The recombinant gene editing complex of claim 1, wherein the target nucleic acid sequence is located on chromosome 4 at position 4q35.
3. The recombinant gene editing complex of claim 1 or 2, wherein the gRNA comprises a sequence encoded by the sequence set forth in any one of SEQ ID NOs: 1-11.
4. The recombinant gene editing complex of any one of claims 1 to 3, wherein the gRNA specifically hybridizes to a nucleic acid sequence encoding a DUX4 promoter or exon 1 of DUX4.
5. The recombinant gene editing complex of claim 4, wherein the gRNA comprises a sequence encoded by the sequence set forth in any one of SEQ ID NOs: 3-8.
6. The recombinant gene editing complex of any one of claims 1 to 5, wherein the recombinant gene editing protein comprises a Cas protein, a Cfp1 protein, or a variant thereof.
7. The recombinant gene editing complex of claim 6, wherein the Cas protein is a Streptococcus pyogenes Cas protein or a Staphylococcus aureus Cas protein.
8. The recombinant gene editing complex of claim 6 or 7, wherein the Cas protein is a Cas9 protein or a dead Cas9 (dCas9) protein.
9. The recombinant gene editing complex of any one of claims 6 to 8, wherein the recombinant gene editing protein comprises the sequence set forth in SEQ ID NO: 45.
10. The recombinant gene editing complex of any one of claims 1 to 9, wherein the recombinant gene editing protein further comprises a transcriptional repressor domain.
11. The recombinant gene editing complex of claim 10, wherein the transcriptional repressor domain is a KRAB domain.
12. The recombinant gene editing complex of claim 11, wherein the gene editing protein comprises the sequence set forth in SEQ ID NO: 43 or 44
13. A vector comprising a nucleic acid encoding one or more components of the recombinant gene editing complex of any one of claims 1 to 12, or a portion thereof.
14. The vector of claim 13, wherein the nucleic acid is engineered to express the one or more components in a cell.
15. The vector of claim 13, wherein the portion thereof is a gRNA.
16. The vector of claim 13, wherein the vector is a lentiviral vector or a recombinant adeno-associated virus vector (rAAV vector).
17. A method for inhibiting expression of DUX4 in a cell, the method comprising: delivering into a cell a nucleic acid encoding one or more components of the recombinant gene editing complex of any one of claims 1 to 12 or a portion thereof, or the vector of any one of claims 13 to 16, in an amount sufficient to inhibit expression of DUX4 gene in the cell.
18. The method of claim 17, wherein the cell comprises a D4Z4 repeat array having 11 or less repeat units.
19. The method of claim 17 or 18, wherein the cell is obtained from a subject having or at risk of having facioscapulohumeral muscular dystrophy (FSHD).
20. The method of any one of claims 17 to 19, wherein the cell is in vitro or ex vivo.
21. A method for treating facioscapulohumeral muscular dystrophy (FSHD) in a subject in need thereof, the method comprising: administering to the subject a therapeutically effective amount of (i) a nucleic acid encoding one or more components of the recombinant gene editing complex of any one of claims 1 to 12, or a portion thereof; or, (ii) the vector of any one of claims 13 to 16.
22. The method of claim 21, wherein the subject is a mammal, optionally a human.
23. The method of claim 21 or 22, wherein chromosome 4 of the subject comprises a D4Z4 repeat array having 11 or less repeat units.
24. The method of any one of claims 21 to 23, wherein the administration is by injection, optionally intramuscular injection or intravenous injection.
25. The method of any one of claims 21 to 24, wherein the recombinant gene editing complex is administered to muscle cells of the subject, optionally myoblasts, myocytes, or terminally differentiated muscle cells of the subject.
26. The method of any one of claims 21 to 24, wherein the recombinant gene editing complex is administered to one or more somatic cells of the subject, optionally fibroblasts or leukocytes.
27. The method of claim 26, wherein the one or more somatic cells are isolated from the subject and reprogrammed into a myogenic lineage.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION
[0029] In some aspects, the disclosure relates to recombinant gene editing complexes useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g., facioscapulohumeral muscular dystrophy, FSHD). The disclosure is based, in part, on the surprising discovery that recruitment of recombinant gene editing complexes to certain loci of the D4Z4 macrosatellite repeat region (e.g., at position 4q35) and/or the DUX4 gene results in decreased production of DUX4-fl, the pathogenic mRNA isoform associated with FSHD, as well as reduced expression of certain genes (e.g., TRIM43, ZSCAN4, etc.) that are downstream targets of DUX4-fl.
Facioscapulohumeral Muscular Dystrophy (FSHD)
[0030] As used herein, the term facioscapulohumeral muscular dystrophy or FSHD refers to a disease or disorder that results from transcriptional activation of the DUX4 gene. In some embodiments, activation of the DUX4 gene results in a toxic gain of function in the DUX4 gene (e.g., production of pathogenic DUX4-fl) and causes a range of symptoms including progressive skeletal muscle weakness (e.g., facial muscle weakness, shoulder weakness, etc.), hearing loss, abnormal heart rhythm, unequal weakening of biceps, triceps, deltoids and lower arm muscles, loss of strength in abdominal and/or leg muscles, a foot drop. In some embodiments, FSHD results in a subject requiring ventilatory support or wheelchair confinement.
[0031] FSHD is associated with a contraction of the D4Z4 repeat sequence at the subtelomeric region 4q35 on Chromosome 4 of the human genome. Generally, chromosome 4 of a healthy subject (e.g., a subject not having FSHD) comprises a D4Z4 repeat region having between 12 and 150 repeat units, resulting in production of an alternatively-spliced 3-truncated DUX4 transcript (DUX4-s). Without wishing to be bound by any particular theory, the DUX4 gene of a subject having a contracted D4Z4 repeat (e.g., 11 or fewer repeat units) becomes transcriptionally activated due to the loss of repeat-mediated repression, resulting in production of pathogenic full-length DUX4 (DUX4-fl) mRNA and protein.
[0032] In some aspects, the invention relates to the discovery that recruitment of recombinant gene editing molecules to certain loci of the D4Z4 macrosatellite repeat region and/or the DUX4 gene results in decreased production of DUX4-fl protein in a subject (e.g., in a cell of a subject). As used herein, the term D4Z4 macrosatellite repeat region refers to a chromosomal locus comprising at least one of the following genomic features: a p13E-11 probe hybridizing sequence, a non-deleted element (NDE) sequence (e.g., a NDE sequence that functions as a transcriptional start site for a DBE-T transcript), a nucleic acid sequence encoding DUX4 (e.g., a nucleic acid sequence encoding exon 1, exon 2 and exon 3 of DUX4). In some embodiments, chromosome 4 comprises a D4Z4 macrosatellite repeat region, for example at locus 4q35.
[0033] As used herein, the term reduced DUX4 expression refers to a change in state of a DUX4 gene from a transcriptionally active (e.g., expressed or transcribed) state to a reduced state of transcriptional activity, for example, a transcriptionally inactive (e.g., silenced) state.
[0034] For example, in some embodiments, a subject (e.g., a cell in a subject) having a transcriptionally active (e.g., expressed) DUX4 gene produces DUX4-fl; knockdown (e.g., silencing) of DUX4 expression in the subject (e.g., cell in the subject), for example by administration of a recombinant gene editing complex targeting a D4Z4 macrosatellite repeat region, leads to reduced (or inhibited) expression and production of DUX4-fl in the subject.
[0035] In some aspects, the disclosure relates to the discovery that inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of certain genes that are downstream targets of DUX4-fl. For example, in some embodiments, inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of TRIM43, ZSCAN4, MBD3L2, or any combination of the foregoing, as described further in the Examples section.
[0036] In some embodiments, reduction of target gene (e.g., DUX4, TRIM43, ZSCAN4) expression can be measured as expression level of the target gene (e.g., DUX4) in a sample (e.g., a cell or a subject) after treatment with a recombinant gene editing complex relative to expression level of target gene (e.g., DUX4) in the sample prior to treatment with the recombinant gene editing complex. Generally, the expression level of a target gene (e.g., DUX4) can be measured by any suitable method known in the art, for example by hybridization-based assay (e.g., RT-PCR, qRT-PCR, Northern Blot), protein-based methods (e.g., Western blot), spectroscopic methods (e.g., mass spectrometry), and cell-based methods (e.g., flow cytometry, fluorescence activated cell sorting (FACS)).
Gene Editing Molecules
[0037] The disclosure is based, in part, on the discovery of recombinant gene editing complexes that inhibitfor example, through transcriptional repression or generation of double-stranded DNA breaks-expression of the DUX4 gene.
[0038] Accordingly, in some aspects, the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
[0039] As used herein, gene editing complex refers to a biologically active molecule (e.g., a protein, one or more proteins, a nucleic acid, one or more nucleic acids, or any combination of the foregoing) configured for adding, disrupting or changing genomic sequences (e.g., a gene sequence), for example by causing a double stranded break (DSB) in a target DNA or inhibiting transcription of a target DNA sequence. Examples of gene editing complexes include but are not limited to Transcription Activator-like Effector Nucleases (TALENs), Zinc Finger Nucleases (ZFNs), engineered meganuclease re-engineered homing endonucleases, the CRISPR/Cas system, and meganucleases (e.g., Meganuclease I-SceI). In some embodiments, a gene editing complex comprises proteins or molecules (e.g., recombinant gene editing proteins) related to the CRISPR/Cas system, including but not limited to Cas9,Cas6, dCas9, Cpf1, CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA), and variants thereof.
[0040] In some embodiments, a recombinant gene editing protein is a nuclease. As used herein, the terms endonuclease and nuclease refer to an enzyme that cleaves a phosphodiester bond or bonds within a polynucleotide chain. Nucleases may be naturally occurring or genetically engineered. Genetically engineered nucleases are particularly useful for genome editing and are generally classified into four families: zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases (e.g., engineered meganucleases) and CRISPR-associated proteins (Cas nucleases). In some embodiments, the nuclease is a ZFN. In some embodiments, the ZFN comprises a Fokl cleavage domain. In some embodiments, the ZFN comprises Cys.sub.2His.sub.2 fold group. In some embodiments, the nuclease is a TALEN. In some embodiments, the TALEN comprises a Fokl cleavage domain. In some embodiments, the nuclease is a meganuclease. Examples of meganucleases include but are not limited to I-SceI, I-CreI, I-DmoI, and combinations thereof (e.g., E-Drel, DmoCre).
[0041] The term CRISPR refers to clustered regularly interspaced short palindromic repeats, which are DNA loci containing short repetitions of base sequences. CRISPR loci form a portion of a prokaryotic adaptive immune system that confers resistance to foreign genetic material. Each CRISPR loci is flanked by short segments of spacer DNA, which are derived from viral genomic material. In the Type II CRISPR system, spacer DNA hybridizes to transactivating RNA (tracrRNA) and is processed into CRISPR-RNA (crRNA) and subsequently associates with CRISPR-associated nucleases (Cas nucleases) to form complexes that recognize and degrade foreign DNA. In certain embodiments, the nuclease is a CRISPR-associated nuclease (Cas nuclease). Examples of CRISPR nucleases include, but are not limited to Cas9, dCas9, Cas6, Cpf1, and variants thereof. In some embodiments, the nuclease is Cas9. In some embodiments, the Cas9 is derived from the bacteria Streptococcus pyogenes (e.g., SpCas9) or Staphylococcus aureus (e.g., SaCas9, for example SEQ ID NO: 42). In some embodiments, a Cas protein is modified (e.g. genetically engineered) to lack nuclease activity. For example, dead Cas9 (dCas9) protein binds to a target locus but does not cleave said locus. In some embodiments, a dCas9 protein comprises the sequence set forth in SEQ ID NO: 45. In some embodiments, a Cas protein or variant thereof does not exceed the packaging capacity of a viral vector, such as a lentiviral vector or an adeno-associated virus (AAV) vector, for example as described by Ran et al. (2015) Nature. 520(7546); 186-91. For example, in some embodiments, a nucleic acid encoding a Cas protein is less than about 4.6 kb in length.
[0042] Aspects of the disclosure relate to the use of CRISPR-mediated regulation of transcription, such as CRISPR interference, for the reduction (e.g. silencing) of DUX4 expression. For example, in some embodiments, a catalytically dead Cas9 protein (e.g., dead Cas9, dCas9) is fused (e.g., covalently bound) to a transcriptional regulator domain to modulate (e.g., inhibit) expression of a target gene (e.g., DUX4), as described by Qi et al. (2013) Cell. 152(5); 1173-1183 and Gilbert et al. (2013) Cell. 154(2); 442-451. In some embodiments, dCas9 comprises a sequence set forth in SEQ ID NO: 45. Without wishing to be bound by any particular theory, dCas9 (or another catalytically dead Cas protein) mediates transcriptional repression, in some embodiments, by sterically hindering the binding of transcriptional machinery (e.g., a RNA polymerase complex) to a target sequence.
[0043] In some embodiments, a CRISPR Cas protein (e.g., dCas9) is fused to a transcriptional regulator domain. As used herein a transcriptional regulator domain is a protein domain that catalyzes structural or chemical changes in a chromatin molecule that results in altered transcriptional activity (e.g., transcriptional activation or transcriptional repression). In some embodiments, the transcriptional regulator domain is a transcriptional repressor domain. In some embodiments, the repressive domain comprises a Kruppel associated box domain (KRAB domain). Non-limiting examples of KRAB domains include KOX1 KRAB domain, KOX8 KRAB domain, ZNF43 KRAB domain, and ZNF184 KRAB domain. In some embodiments, the KRAB domain is a KOX1 KRAB domain. In some embodiments, the gene editing protein comprises a sequence set forth in SEQ ID NO: 43 or 44. Further non-limiting examples of repressive domains include Chromo Shadow (CS) domain (e.g., CS domain of HP1) and WRPW domain (e.g., WRPW domain of Hes1).
[0044] In some embodiments, the transcriptional regulator domain is a transcriptional activator domain. In some embodiments, the transcriptional activator domain comprises a transcriptional activation domain of Herpes simplex virus, such as VP16, or a variant thereof. Generally, a transcription factor may contain multiple activation domains, for example as described by Beerli et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95(25); 14628-33. Accordingly, in some embodiments, the transcriptional activator domain comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 activation domains. In some embodiments, the transcriptional activator domain is VP64, VP96, or VP160.
[0045] In some embodiments, a Cas protein is not fused to a transcriptional regulator domain, and is capable of modulating (e.g., inhibiting) gene expression via nuclease activity (e.g., DNA cleavage). Generally, Cas9 cleaves DNA at a site targeted by the guide RNA and then repaired by either non-homologous end joining (NHEJ), which is imprecise and often results in a small insertion or deletion (InDel) that disrupts the targeted sequence, or homology directed DNA repair, which allows for the insertion of a changed or new DNA sequence into the genome at a specific location. Without wishing to be bound by any particular theory, DNA cleavage by a Cas protein and subsequent repair introduce modifications into a target DNA sequence that may adversely affect (e.g., inhibit) gene expression. Accordingly, in some aspects, the disclosure relates to a gene editing complex comprising a functional nuclease and a guide RNA that hybridizes to a D4Z4 macrosatellite repeat region that is capable of reducing expression of DUX4 in a subject (e.g., a cell of a subject). In some embodiments, the guide RNA that directs the activity of the functional nuclease targets exon 3 of the DUX4 gene.
[0046] For the purpose of genome editing, the CRISPR system can be modified to combine the tracrRNA and crRNA in to a single guide RNA (sgRNA) or just (gRNA). As used herein, the terms guide RNA, gRNA, and sgRNA refer to a polynucleotide sequence that is complementary to a target sequence in a cell and associates with a Cas nuclease, thereby directing the Cas nuclease to the target sequence. In some embodiments, a gRNA (e.g., sgRNA) ranges between 1 and 30 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 5 and 25 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 10 and 22 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 14 and 24 nucleotides in length. In some embodiments, a Cas protein and a guide RNA (e.g., sgRNA) are expressed from the same vector. In some embodiments, a Cas protein and a guide RNA (e.g., sgRNA) are expressed from separate vectors (e.g., two or more vectors).
[0047] Typically, a guide RNA (e.g., a gRNA or sgRNA) hybridizes (e.g., binds specifically to, for example by Watson-Crick base pairing) to a target sequence and thus directs the CRISPR/Cas protein to the target sequence. In some embodiments, a guide RNA hybridizes to (e.g., targets) a nucleic acid sequence encoding a D4Z4 macrosatellite repeat region or a nucleic acid sequence encoding DUX4 gene. In some embodiments, the gRNA hybridizes to a p13E-11 sequence or a NDE sequence. In some embodiments, the gRNA hybridizes to exon 1, exon 2 or exon 3 of a DUX4 gene. In some embodiments, the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 1-11, for example as described in Table 1.
Methods of Treatment
[0048] In some aspects, the disclosure provides methods for treating a subject having facioscapulohumeral muscular dystrophy (FSHD). For example, transcriptional activation of the DUX4 gene may lead to FSHD in a subject. As used herein, a subject is interchangeable with a subject in need thereof, both of which may refer to a subject having FSHD, or a subject having an increased risk of developing such a disorder relative to the population at large. For example, in some embodiments, a subject has a D4Z4 array comprising 11 or fewer repeat units at chromosome 4q35 but does not exhibit signs or symptoms of FSHD. A subject in need thereof may be a subject having a transcriptionally active DUX4 gene (e.g., a subject expressing DUX4-fl protein). A subject can be a human, non-human primate, rat, mouse, cat, dog, or other mammal.
[0049] As used herein, the terms treatment, treating, and therapy refer to therapeutic treatment and prophylactic or preventative manipulations. The terms further include ameliorating existing symptoms, preventing additional symptoms, ameliorating or preventing the underlying causes of symptoms, preventing or reversing causes of symptoms, for example, symptoms associated with FSHD. Thus, the terms denote that a beneficial result has been conferred on a subject having FSHD, or with the potential to develop such a disorder. Furthermore, the term treatment is defined as the application or administration of an agent (e.g., therapeutic agent or a therapeutic composition) to a subject, or an isolated tissue or cell line from a subject, who may have a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
[0050] Therapeutic agents or therapeutic compositions may include a compound in a pharmaceutically acceptable form that prevents and/or reduces the symptoms of a particular disease (e.g., FSHD). For example a therapeutic composition may be a pharmaceutical composition that prevents and/or reduces the symptoms of FSHD. In some embodiments, the disclosure provides a composition (e.g., a therapeutic composition) comprising a gene editing complex as described by the disclosure or a vector as described by the disclosure. In some embodiments, the composition further comprises a pharmaceutically acceptable excipient. It is contemplated that the therapeutic composition of the present invention will be provided in any suitable form. The form of the therapeutic composition will depend on a number of factors, including the mode of administration as described herein. The therapeutic composition may contain diluents, adjuvants and excipients, among other ingredients as described herein.
[0051] In some aspects, the disclosure provides a method for inhibiting (e.g., silencing) a transcriptionally active DUX4 gene in a cell, the method comprising: delivering to the cell an effective amount of gene editing complex, wherein the gene editing complex reduces DUX4 expression in the cell.
[0052] The cell containing an effective amount of a gene editing complex can be any cell that has a transcriptionally active DUX4 gene. For example, the cell can be a muscle cell (e.g., a myoblast, myocyte, or terminally differentiated muscle cell).
[0053] A cell having a transcriptionally active DUX4 gene can also comprise a contraction of a D4Z4 repeat array at chromosome 4q35 of the DUX4 gene. The number of repeat units in the array can vary. In some embodiments, the number of repeat units in the contraction is 11 or fewer (e.g., 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0) repeat units. In some embodiments, the cell is in vitro or ex vivo.
[0054] In some aspects, gene editing complexes described by the disclosure are useful for the production of modified cells, such as ex vivo modified cells. As used herein, ex vivo modified cell refers to a cell (e.g., a mammalian cell) that is removed from a subject, genetically modified (e.g., transfected or transduced with exogenous nucleic acids, or genetically reprogrammed), cultured or expanded, and optionally, returned to a subject (e.g., either the same subject, or a different subject). Generally, ex vivo modified cells are useful for autologous cell therapy, or allogeneic cell therapy. For example, cells may be removed from a subject having a disease associated with a particular genetic defect (e.g., FSHD), transfected with a gene editing complex that corrects the genetic defect (e.g. reduces expression of DUX4), and reintroduced into the subject. In another non-limiting example, cells are removed from a subject, genetically reprogrammed (e.g., dedifferentiated or transdifferentiated into muscle cells), expanded, and reintroduced into the subject. In some embodiments, ex vivo modified cells produced by transfection with a nucleic acid as described by the disclosure have an improved safety profile compared to ex vivo cells produced by currently available gene therapy vectors.
Pharmaceutical Compositions
[0055] In some aspects, the disclosure relates to pharmaceutical compositions comprising a gene editing complex. In some embodiments, the composition comprises gene editing complex and a pharmaceutically acceptable carrier. As used herein the term pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions. Pharmaceutical compositions can be prepared as described below. The active ingredients may be admixed or compounded with any conventional, pharmaceutically acceptable carrier or excipient. The compositions may be sterile.
[0056] Typically, pharmaceutical compositions are formulated for delivering an effective amount of an agent (e.g., gene editing complex). In general, an effective amount of an active agent refers to an amount sufficient to elicit the desired biological response (e.g., transcriptional repression, such as silencing or inhibition, of the active DUX4 gene). An effective amount of an agent may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated (e.g., FSHD), the mode of administration, and the patient.
[0057] A composition is said to be a pharmaceutically acceptable carrier if its administration can be tolerated by a recipient patient. Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier. Other suitable carriers are well-known in the art. See, for example, REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Ed. (1990).
[0058] It will be understood by those skilled in the art that any mode of administration, vehicle or carrier conventionally employed and which is inert with respect to the active agent may be utilized for preparing and administering the pharmaceutical compositions of the present disclosure. Illustrative of such methods, vehicles and carriers are those described, for example, in Remington's Pharmaceutical Sciences, 4th ed. (1970), the disclosure of which is incorporated herein by reference. Those skilled in the art, having been exposed to the principles of the disclosure, will experience no difficulty in determining suitable and appropriate vehicles, excipients and carriers or in compounding the active ingredients therewith to form the pharmaceutical compositions of the disclosure.
[0059] An effective amount, also referred to as a therapeutically effective amount, of a compound (for example, a gene editing complex or vector as described by the disclosure) is an amount sufficient to ameliorate at least one adverse effect associated with activation (e.g., transcriptional activation), or increased expression, of the gene in a cell or in an individual in need of such modulation. In some embodiments, an effective amount is an amount sufficient to inhibit (e.g., transcriptionally repress) DUX4 gene in a cell or in an individual in need of DUX4 inhibition. The therapeutically effective amount to be included in pharmaceutical compositions depends, in each case, upon several factors, e.g., the type, size and condition of the patient to be treated, the intended mode of administration, the capacity of the patient to incorporate the intended dosage form, etc. Generally, an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg. In the case of viral vectors, an amount of active agent can be included in each dosage form to provide between about 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, or 10.sup.15 genome copies per subject. One of ordinary skill in the art would be able to determine empirically an appropriate therapeutically effective amount.
[0060] Combined with the teachings provided herein, by choosing among the various active compounds and weighing factors such as potency, relative bioavailability, patient body weight, severity of adverse side-effects and selected mode of administration, an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject. The effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular therapeutic agent being administered, the size of the subject, or the severity of the disease or condition. One of ordinary skill in the art can empirically determine the effective amount of a particular nucleic acid and/or other therapeutic agent without necessitating undue experimentation.
[0061] In some cases, compounds of the disclosure are prepared in a colloidal dispersion system. Colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. In some embodiments, a colloidal system of the disclosure is a liposome. Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vesicles (LUVs), which range in size from 0.2-4.0 m can encapsulate large macromolecules. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form. Fraley et al. (1981) Trends Biochem Sci 6:77.
[0062] Liposomes may be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein. Ligands which may be useful for targeting a liposome to, for example, an smooth muscle cell include, but are not limited to: intact or fragments of molecules which interact with smooth muscle cell specific receptors and molecules, such as antibodies, which interact with the cell surface markers of cancer cells. Such ligands may easily be identified by binding assays well known to those of skill in the art. In still other embodiments, the liposome may be targeted to a tissue by coupling it to an antibody known in the art.
[0063] Lipid formulations for transfection are commercially available from QIAGEN, for example, as EFFECTENE (a non-liposomal lipid with a special DNA condensing enhancer) and SUPERFECT (a novel acting dendrimeric technology).
[0064] Liposomes are commercially available from Gibco BRL, for example, as LIPOFECTIN and LIPOFECTACE, which are formed of cationic lipids such as N-[1-(2, 3 dioleyloxy)-propyl]-N, N, N-trimethylammonium chloride (DOTMA) and dimethyl dioctadecylammonium bromide (DDAB). Methods for making liposomes are well known in the art and have been described in many publications. Liposomes also have been reviewed by Gregoriadis G (1985) Trends Biotechnol 3:235-241.
[0065] Certain cationic lipids, including in particular N-[1-(2, 3 dioleoyloxy)-propyl]-N,N,N-trimethylammonium methyl-sulfate (DOTAP), may be advantageous when combined with the gene editing complexes and vectors of the disclosure.
[0066] In some aspects of the disclosure, the use of compaction agents may also be desirable. Compaction agents also can be used alone, or in combination with, a biological or chemical/physical vector. A compaction agent, as used herein, refers to an agent, such as a histone, that neutralizes the negative charges on the nucleic acid and thereby permits compaction of the nucleic acid into a fine granule. Compaction of the nucleic acid facilitates the uptake of the nucleic acid by the target cell. The compaction agents can be used alone, e.g., to deliver a gene editing complex or a vector as described by the disclosure in a form that is more efficiently taken up by the cell or, in combination with one or more of the above-described carriers.
[0067] Other exemplary compositions that can be used to facilitate uptake of a gene editing complex or vector as described by the disclosure include calcium phosphate and other chemical mediators of intracellular transport, microinjection compositions, electroporation and homologous recombination compositions (e.g., for integrating a nucleic acid into a preselected location within the target cell chromosome).
[0068] The compounds may be administered alone (e.g., in saline or buffer) or using any delivery vehicle known in the art. For instance the following delivery vehicles have been described: cochleates; Emulsomes; ISCOMs; liposomes; live bacterial vectors (e.g., Salmonella, Escherichia coli, Bacillus Calmette-Gurin, Shigella, Lactobacillus); live viral vectors (e.g., Vaccinia, adenovirus, Herpes Simplex, Lentiviral); microspheres; nucleic acid vaccines; polymers (e.g., carboxymethylcellulose, chitosan); polymer rings; proteosomes; sodium fluoride; transgenic plants; virosomes; and, virus-like particles. In some embodiments, gene editing complexes described by the disclosure are delivered by lentiviral vector or recombinant adeno-associated virus (rAAV) vector.
[0069] The formulations of the disclosure are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
[0070] The term pharmaceutically-acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal. The term carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application. The components of the pharmaceutical compositions also are capable of being commingled with the compounds of the present disclosure, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficiency.
[0071] Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
[0072] In addition to the formulations described herein, the compounds may also be formulated as a depot preparation. Such long-acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
[0073] The pharmaceutical compositions also may comprise suitable solid or gel phase carriers or excipients. Examples of such carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
[0074] Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin. The pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above. The pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer R (1990) Science 249:1527-1533, which is incorporated herein by reference.
[0075] The compounds may be administered per se (neat) or in the form of a pharmaceutically acceptable salt. When used in medicine the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof. Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2-sulphonic, and benzene sulphonic. Also, such salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
[0076] Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v). Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3-0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
[0077] The compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the compounds into association with a carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing the compounds into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product. Liquid dose units are vials or ampoules. Solid dose units are tablets, capsules and suppositories.
Modes of Administration
[0078] The pharmaceutical compositions of the present disclosure preferably contain a pharmaceutically acceptable carrier or excipient suitable for rendering the compound or mixture administrable orally as a tablet, capsule or pill, or parenterally, intravenously, intradermally, intramuscularly or subcutaneously, or transdermally.
[0079] In some embodiments, a therapeutically effective amount of a gene editing complex or vector as described by the disclosure is delivered to a target tissue or a target cell. In some embodiments, DUX4 (e.g., DUX4-fl) is expressed in muscle cells of a subject having FSHD. Thus, in some embodiments, an effective amount of gene editing complex or vector is delivered to the muscle cells of a subject. In some embodiments, the muscle cells are myoblasts. In some embodiments, the muscle cells are terminally differentiated muscle cells. Examples of differentiated muscle cells include myocytes and myotubes.
[0080] The pharmaceutical compositions containing gene editing complex or vector, and/or other compounds can be administered by any suitable route for administering medications. A variety of administration routes are available. The particular mode selected will depend, of course, upon the particular agent or agents selected, the particular condition being treated, and the dosage required for therapeutic efficacy. The methods of this disclosure, generally speaking, may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces therapeutic effect without causing clinically unacceptable adverse effects. Various modes of administration are discussed herein. For use in therapy, an effective amount of the gene editing complex or vector, and/or other therapeutic agent can be administered to a subject by any mode that delivers the agent to the desired surface, e.g., systemic, intramuscular, etc. In some embodiments, the gene editing complex or vector as described by the disclosure is administered to a subject via intramuscular (IM) injection.
[0081] However, it should be appreciated that administering the pharmaceutical composition of the present disclosure may be accomplished by any means known to the skilled artisan. Additional routes of administration include but are not limited to oral, parenteral, intravenous, intraperitoneal, intranasal, sublingual, intratracheal, inhalation, subcutaneous, ocular, vaginal, and rectal. Systemic routes include oral and parenteral. Several types of devices are regularly used for administration by inhalation. These types of devices include metered dose inhalers (MDI), breath-actuated MDI, dry powder inhaler (DPI), spacer/holding chambers in combination with MDI, and nebulizers.
[0082] For oral administration, the compounds can be formulated readily by combining the active compound(s) with pharmaceutically acceptable carriers well known in the art. Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated. Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Optionally the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
[0083] Pharmaceutical preparations which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
[0084] For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.
[0085] For administration by inhalation, the compounds for use according to the present disclosure may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
[0086] The compounds, when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
[0087] Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
[0088] Alternatively, the active compounds may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
[0089] The compounds may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g., containing conventional suppository bases such as cocoa butter or other glycerides.
[0090] Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109. Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di-, and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which an agent of the disclosure is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775, 4,675,189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos. 3,854,480, 5,133,974 and 5,407,686. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
[0091] In some embodiments, a gene editing complex (e.g., a nucleic acid encoding one or more components of a gene editing complex) can be delivered to the cells via an expression vector engineered to express the gene editing complex. An expression vector is one into which a desired sequence may be inserted, e.g., by restriction and ligation, such that it is operably joined to regulatory sequences and may be expressed as an RNA transcript. An expression vector typically contains an insert that is a coding sequence for a protein (e.g., gene editing protein, such as a CRISPR/Cas protein) or for a polynucleotide, such as guide RNA (gRNA, sgRNA, etc.). Vectors may further contain one or more marker sequences suitable for use in the identification of cells that have or have not been transformed or transfected with the vector. Markers include, for example, genes encoding proteins that increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes that encode enzymes whose activities are detectable by standard assays or fluorescent proteins, etc.
[0092] As used herein, a coding sequence (e.g., protein coding sequence, miRNA sequence, shRNA sequence) and regulatory sequences are said to be operably joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences. If it is desired that the coding sequences be translated into a functional protein, two DNA sequences are said to be operably joined if induction of a promoter in the 5 regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein. Thus, a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide. It will be appreciated that a coding sequence may encode an miRNA, shRNA or siRNA.
[0093] The precise nature of the regulatory sequences needed for gene expression may vary between species or cell types, but shall in general include, as necessary, 5 non-transcribed and 5 non-translated sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, and the like. Such 5 non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene. However, in some embodiments, a vector does not include a promoter sequence. Regulatory sequences may also include enhancer sequences, upstream activator sequences, internal ribosomal entry sites (IRES), and/or self-processing peptide sequences (e.g., 2A peptide), as desired. The vectors of the disclosure may optionally include 5 leader or signal sequences.
[0094] In some embodiments, a virus vector for delivering a nucleic acid molecule is selected from the group consisting of adenoviruses, adeno-associated viruses, poxviruses including vaccinia viruses and attenuated poxviruses, Semliki Forest virus, Venezuelan equine encephalitis virus, retroviruses, Sindbis virus, and Ty virus-like particle. Examples of viruses and virus-like particles which have been used to deliver exogenous nucleic acids include: replication-defective adenoviruses, a modified retrovirus, a nonreplicating retrovirus, a replication defective Semliki Forest virus, canarypox virus and highly attenuated vaccinia virus derivative, non-replicative vaccinia virus, replicative vaccinia virus, Venzuelan equine encephalitis virus, Sindbis virus, lentiviral vectors and Ty virus-like particle.
[0095] Another virus useful for certain applications is the adeno-associated virus. The adeno-associated virus is capable of infecting a wide range of cell types and species and can be engineered to be replication-deficient. It further has advantages, such as heat and lipid solvent stability, high transduction frequencies in cells of diverse lineages, including hematopoietic cells, and lack of superinfection inhibition thus allowing multiple series of transductions. The adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression. In addition, wild-type adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event. The adeno-associated virus can also function in an extrachromosomal fashion.
[0096] Generally, a recombinant AAV vector (rAAV) comprises, at a minimum, a transgene coding sequence (e.g., a nucleic acid sequence encoding a gene editing protein, such as a Cas protein, or a gRNA) and its associated regulatory sequence flanked by two AAV inverted terminal repeat (ITR) sequences. Examples of regulatory sequences include promoters (e.g., constitutive promoters, inducible promoters, tissue-specific promoters), enhancer sequences, etc. In some embodiments, the ITR sequences are AAV1, AAV2, AAV5, AAV6, AAV7, AAV8, or AAV9 ITR sequences, or variants thereof.
[0097] In some embodiments, an rAAV vector comprising a nucleic acid encoding all or part of a gene editing complex (e.g., a nucleic acid sequence encoding a gene editing protein, a gRNA, or both) is packaged into a recombinant AAV (rAAV). Typically, an AAV vector is packaged into viral particles by one or more AAV capsid proteins. The AAV capsid is an important element in determining these tissue-specific targeting capabilities. Thus, an rAAV having a capsid appropriate for the tissue being targeted can be selected. In some embodiments, the capsid protein has a serotype selected from AAV2, AAV3, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAVrh.8, AAVrh.10, AAVrh.39, and AAVrh.43. In some embodiments, the rAAV comprises a capsid protein that targets muscle cells.
[0098] In general, other useful viral vectors are based on non-cytopathic eukaryotic viruses in which non-essential genes have been replaced with the gene of interest. Non-cytopathic viruses include certain retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. In general, the retroviruses are replication-deficient (e.g., capable of directing synthesis of the desired transcripts, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo. Standard protocols for producing replication-deficient retroviruses (including the steps of incorporation of exogenous genetic material into a plasmid, transfection of a packaging cell lined with plasmid, production of recombinant retroviruses by the packaging cell line, collection of viral particles from tissue culture media, and infection of the target cells with viral particles) are provided in Kriegler, M., Gene Transfer and Expression, A Laboratory Manual, W. H. Freeman Co., New York (1990) and Murry, E. J. Ed. Methods in Molecular Biology, vol. 7, Humana Press, Inc., Clifton, N.J. (1991). In some embodiments, gene editing complex (e.g., a nucleic acid sequence encoding a gene editing protein, a gRNA, or both) is delivered to a cell (e.g. a cell of a subject) by a lentiviral vector.
[0099] Various techniques may be employed for introducing nucleic acid molecules of the disclosure into cells, depending on whether the nucleic acid molecules are introduced in vitro or in vivo in a host. Such techniques include transfection of nucleic acid molecule-calcium phosphate precipitates, transfection of nucleic acid molecules associated with DEAE, transfection or infection with the foregoing viruses including the nucleic acid molecule of interest, liposome-mediated transfection, and the like. Other examples include: N-TER Nanoparticle Transfection System by Sigma-Aldrich, FectoFly transfection reagents for insect cells by Polyplus Transfection, Polyethylenimine Max by Polysciences, Inc., Unique, Non-Viral Transfection Tool by Cosmo Bio Co., Ltd., Lipofectamine LTX Transfection Reagent by Invitrogen, SatisFection Transfection Reagent by Stratagene, Lipofectamine Transfection Reagent by Invitrogen, FuGENE HD Transfection Reagent by Roche Applied Science, GMP compliant in vivo-jetPEI transfection reagent by Polyplus Transfection, and Insect GeneJuice Transfection Reagent by Novagen.
EXAMPLES
Example 1
Materials and Methods
Plasmids and Antibodies.
[0100] The following plasmids were used in this example: pHAGE EF1-dCas9-VP64 (Addgene plasmid #50918), pHAGE EF1-dCas9-KRAB (Addgene plasmid#50919), pLKO.1-puro U6 sgRNA BfuAI stuffer (Addgene plasmid #50920), pHRdSV40-dCas9-10xGCN4-v4-P2A-BFP (Addgene plasmid #60903), and pHRdSV40-scFv-GCN4-sfGFP-VP64-GB1-NLS (Addgene plasmid #60904), pHR-scFv-GCN4-sfGFP-GB1-NLS-dWPRE (Addgene plasmid #60906).
[0101] ChIP-grade antibodies used in this example include: -KAP1(ab3831), -HP1 (ab77256), -HP1 (ab10811), -histone H3 (ab1791), -histone H3K27acetyl (ab4729), and -RNA Polymerase II CTD phosphor S2 (ab5095).
[0102] Other antibodies used for ChIP were -HA high affinity (clone 3F10) and normal mouse IgG (sc-2025).
sgRNA Design and Plasmid Construction.
[0103] An sgRNA design tool was used to identify high-scoring candidate sgRNAs to four target regions within and flanking the D4Z4 repeat array (
Cell Culture, Transient Transfections, and Lentiviral Infections.
[0104] Myogenic cultures derived from biceps muscle of an FSHD1 patient (17Abic) were used in this example. Patient 17A has two permissive 4qA alleles (5 repeat units on a contracted 4A161 allele; 26 repeat units on the non-contracted 4A-L161 allele; each 10 q allele has 37 repeat units). 17Abic myoblasts were grown in Ham's F-10 medium supplemented with 20% FBS (Hyclone), 0.5% chick embryo extract, 1% antibiotics and antimycotics, and 1.2 mmol/1 CaCl2. 293 T packaging cells were grown in DMEM+10% FBS+0.1% penicillin-streptavidin. At 80% confluency, 293 T cells were transfected with lentiviral packaging plasmid (pCMV-dR8.91), envelope plasmid (VSV-G), and sgRNA expression plasmid using the TranslT-LT1 transfection reagent (Mirus). Lentiviral supernatants were harvested at 11-hour intervals from 72-108 hours post-transfection. At 70-80% confluency, 17Abic myoblasts were subjected to four serial infections. Briefly, lentiviral supernatants +8 g/ml polybrene were added to myoblasts and the plates were incubated for 15 minutes at 37 C., then wrapped well with parafilm before centrifuging for 30 minutes at 1,100 g (32 C.). Following centrifugation, the viral supernatants were replaced with growth medium and cells were allowed to recover for 8 hours prior to the next round of infection. Following the last round of infection, cells were switched to differentiation medium (DM) (DMEM/F-12 medium (1:1, Hyclone) plus 2% horse serum (Lonza)) for 40-48 hours prior to harvesting.
qRT-PCR.
[0105] Total RNAs were extracted using TRIzol (Invitrogen) and purified using the RNeasy Mini kit (Qiagen) after on-column DNase I digestion. Total RNA (2 g) was used for cDNA synthesis using Superscript III Reverse Transcriptase (Invitrogen), and 200 ng of cDNA were used for qPCR analysis. Oligonucleotide primer sequences are provided in Table 2.
ChIP.
[0106] ChIP assays were performed with lentiviral-infected 17Abic differentiated myocytes using the Fast ChIP method. Cells were fixed in 1% formaldehyde in DMEM for 10 minutes and dounced 10 prior to sonication. Cells were sonicated for 12 rounds of 15-second pulses at 65% power output on a Branson Sonifier 450 (VWR Scientific) to shear the DNA to a ladder of 200-800 bp, and efficiency of shearing was verified by agarose gel electrophoresis. Chromatin was immunoprecipitated using 2 g of specific antibodies or normal IgG. SYBR green quantitative PCR assays were performed for 40 cycles of: 94 C. for 15 seconds, 55 C. for 30 seconds, and 72 C. for 30 seconds. PCR products were analyzed on a 1.5% agarose gel to verify correct size of products and specificity of primer annealing. Oligonucleotide primer sequences are provided in Table 2.
Example 2
CRISPR/Cas9 Approaches for Fascioscapulohumeral Muscular Dystrophy (FSHD)
[0107] Recruitment of dCas9 and VP64 to the DUX4 Promoter or exon 1 Activates DUX4 fl in FSHD myocytes
[0108] To search for potential FSHD therapeutic targets in vivo, the CRISPR/dCas9 system was used to test several candidate regions in or flanking the 4q35 D4Z4/DUX4 locus for the ability to modulate gene expression in the D4Z4 array. Polyadenylated DUX4 fl mRNA levels in FSHD1 myocytes were used as a read-out for gene expression which is specifically derived from the contracted 4q35 D4Z4 array. When targeted by small guide RNAs (sgRNAs), dCas9 transcriptional effector platforms are effective in modulating endogenous gene expression levels in mammalian cells. In this example, the SunTag system was used, which involves the dual activity of two constructs: (i) dCas9 fused to 10 copies of the GCN4 peptide and (ii) GCN4 antibody fused to the VP64 activator. The dCas9 fused directly to VP64 generally requires multiple, non-overlapping sgRNAs to achieve strong activation of gene expression. In contrast, the SunTag system allows recruitment of multiple VP64 domains to a single dCas9, resulting in robust gene activation with only a single sgRNA. Myogenic cells from an FSHD1 patient (17Abic), which express consistent and relatively high levels of DUX4 fl when terminally differentiated, were used in this example.
[0109] Single guide RNAs (sgRNAs) targeting two candidate regions upstream of the D4Z4 repeat (
[0110] Primary myoblasts were transfected (infected) by four serial rounds of viral exposure with centrifugation. After the final round of infection, the cells were induced to differentiate and harvested 48 hours later for analysis of DUX4 fl expression by quantitative reverse transcriptase polymerase chain reaction (qRT-PCR). Expression of the SunTag system alone had no effect on DUX4 fl mRNA levels in FSHD myocytes (
Recruitment of dCas9-KRAB to the DUX4 Promoter or exon 1 represses DUX4-fl in FSHD myocytes
[0111] Reducing the aberrant expression of DUX4-fl in FSHD by returning the chromatin at the disease locus to a nonpathogenic, repressed state is a viable avenue of therapy. Whether DUX4-fl expression could be reduced in FSHD myocytes using a dCas9-KRAB repressor was examined. When guided by multiple sgRNAs, dCas9-KRAB has proven effective in reducing target gene expression in mammalian cells. Since dCas9-mediated recruitment of VP64 to the DUX4 promoter or exon 1 strongly activated DUX4-fl expression, these regions were selected as candidates for therapeutic targeting with dCas9-KRAB. Four serial coinfections of FSHD myogenic cultures were carried out. Cells were infected with various combinations of lentiviral supernatants expressing either dCas9-KRAB or individual sgRNAs targeting the candidate regions. After the final round of infection, the cells were induced to differentiate and harvested 40 hours later for analysis of DUX4-fl expression by qRT-PCR.
[0112] Expression of the dCas9-KRAB repressor alone had little effect on DUX4-fl levels
[0113] (
[0114] Previous studies have demonstrated that in some contexts, dCas9 can inhibit transcription through steric hindrance of target regions. To determine whether the repressive effects observed were due to an obstruction mechanism rather than KRAB-mediated repression, the effect of a dCas9 variant lacking an effector domain (e.g. KRAB) was tested. Recruitment of dCas9 alone to any of the target regions did not reduce levels of DUX4-fl (
[0115] In FSHD myogenic cultures, DUX4-FL expression is restricted to terminally differentiated myocytes. To rule out a nonspecific effect of dCas9-KRAB on muscle differentiation, levels of Myosin heavy chain (MyHC), a marker of terminal muscle differentiation, were assessed by qRT-PCR. Importantly, MyHC levels were equivalent in all cultures expressing dCas9-KRAB and sgRNAs (
Recruitment of dCas9-KRAB to the DUX4 Promoter or exon 1 Represses DUX4-FL Targets in FSHD myocytes
[0116] Expression of DUX4-FL in FSHD myocytes causes the aberrant upregulation of many downstream targets, including genes expressed in the germline and in early development. TRIM43, ZSCAN4, and MBD3L2 are downstream targets of DUX4-FL that were also found to be upregulated in the myogenic cultures used in this example. To determine whether dCas9-KRAB-mediated repression of DUX4 fl also results in repression of these DUX4-FL target genes, expression levels of TRIM43, ZSCAN4, and MBD3L2 were measured by qRT-PCR in the cells. It was observed that expression of these genes was not significantly altered by expressing the dCas9-KRAB repressor alone or by targeting the repressor to p13-E11 or to DUX4 exon 3 (
[0117] Next, the question of whether targeting a transcriptional effector to the DUX4 promoter or exon 1 has any effect on the expression of several predicted off-target genes was addressed. Of the sgRNAs used in this example to decrease expression of DUX4 fl and its downstream targets, #3 and #6 have the fewest off-target matches in the human genome (Table 1). The expression levels of several genes at a range of distances from off-target matches to sgRNAs #3 and #6 were examined in cells expressing the SunTag activator and either sgRNA. Since the binding specificity of an sgRNA is largely determined by the PAM-proximal sequence, genes in the vicinity of off-target matches to 9- or 12-bp seed sequences +NGG (PAM) were identified. For sgRNA #3, expression level of the histone demethylase Jumonji, which contains an off-target match (12-bp seed +PAM) in intron 7, was quantified. It was observed that expression of the untargeted SunTag system alone had a slight repressive effect on levels of Jumonji (
[0118] Recruitment of dCas9-KRAB to the DUX4 Promoter or exon 1 Represses the D4Z4 locus in FSHD myocytes
[0119] To determine whether changes in the D4Z4 chromatin structure could be detected, FSHD myogenic cultures were infected with lentiviral supernatants expressing dCas9-KRAB and sgRNAs targeting the DUX4 promoter or exon 1, and cells were induced to differentiate, then fixed and harvested 40 hours later for analysis by ChIP. Recruitment of the dCas9 repressor to the DUX4 promoter resulted in a trend toward increased levels of the KAP1/TRIM28 corepressor, which is recruited by the KRAB domain, as well as HP1 and HP1, which are recruited by KAP1 to heterochromatin (
[0120] Recruitment of the dCas9 repressor to DUX4 exon 1 increased levels of KAP1 at DUX4 intron 1, but had little observable effect on levels of HP1 or H3K27 acetylation across the gene (
In Vivo Experiments
[0121] Repression of DUX4-fl in vivo was examined in a mouse model of FSHD. Mice were injected intramuscularly (IM) into Tibialis anterior (TA) muscle with AAV-dCas9KRAB and GFP-labeled DUX4 sgRNA. Relative expression level of DUX4-fl mRNA was measured and normalized to GAPDH.
[0122] Catalytically Active Cas9 Nuclease Targeted by DUX4 sgRNA
[0123] AAV-compatible, catalytically active SpCas9was recruited to the FSHD locus in primary human myogenic cells by using sgRNA targeting exon 3 of the DUX4 gene. Targeting of the Cas9 nuclease to exon 3 of DUX4 resulted in reduction of DUX4 expression as quantified by relative mRNA expression (
TABLE-US-00001 TABLE1 sgRNAsequencestargetingtheD4Z4/DUX4region sgRNA (SEQ IDNO:) Target *19-ntsequence+ PAM(NGG) Score** Enrich{circumflex over ()} OT(12).sup.# OT(19).sup.## 1 p13-E11 TACCACAGACAGCCAACTGGGG 0.61 6.9 18 0 2 p13-E11 TTCACCCAGAACAGTAACTGGG 0.60 1.6 27 0 3 DUX4 CACCCGGGCAAAAGCCGGGAGG 0.61 2.5 8 1(Y) E1 4 DUX4 CTGGAAGCACCCCTCAGCGAGG 0.85 2.4 9 3(14/18/Y) E1 5 DUX4 CTGGAGGAGCTTTAGGACGCGG 0.65 2.2 14 6(14/18/20/22/Y) E1 6 DUX4 CTCGCTCTGGTCTTCTACGTGG 0.72 2.0 4 0 prom 7 DUX4 CCGTCCGTGAAATTCCGGCCGG 0.76 1.7 10 1(20) prom 8 DUX4 TCGGACAGCACCCTCCCCGCGG 0.79 2.6 19 3(3/14/Y) prom 9 DUX4 CTCCCTTGCACGTCAGCCGGGG 0.84 3.4 7 2(14/18) E3 10 DUX4 GAATTTCACGGAAGAACAAGGG 0.76 1.8 5 0 E3 11 DUX4 ATCTTCTATAGGATCCACAGGG 0.88 2.0 9 0 E3 CpGs are underlined **sgRNA Designer score. {circumflex over ()}Relative enrichment of dCas9-VP64-HA (Addgene plasmid #50918) at each target region measured by chromatin immunoprecipitation (ChIP) using HA antibodies normalized to mouse IgG. .sup.#Number of off-target (non-Ch 4/10) matches to 12-nt seed sequence + NGG in human genomic database. .sup.##Number of off-target (non-Ch 4/10) matches to 19-nt sequence + NGG in human genomic database (chromosomes in parentheses).
[0124] All off-target matches except those underlined are in D4Z4 homologous repeat sequences.
TABLE-US-00002 TABLE2 Primersequences SEQ ID PrimerName Sequence(5-3) NO: DUX4-f1-F GCTCTGCTGGAGGAGCTTTAGGA 12 DUX4-f1-R GCAGGTCTGCWGGTACCTGG 13 MyHC1-F TGGAGGCCAGGGTTCGTGAA 14 MyHC1-R ATTGTTCCTCCGCTTCTTCAGC 15 FRG1-F TCTACAGAGACGTAGGCTGTCA 16 FRG1-R CTTGAGCACGAGCTTGGTAG 17 FRG2-F GGGAAAACTGCAGGAAAA 18 FRG2-R CTGGACAGTTCCCTGCTGTGT 19 TRIM43-F ACCCATCACTGGACTGGTGT 20 TRIM43-R CACATCCTCAAAGAGCCTGA 21 ZSCAN4-F TGGAAATCAAGTGGCAAAAA 22 ZSCAN4-R CTGCATGTGGACGTGGAC 23 MBD3L2-F GCGTTCACCTCTTTTCCAAG 24 MBD3L2-R GCCATGTGGATTTCTCGTTT 25 Jumonji-F AAGAAAAAGCCTCGAAAGTG 26 Jumonji-R AGAGCACACTCCAGACAGAA 27 KLF14-F TGCAACGTGTATATCATCCT 28 KLF14-R ACACCAGAGTCCTTTGAGAC 29 UBR4-F GGAGTCTGTGGCAACTGTGGAGAGAATG 30 UBR4-R CCGGTCTTCTTCATTCTCAATGGGATCCACT 31 OT-F* GAATGTGGACACGGTAAAGA 32 OT-R** TAGGTTTGACTGCCAATGAC 33 p13-E11-F TGGGCATTTTCTCATTAGCC 34 p13-E11-R CTGGAGCAGAGATGACCACA 35 DUX4-exon1-F GACACCCTCGGACAGCAC 36 DUX4-exon1-R GTACGGGTTCCGCTCAAAG 37 DUX4-intron1-F CTCAGCGAGGAAGAATACCG 38 DUX4-intron1-R AGTCTCTCACCGGGCCTAGA 39 DUX4-exon3-F CTGACGTGCAAGGGAGCT 40 DUX4-exon3-R CAGGTTTGCCTAGACAGCG 41 *OT-F: (intergenic region on Ch. 8, ref NC_018919.2) OT-R: (intergenic region on Ch. 8, ref NC_018919.2) SaCas9 Protein (SEQ ID NO: 42) MAPKKKRKVGIHGVPAAKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRL FKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGI NPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKEQ ISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTY FPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQ KKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEI IENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGT HNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLVDD FILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEM QKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLED LLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSD SKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLV DTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGY KHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQE YKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTL IVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEK NPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNSRN KVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKL KKISNQAEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREY LENMNDKRPPRIIKTIASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKGKR PAATKKAGQAK Sa-dCas9-KRAB (SEQ ID NO: 43) MAPKKKRKVGIHGVPAAKRNYILGLAIGITSVGYGIIDYETRDVIDAGVRL FKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGI NPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKEQ ISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTY FPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQ KKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEI IENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGT HNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLVDD FILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEM QKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLED LLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEEASKKGNRTPFQYLSSSD SKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLV DTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGY KHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQE YKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTL IVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEK NPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNSRN KVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKL KKISNQAEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREY LENMNDKRPPRIIKTIASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKGKR PAATKKAGQAKKKKGSDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQ IVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGEEP Sp-dCas9-KRAB (SEQ ID NO: 44) MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGAL LFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLE ESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRL IYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINAS GVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSN FDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDIL RVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKN GYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNG SIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGN SRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPK HSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTV KQLKEDYFKKIECFDSVETSGVEDRFNASLGTYHDLLKIIKDKDFLDNEEN EDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLS RKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVS GQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMAR ENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYL QNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKS DNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIK RQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKD FQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRK MIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGE IVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIAR KKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSS FEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGN ELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISE FSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKY FDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGTGGPKKKR KVYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAGSMDAKSLTAWSRTLVTFK DVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEK GEEP Sa-dCas9 (SEQ ID NO: 45) MAPKKKRKVGIHGVPAAKRNYILGLAIGITSVGYGIIDYETRDVIDAGVRL FKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGI NPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKEQ ISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTY FPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQ KKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEI IENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGT HNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLVDD FILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKMINEM QKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEAIPLED LLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEEASKKGNRTPFQYLSSSD SKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLV DTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGY KHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEEKQAESMPEIETEQE YKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELINDTLYSTRKDDKGNTL IVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKLKLIMEQYGDEK NPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNSRN KVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKCYEEAKKL KKISNQAEFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREY LENMNDKRPPRIIKTIASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG