Agent and method for enhancing fertility
11702457 · 2023-07-18
Assignee
Inventors
Cpc classification
C12N5/0682
CHEMISTRY; METALLURGY
A61P15/08
HUMAN NECESSITIES
International classification
Abstract
An agent capable of promoting proliferation and differentiation of granulosa cells is disclosed which comprises a growth and differentiation factor-9 (GDF9) protein comprising a modified GDF9 polypeptide monomer which includes at least one amino acid substitution that enhances binding to and/or activation of activin-like kinase 4 and/or 5 receptor (ALK4/5). The agent is preferably provided in a mature dimeric form (eg comprising two monomers of the same modified GDF9 polypeptide monomer) and/or in a pro/mature complex form. The agent may be suitable for, inter alia, promoting oocyte maturation in vitro for use in assisted reproductive technologies.
Claims
1. An agent for promoting proliferation and differentiation of granulosa cells, said agent comprising a growth and differentiation factor-9 (GDF9) protein comprising a modified GDF9 polypeptide monomer which includes at least one amino acid substitution that enhances binding to and/or activation of activin-like kinase 4 and/or 5 receptor (ALK4/5), wherein the at least one amino acid substitution that enhances binding to and/or activation of ALK4/5 is at an amino acid position selected from the group consisting of positions 363, 366 and 369 from the human wild-type sequence or corresponding positions of other GDF9 proteins.
2. The agent of claim 1 in a mature dimeric form.
3. The agent of claim 1 in a pro/mature complex form.
4. The agent of claim 1, wherein the GDF9 protein comprises two monomers of the same modified GDF9 polypeptide monomer.
5. The agent of claim 1, wherein the modified GDF9 polypeptide monomer(s) is derived from human GDF9 (hGDF9).
6. The agent of claim 5, wherein the modified hGDF9 polypeptide monomer(s) further includes a G391R amino acid substitution.
7. The agent of claim 1, wherein the at least one amino acid substitution that enhances binding to and/or activation of ALK4/5 is/are selected from the following amino acid substitutions: (i) S363R, S363K or S363H; (ii) K366G, K366A, K366V, K366I, K366L or K366M; and (iii) N369H, N369K or N369R.
8. The agent of claim 1, wherein the modified hGDF9 polypeptide monomer(s) includes an amino acid substitution from each of the following groups of amino acid substitutions: (i) S363R, S363K or S363H; (ii) K366G, K366A, K366V, K366I, K366L or K366M; (iii) N369H, N369K or N369R; and (iv) T431M, T431S or T431C.
9. An agent comprising a growth and differentiation factor-9 (GDF9) protein comprising a modified GDF9 polypeptide monomer derived from human GDF9 (hGDF9) and which includes at least one of the following amino acid substitutions: K366G, K366A, K366V, K366I, K366L and K366M.
10. The agent of claim 9, wherein the modified GDF9 polypeptide monomer includes a K366G amino acid substitution.
11. The agent of claim 9, wherein the modified GDF9 polypeptide monomer further includes one or more amino acid substitution selected from: (i) S363R, S363K or S363H; and (ii) N369H, N369K or N369R.
12. The agent of claim 9, wherein the modified hGDF9 polypeptide monomer includes an amino acid substitution from each of the following groups of amino acid substitutions: (i) S363R, S363K or S363H; (ii) K366G, K366A, K366V, K366I, K366L or K366M; (iii) N369H, N369K or N369R; and (iv) T431M, T431S or T431C.
13. The agent of claim 9, wherein the modified GDF9 polypeptide monomer further includes a G391R amino acid substitution.
14. The agent of claim 9, wherein the modified GDF9 polypeptide monomer includes the following amino acid substitutions: S363R, K366G, N369H and G391R.
15. The agent of claim 9, wherein the modified GDF9 polypeptide monomer includes the following amino acid substitutions: S363R, K366G, N369H, T431M and G391R.
16. The agent of claim 9, wherein the GDF9 protein comprises two monomers of the same modified GDF9 polypeptide monomer.
17. The agent of claim 1, wherein the modified GDF9 polypeptide monomer further includes an S396C and/or S418C amino acid substitution(s).
18. The agent of claim 1, wherein the agent is provided in an isolated form.
19. A composition comprising the agent of claim 1, optionally in combination with a pharmacologically acceptable carrier and/or excipient.
Description
BRIEF DESCRIPTION OF FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION
(11) The structure of TGF-β superfamily ligand monomers has been likened to an open hand, with the functional (ie active) mature dimer forming through interactions between the inner portions of the “wrist” and the “palm”. The wrist region forms the type 1 receptor binding sites, which are built from amino acids from both monomers of the mature dimer. Structural modelling of the mature human cumulin protein (see
(12) Thus, in a first aspect of the present disclosure, there is provided an agent capable of promoting proliferation and differentiation of granulosa cells, said agent comprising a growth and differentiation factor-9 (GDF9) protein comprising a modified GDF9 polypeptide monomer which includes at least one amino acid substitution that enhances binding to and/or activation of activin-like kinase 4 and/or 5 receptor (ALK4/5).
(13) GDF9 genes are highly homologous across mammalian species and encode proteins of very similar size. For instance, the protein encoded by the human GDF9 gene is 454 amino acids (aa) in length, and consists of a signal peptide (aa 1-29), a propeptide (aa 30-318) terminating in a tetrabasic proteolytic processing site (RHRR) followed by the 135 amino acid mature polypeptide (aa 319-454) (McGrath et al. 1995). Similarly, the immature (ie pre-processed) murine GDF9 protein is 441 amino acids in length and includes a signal peptide (aa 1-29), a propeptide (aa 30-306) which terminates in a RRRR proteolytic processing site, and a 135 amino acid mature polypeptide (aa 307-441) (McPherron & Lee 1993); and the immature ovine GDF9 protein is 453 amino acids in length and includes a signal peptide (aa 1-27), a propeptide (aa 28-318) which terminates in a RHRR proteolytic processing site, and a 135 amino acid mature polypeptide (aa 319453). In another example, the immature bovine GDF9 protein is also 453 amino acids in length and includes a signal peptide (aa 1-25), a propeptide (aa 26-318) which terminates in a RHRR proteolytic processing site, and a 135 amino acid mature polypeptide (aa 319-453).
(14) Like other TGF-β superfamily members, the propeptide of GDF9 has an essential role in directing the correct folding, dimerisation, processing and secretion of the mature, biologically active dimeric protein (Gray & Mason 1990) comprising the mature polypeptides. However, somewhat unusually, the two mature polypeptide monomers are not covalently linked (ie by Cys-Cys linkages) and, moreover, it is believed that following cleavage of the propeptide (eg by furin-like proteases) and even secretion from the cell, the propeptide remains non-covalently associated with the mature polypeptides, thereby forming a non-covalent pro/mature complex. This is also considered to be true of BMP15 and cumulin (Mottershead et al., supra); although in the case of BMP15 and cumulin, it appears that at some point, possibly after the propeptide has assisted in presenting the respective mature dimeric protein to its receptor, the propeptide is displaced leaving the mature dimeric protein to stimulate signalling.
(15) Accordingly, as is well known to those skilled in the art, “Pro-GDF9” refers to the pro/mature dimeric complex of GDF9 while “GDF9” refers to the dimeric protein comprising two mature polypeptide monomers (ie without the propeptides). Similarly, “Pro-BMP15” refers to the pro/mature dimeric complex of BMP15 while “BMP15” refers to the dimeric protein comprising two mature BMP15 polypeptide monomers lacking the propeptides. Also, “Pro-cumulin” refers to the pro/mature heterodimeric complex of GDF9 and BMP15 while “cumulin” refers to the heterodimeric protein comprising a mature GDF9 polypeptide monomer and a mature BMP15 polypeptide monomer (ie without the respective propeptides).
(16) Agents according to the first aspect are hereinafter collectively referred to as being “cumulin-like” or termed more specifically as “Cumulin-like GDF9” or “Pro-cumulin-like GDF9”, wherein “Cumulin-like GDF9” refers to a dimeric protein comprising two mature GDF9 polypeptide monomers (ie without the propeptides) at least one of which is a “modified GDF9 polypeptide monomer” inasmuch as the polypeptide includes at least one amino acid substitution that enhances binding to and/or activation of activin-like kinase 4 and/or 5 receptor (ALK4/5), and “Pro-cumulin-like GDF9” refers to the pro/mature dimeric complex form of such a protein. It will be appreciated by those skilled in the art that the Pro-cumulin-like GDF9 and Cumulin-like GDF9 molecule may comprise one or two modified GDF9 polypeptide monomer(s).
(17) Where the molecule comprises just one modified GDF9 polypeptide monomer, the other GDF9 polypeptide monomer may be of a wild-type sequence (eg a human wild-type GDF9 mature sequence such as that shown hereinafter as SEQ ID NO: 1, or a murine wild-type GDF9 mature sequence such as that shown hereinafter as SEQ ID NO: 2) or a wild-type sequence incorporating a single “activating” amino acid substitution (eg a human wild-type GDF9 sequence incorporating a Gly-Arg substitution at position 391 or a position corresponding thereto). Such molecules may be considered to be heterodimers.
(18) TABLE-US-00001 SEQ ID NO: 1: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFS QLKWDNWIVAPHRYNPRYCKGDCPRAVCHRYGSPVHTMVQNIIY EKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC TCR SEQ ID NO: 2: GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFS QLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIY EKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRC TCR
(19) On the other hand, where the molecule comprises two modified GDF9 polypeptide monomers, it is to be appreciated that the two modified GDF9 polypeptide monomers may be the same or different. Molecules comprising monomers of the same modified GDF9 polypeptide are homodimers, whereas molecules comprising two different modified GDF9 polypeptide monomers may be considered as heterodimers.
(20) Preferably, the agent of the first aspect comprises a GDF9 protein comprising two monomers of the same modified GDF9 polypeptide monomer (ie a homodimer).
(21) The modified GDF9 polypeptide monomer(s) are preferably derived from human GDF9 (hGDF9) such as wild-type hGDF9 having the amino acid sequence shown as SEQ ID NO: 1, however they may otherwise be derived from the GDF9 proteins of other mammalian species (eg murine GDF9 (mGDF9), ovine GDF9 (oGDF9) and bovine GDF9 (bGDF9)).
(22) The modified GDF9 polypeptide monomer(s) include at least one amino acid substitution that enhances binding to and/or activation of activin-like kinase 4 and/or 5 receptor (ALK4/5). Enhanced binding to and/or activation of ALK4/5 may be determined with reference to the corresponding wild-type GDF9 or Pro-GDF9 protein. For example, where the agent of the first aspect comprises a modified murine GDF9 polypeptide monomer(s), then the amino acid substitution(s) may be assessed for enhanced binding to and/or activation of ALK4/5 by comparative testing against murine Pro-GDF9 or mGDF9 using any of the suitable affinity and/or activity assays known to those skilled in the art, including for example, Surface Plasmon Resonance (SPR) and suitable Smad-2/3 responsive reporter expression assays such as the luciferase-based assay described in the Examples hereinafter. On the other hand, where the agent of the first aspect comprises a modified GDF9 polypeptide monomer(s) developed from a latent GDF9 protein (eg human GDF9), then the amino acid substitution(s) may be assessed for enhanced binding to and/or activation of ALK4/5 by comparative testing against an “activated” Pro-GDF9 or GDF9 from the relevant species (eg one incorporating a single activating amino acid substitution as described in the Examples hereinafter). Enhanced binding to ALK4/5 may be determined by the identification of an increase in binding (eg affinity) to ALK4/5, and enhanced activation of ALK4/5 may be determined by the identification of an increase in Smad-2/3 signalling (which may be observed by increased expression of a reporter from a suitable Smad-2/3 responsive reporter construct).
(23) Preferably, agents according to the first aspect lack an ability to bind to the ALK6 receptor and/or to activate ALK6 to effect Smad-1/5/8 signalling. This may be assessed by using any of the suitable affinity and/or activity assays known to those skilled in the art, including for example, Surface Plasmon Resonance (SPR) and suitable Smad-1/5/8 responsive reporter expression assays such as the luciferase-based assay described in the Examples hereinafter.
(24) Preferably, the modified GDF9 polypeptide monomer includes an amino acid substitution at one or more amino acid positions within “finger 1” which, in hGDF9 for example, spans amino acid positions 354 to 381. More preferably, the modified GDF9 polypeptide monomer includes an amino acid substitution at one or more amino acid positions selected from the group consisting of positions 363, 366 and 369 (from the human wild-type sequence) or corresponding positions of other GDF9 proteins (eg positions 350, 353 and 356 of the murine wild-type sequence). Those skilled in the art can readily identify “corresponding positions” by using, for example, BLAST alignment of the human wild-type sequence with the relevant other GDF9 protein sequence. The amino acid substitution(s) may be an X.fwdarw.Z substitution, wherein X is the “wild-type” amino acid of the particular sequence position, and Z is any other amino acid but preferably one that is selected from the twenty (20) standard amino acids encoded by genetic code. Z may, however, be a non-standard amino acid such as, for example, certain Nα-alkylamino acids (eg N-methyl glycine (sarcosine) and N-methyl alanine), other amino acids such as 2-aminobutyric acid (Abu), amino isobutyric acid, 3-aminoadipic acid (Aad), ornithine, citruline, amino-oxyserine, homo-arginine, aminosuberic acid and β-2- and β-3-napthylalanine, ring-substituted phenylalanine (Phe) analogues (eg 2,3,4,5,6-pentafluoro-phenylalanine, 4-chloro-phenylalanine, methyl-phenylalanine and phosphono-phenylalanine), phospho-tyrosine (pTyr), selenocysteine and selenomethionine. However, preferably, Z will be an amino acid present in the corresponding position of a BMP15 protein or an otherwise similar amino acid to the one present at the corresponding position of the BMP15 protein. Those skilled in the art can readily identify a “corresponding position of a BMP15 protein” by using BLAST alignment of the mature polypeptide sequences of the relevant GDF9 and BMP15 proteins. Thus, for example, by BLAST alignment between the mature polypeptides of hGDF9 and hBMP15, it can be readily identified that positions 363, 366 and 369 of hGDF9 have corresponding positions in hBMP15 at positions 301, 304 and 307. The amino acids at positions 301, 304 and 307 of hBMP are arginine, glycine and histidine respectively. Accordingly, in some preferred embodiments, the modified GDF9 polypeptide monomer is a modified hGDF9 polypeptide monomer including one or more of the following amino acid substitutions: S363R (ie an Ser-Arg substitution at position 363), K366G (ie a Lys-Gly substitution at position 366) and N369H (ie an Asn-His substitution at position 369). However, the substitution(s) may also be made with other amino acids which are similar to those found in the relevant positions of BMP15. For example, instead of substituting the serine at position 363 of hGDF9 with arginine, a similar amino acid such as lysine, or an amino acid considered to be a conservative substitution of arginine, may be substituted instead.
(25) In some preferred embodiments, the modified GDF9 polypeptide monomer is a modified hGDF9 polypeptide monomer including one or more of the following amino acid substitutions: (i) S363R, S363K or S363H; (ii) K366G, K366A, K366V, K366I, K366L or K366M; and (iii) N369H, N369K or N369R.
(26) In some further preferred embodiments, the modified GDF9 polypeptide monomer is a modified hGDF9 polypeptide monomer including an amino acid substitution from each of the following groups of amino acid substitutions: (i) S363R, S363K or S363H; (ii) K366G, K366A, K366V, K366I, K366L or K366M; (iii) N369H, N369K or N369R; and (iv) T431M, T431S or T431C.
(27) Preferably, a modified hGDF9 polypeptide monomer will include at least one of the following amino acid substitutions: K366G, K366A, K366V, K366I, K366L and K366M. Most preferably, a modified hGDF9 polypeptide monomer will include at least the amino acid substitution K366G.
(28) Further, in some preferred embodiments, the modified GDF9 polypeptide monomer(s) may include an amino acid substitution to introduce a cysteine residue to achieve disulphide cross-linking (Cys-Cys linkages) of the two monomers of the agent. An agent cross-linked in this manner may show improved levels of stability and/or activity (eg by enhancing binding to and/or activation of ALK4/5). One suitable example of such a substitution is S418C in a modified hGDF9 polypeptide monomer (Mottershead et al. supra). However, those skilled in the art will also understand that the two monomers may be otherwise cross-linked by other chemical cross-linking techniques forming one or more covalent bonds between the monomers, such as the use of carbodiimides such as 1-ethyl-3-(3-dimethylamino propyl)carbodiimide (EDC) to link carboxyl groups and amine groups.
(29) It will also be understood by those skilled in the art that the modified GDF9 polypeptide monomer(s) may include yet further additional amino acid substitutions or other sequence variations such as addition(s) or deletion(s) (eg as may be present in a naturally-occurring variant of the Pro-GDF or GDF9 protein) or which may have been introduced and, preferably, do not substantially alter the function of the polypeptide (eg despite the addition of a further amino acid substitution(s), the polypeptide maintains the ability of binding to and activating ALK4/5). Such variation(s) may include one or more conservative amino acid substitutions such as: G, A, V, I, L, M; D, E; N, Q; S, T; K, R, H; F, Y, W, H; and P, Nα-alkylamino acids. Other substitutions may include the substitution of one or more L-amino acid(s) with a D-amino acid(s). An example of a particular amino acid addition is the addition of a methionine (M) residue to the N-terminal of the polypeptide, as may be a consequence of production of the mature polypeptide by recombinant techniques. Other additions that may be made to, for example, the N-terminal or C-terminal sequence may comprise the addition of short amino acid sequences (eg 2 to 10 amino acids in length) or long amino acid sequences (eg 11 or more amino acids) which confer various additional functionalities or properties, such as improved bioavailability, protein recovery or expression (eg a fusion partner).
(30) Notwithstanding the above, the modified GDF9 polypeptide monomer may additionally or alternatively, comprise amino acid sequences that have been modified either by natural processes, such as post-translational processing, or by chemical modification techniques such as those well known to those skilled in the art (eg Pegylation). Such modifications can occur anywhere in the polypeptide, including within the peptide backbone, the amino acid side-chains and/or the N- and/or C-termini. It will also be appreciated that the same types of modifications may be present in the same or at varying degrees at several sites in the polypeptides. Moreover, other modifications that may be present include the addition of an N-terminal spacer/linker moiety such as β-alanine, 8-amino-3,6-dioxaocanoic acid (“mini-PEG™”) and 11-amino-3,6,9-trioxaundecanoic acid (“mini-PEG3™”) for attaching, for example, a biochemical tag or chelator such as Fluorescein isothiocyanate (5-FTC), 5-carboxyfluorecein (5-Fam), 5-(and-6)-Carboxytetramethylrhodamine] (5,6-TAMRA), an Alexa Fluor® dye (Life Technologies Corporation, Carlsbad, Calif., United States of America), a cyanine dye, near-IR dye, 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA), 2-(4,7-bis(2-(tert-butoxy)-2-oxoethyl)-1,4,7-triazonan-1-yl)acetic acid (NOTA), diethylene triamine pentaacetic acid (DFTA) etc.
(31) Preferably, the agent of the first aspect is provided in an isolated form.
(32) The agent of the first aspect may be produced using synthetic or recombinant techniques well known to those skilled in the art. Where the agent is heterodimeric (ie where the agent comprises two different modified GDF9 polypeptide monomers), the monomers may be produced separately and then simply added together to enable the formation of the dimer. However, it is preferred that the two polypeptide monomers be co-expressed using recombinant techniques.
(33) The agent of the first aspect is capable of promoting proliferation and differentiation of granulosa cells. As such, the agent may be suitable for use in ART such as IVM since, as noted above, the proliferation and differentiation of the granulosa cells into cumulus cells promotes follicular development and oocyte maturation. Moreover, the agent may have a direct effect on oocyte maturation, particularly when in the pro/mature complex form (ie Pro-cumulin-like GDF9) as Pro-cumulin has been observed to promote oocyte development (Mottershead et al. supra), which may lead to enhanced oocyte yield and/or enhanced oocyte quality which, in turn, may result in improved embryo development and foetal survival. For use in an ART, the agent may be formulated into a suitable composition.
(34) Thus, in a second aspect, the present disclosure provides a composition, preferably an aqueous composition, comprising the agent of the first aspect optionally in combination with a pharmacologically acceptable carrier (eg solvent and/or buffer) and/or excipient.
(35) The composition may further comprise one or more other beneficial substances. Examples of suitable beneficial substances include cyclic-AMP (cAMP) modulators which may enhance oocyte development and maturation (Gilchrist et al. 2016).
(36) In a third aspect, the present disclosure provides a method of promoting proliferation and differentiation of granulosa cells (preferably i vitro), said method comprising contacting granulosa cells with an effective amount of the agent of the first aspect or the composition of the second aspect.
(37) In a related fourth aspect, the present disclosure provides the use of an agent of the first aspect or the composition of the second aspect for promoting proliferation and differentiation of granulosa cells.
(38) Further, in a fifth aspect, the present disclosure provides the use of an agent of the first aspect in the manufacture of a composition for promoting proliferation and differentiation of granulosa cells.
(39) In a sixth aspect, the present disclosure provides a method of promoting oocyte maturation (preferably in vitro), said method comprising contacting an immature cumulus-oocyte-complex (COC) with an effective amount of the agent of the first aspect or the composition of the second aspect.
(40) Preferably, the method of the sixth aspect comprises culturing the COC in vitro under conditions favourable to oocyte maturation (for example, in accordance with any of the IVM protocols known to those skilled in the art such as simulated physiological oocyte maturation (SPOM) (Albuz et al., 2010) for a period of, for example, 24 to 40 hours, and the COC is contacted with the agent or composition by adding the agent or composition to the culture media at a suitable time point or time point(s). Preferably, the time point at which the agent or composition is added to the culture media will correspond with the late stage(s) of oocyte maturation, such as the late antral stage (Otsuka et al., 2011).
(41) Preferably, the COC is a human COC.
(42) In some embodiments, the COC has been collected from women suffering from PCOS or POI, other women with pre-existing reproductive issues (such as those associated with hypothalamic dysfunction), or women in remission or recovery from cancer (ie where the administration of exogenous gonadotrophins used in conventional IVF may be undesirable). Further, in some embodiments, the COC is one that has been stored as part of a fertility preservation strategy prior to destructive cancer therapies.
(43) Following maturation of the oocyte in accordance with the method of the sixth aspect, the oocyte may be fertilised according to a standard in vitro fertilisation protocol (eg intracytoplasmic sperm injection (ICSI)), and the fertilised oocyte transferred to a recipient female or placed in appropriate storage for a later transfer.
(44) In a seventh aspect, the present disclosure provides the use of an agent of the first aspect or the composition of the second aspect for promoting oocyte maturation.
(45) In an eighth aspect, the present disclosure provides the use of an agent of the first aspect in the manufacture of a composition for promoting oocyte maturation.
(46) As mentioned above, the agent of the present disclosure may be produced using recombinant techniques well known to those skilled in the art. Accordingly, in a further aspect of the present invention, the invention provides a polynucleotide molecule (preferably in an isolated form) comprising a nucleotide sequence encoding a modified GDF9 polypeptide monomer. In a still further aspect, the present disclosure provides a cloning or expression vector comprising such a polynucleotide molecule. Moreover, in yet a still further aspect, the present disclosure provides a host cell (eg a suitable eukaryotic cell) including the polynucleotide or cloning or expression vector, wherein said host cell is capable, for example, of expressing the agent in culture.
(47) The agent and method(s) of the present disclosure are hereinafter further described by way of the following non-limiting example(s) and accompanying figures.
EXAMPLES
Example 1 Production of hGDF9 Mutants with Amino Acid Substitutions in “Wrist” REGION
(48) A comparison of the amino acid sequence of the mature domains of the hGDF9 and hBMP15 proteins of cumulin using BLAST alignment found them to be 59% identical (
(49) A number of mutant GDF9 proteins were then designed and produced to determine whether the mature hGDF9 homodimer could be made to be more “cumulin-like” (ie could be modified to achieve higher affinity for ALK4/5) by introducing one or more of the amino acid residues from BMP15. The various mutant proteins are summarised in Table 1 below. All of the mutant proteins incorporated a G391R substitution which overcomes/ameliorates latency of hGDF9 activity (see Example 2).
(50) TABLE-US-00002 TABLE 1 Mutant GDF9 protein name Mutations included GDF9_G391R G391R Cumulin-like GDF9 (Mutant 1) S363R, K366G, N369H, G391R Cumulin-like GDF9_T431M (Mutant 2) S363R, K366G, N369H, G391R, T431M Cumulin-like GDF9_D445G (Mutant 3) S363R, K366G, N369H, G391R, D445G Cumulin-like GDF9_T431M_D445G S363R, K366G, N369H, (Mutant 4) G391R, T431M, D445G Cumulin-like GDF9_R363S (Mutant 5) K366G, N369H, G391R Cumulin-like GDF9_G366K (Mutant 6) S363R, N369H, G391R Cumulin-like GDF9_H369N (Mutant 7) S363R, K366G, G391R
Materials and Methods
(51) Mutagenesis
(52) The mutant GDF9 proteins were produced by introducing mutations into a codon-optimised expression cassette encoding a modified hGDF9 DNA sequence (hGDF9_His-8; also referred to herein as “wild-type hGDF9”) contained within the mammalian expression vector pEF-IRES (Mottershead et al., supra). This modified hGDF9 DNA sequence included sequence encoding the rat serum albumin signal sequence at the 5′ end followed by sequences to provide a His-8 tag and a Strep 11 epitope tag at the N-terminus of the GDF9 pro-peptide. Additionally, hGDF9_His-8 included sequence to substitute the usual RHRR tetrabasic proteolytic processing site with RRRR. The QuikChange Lightning Multi Site-Directed Mutagenesis Kit (Agilent Technologies, Inc., Santa Clara, Calif., United States of America) was used to introduce the required mutations. Subsequent changes to the GDF9 mutant cDNA were carried out by overlap extension PCR using Phusion® HF DNA polymerase (New England Biolabs Inc, Ipswich, Mass., United States of America) and the mutated PCR products were ligated into the pEF1α-IRES (Clontech Catalogue no. 631970; Clontech Laboratories, Inc., Mountain View, Calif., United States of America) multiple cloning site A between the restriction sites NheI and EcoRI. For each construct, the entire hGDF9 cDNA cassette was confirmed by DNA sequencing. The primers used for the mutagenesis of hGDF9 His-8 are shown in Table 2.
(53) TABLE-US-00003 TABLE 2 Primer name Primer purpose Primer sequence (5′-3′) CO_hGDF9_5′_NheI Amplification of hGDF9 from 5′ end ctaggctagcaccatgaagtgggtaacc with NheI site addition tttctcc (SEQ ID NO: 3) CO_hGDF9_3′_EcoRI Amplification of hGDF9 from 3′ end tgagcggccgcagaattcagt (SEQ with EcoRI site addition ID NO: 4) CO_hGDF9_G391R_S Introduction of G391R mutation into ccaagggcagtgagacacagatacggc hGDF9 (SEQ ID NO: 5) CO_hGDF9_G391R_AS Introduction of G391R mutation into gccgtatctgtgtctcactgcccttgg hGDF9 (SEQ ID NO: 6) CO_hGDF9_F362- Introduction of S363R, K366G and GCTGAGCTTCCGCCAGCTGGGGTSGGAC N369_S N369H mutations into hGDF9 CACTGGATCG (SEQ ID NO: 7) CO_hGDF9_F362- Introduction of S363R, K366G and CGATCCAGTGGTCCCACCCCAGCTGGCG N369_AS N369H mutations into hGDF9 GAAGCTCAGC (SEQ ID NO: 8) CO_hGDF9_T431M_S Introduction of T431M mutation into CTGAGCGTGCTGATGATCGAGCC (SEQ hGDF9 ID NO: 9) CO_hGDF9_T431M_AS introduction of T431M mutation into GGCTCGATCATCACCACGCTCAG (SEQ hGDF9 ID NO: 10) CO_hGDF9_D445G_S Introduction of D445G mutation into caaggagtacgagggcatgatcgccac hGDF9 (SEQ ID NO: 11) CO_hGDF9_D445G_AS Introduction of D445G mutation into gtggcgatcatgccctcgtactccttg hGDF9 (SEQ ID NO: 12)
(54) Production and Purification
(55) Production of wild-type and mutant hGDF9 proteins were assessed following transient transfection of HEK-293T cells using polyethylenimine (PEI)-MAX (Polysciences, Inc., Warrington, Pa. United States of America). In brief, HEK-293T cells were plated at 8×10.sup.5 cells/well in 6-well plates. Wild-type or mutant hGDF9_pEF1α-IRES DNA (2.5 μg/well) was combined with PET for 10 minutes. DNA-PEI complexes were added directly to cells and incubated in OPTI-MEM (Life Technologies, Carlsbad, Calif., United States of America) medium for 4 hours at 37° C. in 5% CO before replacing with fresh OPTI-MEM medium. After 24 hours, the medium was replaced with production media [Dulbecco's modified Eagle medium (DMEM):F12medium containing L-glutamine, 0.02% bovine serum albumin (BSA), 0.005% heparin (Sigma-Aldrich, St Louis, Mo., United States of America)] for 72 hours. Conditioned media was concentrated 5-fold using Nanosep microconcentrators (10 kDa; Pall Life Sciences, Port Washington, N.Y., United States of America). GDF9 expression in media was assessed by Western blotting of reduced samples on 10%/sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis gels (Bio-Rad Laboratories, Inc., Hercules, Calif., United States of America) transferred onto ECL Hybond membranes (GE Health Care, Chalfont St Giles, Bucks, United Kingdom). Blots were probed overnight with mAb 53/1 (1:5000)(Oxford Brookes University, Headington, Oxford, United Kingdom), an antibody specific for a 4 amino acid sequence (EPDG; aa 433-436 in hGDF9) towards the C-terminus of all mammalian mature GDF9 proteins (Gilchrist et al. 2004). This was followed by the secondary antibody horseradish peroxidase-conjugated anti-mouse IgG (1:10,000)(GE Healthcare) with detection using Lumi-light chemiluminescence reagents (Roche, Basel, Switzerland). The pre-stained protein standard SeeBlue Plus2 (Life Technologies) was used to assess molecular weight (MW) sizes.
(56) Larger-scale production of wild-type and mutant hGDF9 proteins was achieved by transfecting multiple 6-well plates at a time with a single construct according to the conditions described above. Each well was treated as a separate transfection, with conditioned media from the hGDF9 mutant transfected cells being pooled after 72 hours incubation. The conditioned media was then centrifuged, concentrated (Centricon Plus-70; Millipore, Billerica, Mass., United States of America), and resuspended in binding buffer (50 mM phosphate buffer, 300 mM NaCl, pH 7.4). The concentrated media was then subjected to immobilised metal affinity chromatography (Co-IMAC) using HisPur™ Cobalt Resin (Thermo Fisher Scientific, Waltham, Mass., United States of America). Bound hGDF9 was then eluted from the Co-IMAC resin using elution buffer (50 mM phosphate buffer, 300 mM NaCl, 333 mM imidazole, pH 7.4). Imidazole was removed from Co-IMAC purified hGDF9 by dialysis against binding buffer using 2 mL 3.5K MW Cut-off Slide-A-Lyzer® MINI Dialysis Devices (Thermo Fisher Scientific) according to the manufacturer's instructions. The degree of recovery and mass estimates for the hGDF9 proteins throughout the purification process was determined by Western blot using recombinant hGDF9 (R&D Systems Inc., Minneapolis, Minn., United States of America) as a reference.
(57) Activity Testing
(58) To test the activity of a selected hGDF9 mutant protein, cells of the COV434 granulosa cell tumour line were transfected with a Smad-2/3 responsive luciferase reporter (pA3-Lux)(Nagarajan et al. 1999) and the transcription factor FAST2 (Chand et al. 2007; Chen el al. 1996). Transfected cells were treated with a dose range (1.6 ng/mL to 25 ng/mL) of Pro-GDF9, Pro-GDF9 plus an equal quantity of Pro-BMP15, Pro-cumulin or the mature hGDF9 mutant protein for ˜20 hours. Expression of the luciferase protein was assessed by measuring luminescence immediately after the addition of the substrate D-luciferin (Invitrogen Corporation, Carlsbad, Calif., United States of America). The concentration of cumulin treatments was based on the quantity of GDF9 mature domain in the preparation.
Results
(59) Expression of hGDF9 Mutants
(60) hGDF9 expression cassettes with the desired sequence mutations for the substituted amino acids from hBMP15 were generated using PCR-based site-directed mutagenesis. To assess the expression of hGDF9 mutants, HEK-293T cells were transiently transfected. The conditioned media was collected, concentrated 5× and examined via Western blotting under reducing conditions with an antibody specific to the GDF9 mature peptide (mAB 53/1) (
(61) Purification of hGDF9 Mutants
(62) To generate a concentrated and purified preparation of cumulin-like GDF9 (Mutant 1), large scale production was performed by transiently transfecting 8×6-well plates of HEK-293T cells. The conditioned media was then pooled and concentrated to ˜1 mL using a Centricon Plus-70 (Millipore) after which binding buffer was used to make it up to a final volume of 5 ml. The concentrated conditioned media was incubated in a column containing ˜0.5 mL of HisPur™ Cobalt Resin for ˜2 hours at room-temperature whilst rolling. The unbound proteins were collected and the column washed twice with 4 mL of PBS. To elute the bound proteins, the HisPur™ Cobalt Resin was incubated in 3 mL of PBS containing 0.33 molar imidazole for 2 hours at room-temperature whilst rolling. To elute any proteins remaining bound, the HisPur™ Cobalt Resin was then incubated in 3 mL of PBS containing 0.5 molar imidazole for 1 hour at room-temperature whilst rolling. This step was repeated again with PBS containing 1 molar imidazole. The recovery was assessed by Western blot (
(63) As the majority of the cumulin-like GDF9 (Mutant 1) protein was eluted in the fraction containing 0.33 molar imidazole, this fraction was dialysed to remove the imidazole. Following dialysis, the concentration of the protein was determined by Western blot using recombinant hGDF9 (R&D Systems) as a reference. The final concentration of the purified cumulin-like GDF9 (Mutant 1) protein was 8.3 ng/L.
(64) TABLE-US-00004 TABLE 3 Lane Sample 1 Ladder (SeeBlue Plus2, Life Technologies) 2 25 ng standard (R&D Systems rhGDF9) 3 Conditioned media (Total volume = 96 mL) 4 Concentrate (Total volume = 5 mL) 5 Flow-through (Total volume = 5 mL) 6 PBS Wash #1 (Total volume = 4 mL) 7 PBS Wash #2 (Total volume = 4 mL) 8 333 mM imidazole PBS (Total volume = 3 mL) 9 500 mM imidazole PBS (Total volume = 3 mL) 10 1M imidazole PBS (Total volume = 3 mL)
(65) Activity Testing
(66) The results of three representative experiments using the cumulin-like GDF9 (Mutant 1) protein are shown in
(67) In an alternate luciferase assay, a plasmid with a promoter responsive to Smad-1/5/8 signalling (Korchynskyi and ten Dijke 2002) was transfected into the COV434 granulosa cell tumour line. Transfected cells were then treated with a dose range (0.63 ng/mL to 20 ng/mL) of the cumulin-like GDF9 (Mutant 1) protein or mature recombinant human BMP15 commercially available from R&D Systems (rhBMP15) for ˜20 hours. The cumulin-like GDF9 (Mutant 1) protein displayed no ability to activate the promoter, whilst rhBMP15 was observed to dose-dependently increase the expression of the luciferase reporter. The results of a representative experiment are shown in
DISCUSSION
(68) Mutant mature hGDF9 proteins were expressed incorporating amino acid substitutions which were hoped to confer a more “cumulin-like” activity (ie a higher affinity for ALK45) to the homodimers. One particular mutant, termed cumulin-like GDF9 (Mutant 1) incorporating S363R, K366G, N369H and G391R substitutions, was found to be expressed substantially higher than hGDF9 when expressed alone or in combination with BMP15. It was also found that this mutant could be more readily recovered using a standard purification regime of Co-IMAC and dialysis, than Pro-cumulin. Thus, cumulin-like GDF9 proteins according to the present disclosure appear to offer considerable advantages for production over Pro-cumulin. Moreover, since the expression and purification described in this example resulted in more concentrated final preparations, the cumulin-like GDF9 proteins ought to enable the use of smaller preparation volumes for their potential applications such as the treatment of female infertility (eg where added to a culture media, the reduced preparation volume may limit any adverse effects from the buffer or the addition of impurities).
(69) The cumulin-like GDF9 proteins of the present disclosure also show excellent cumulin-like activity with the representative example (ie cumulin-like GDF9 (Mutant 1)) having the ability to hyper-activate the Smad-2/3 signalling pathway. In fact, in the Smad-2/3 responsive COV434 luciferase assay described in this example, this cumulin-like GDF9 protein proved to work approximately twice as well as Pro-cumulin. While not wishing to be bound by theory, it is considered that this stems from the fact that mature cumulin has one receptor binding site with high affinity for ALK4/5 and another site with affinity for ALK6 (
(70) Further, it was observed that the Pro-cumulin preparations displayed substantial batch-to-batch variation in potency, whereas different batches of the cumulin-like GDF9 (Mutant 1) protein, being homogenous preparations of active homodimers, provided a consistent and reliable level of potency.
Example 2 Production of hGDF9 Mutant with a G391R Substitution
(71) The site in cumulin which binds ALK4/5 with high affinity is predicted to be composed of the wrist region of hBMP15 (monomer 1) and the fingers of hGDF9 (monomer 2). Within the wrist of monomer 2, it was observed that there is one amino acid difference; that is, at position 391 in hGDF9 there is a glycine residue whereas the corresponding position of hBMP15 (ie position 329) contains an arginine (see
(72) Materials and Methods
(73) Mutagenesis
(74) A mutant hGDF9 protein was produced by introducing a mutation to effect a G391R substitution in the manner described in Example 1 for the hGDF9 mutants described therein.
(75) Production and Purification
(76) Expression and purification of the hGDF9 (G391R) mutant was undertaken in a similar manner to that described in Example 1 using transfection of HEK-293T cells and immobilised metal affinity chromatography (Co-IMAC).
(77) Activity Testing
(78) The activity of the hGDF9 (G391R) mutant was tested, along with wild-type mature hGDF9 (R&D Systems) and mature murine GDF9 (R&D Systems), using the Smad-2/3 responsive luciferase reporter and assay described in Example 1. Expression of the luciferase protein was assessed by measuring luminescence immediately after the addition of the substrate D-luciferin (Invitrogen Corporation).
Results
(79) The results of the Smad-2/3 activity testing of the hGDF9 (G391R) mutant is shown in
(80) Discussion
(81) In vitro mGDF9 has been shown to exert its biological activity primarily through phosphorylation of Smad-2/3 mediated via the type I receptor activin receptor-like kinase-5 (ALK5) and BMPR2 (Mazerbourg et al. 2004; Vitt et al. 2002). This potently induces the expression of genes essential to cumulus expansion, an important process which successful ovulation and fertilisation depend upon (Li et al. 2008). In contrast to mGDF9, human GDF9 (hGDF9) is secreted as a latent complex (
Example 3 Production and Analysis of Further hGDF9 Mutants with Cumulin-Like Activity
(82) The cumulin-like GDF9 (Mutant 1) protein mutant described in Example 1 includes four mutations (ie S363R, K366G, N369H and G391R). While found to be highly active, it was unclear whether all four mutations were actually required for the heightened activity. In other words, it was considered that it may be that only one of the three “BMP15 residues” (ie S363R, K366G or N369H) was responsible for the observed heightened activity. It was also plausible that if only one of the three mutations was required, then one or both of the other two may even have an inhibitory effect on activity. Therefore, experiments were undertaken to analyse the need for each of S363R, K366G or N369H mutations and determine whether greater levels of activity may be achieved by reversing one or two of these mutations.
(83) Materials and Methods
(84) Mutagenesis
(85) Mutant hGDF9 proteins incorporating the G391R mutation and one “reversed” mutation selected from R363S, G366K and H369N were prepared in the manner described in Example 1. Briefly, three different cumulin-like GDF9 expression cassettes where one mutation from hBMP15 had been reversed were generated using PCR-based site-directed mutagenesis. The primers used are shown in Table 4. The mutants were designated cumulin-like GDF9 R363S, cumulin-like GDF9 G366K and cumulin-like GDF9 H369N. For clarification, cumulin-like GDF9 R363S retained the G391R, K366G and N369H mutations included in the cumulin-like GDF9 (Mutant 1) mutant; cumulin-like GDF9 G366K retained the G391R, S363R and N369H mutations included in the cumulin-like GDF9 (Mutant 1) mutant; and cumulin-like GDF9 H369N retained the G391R, S363R and K366G mutations included in the cumulin-like GDF9 (Mutant 1) mutant.
(86) TABLE-US-00005 TABLE 4 Primer name Primer purpose Primer sequence (5′-3′) CL_GDF9_R363S_S Reversal of S363R mutation in cggctgagcctcagccagctgggg Cumulin-like GDF9 (SEQ ID NO: 13) CL_GDF9_R363S_AS Reversal of S363R mutation in ccccagctggctgaagctcagccg Cumulin-like GDF9 (SEQ ID NO: 14) CL_GDF9_G366K_S Reversal of K366G mutation in cttccgccagctgaagtgggaccactgg Cumulin-like GDF9 (SEQ ID NO: 15) CL_GDF9_G366K_AS Reversal of K366G mutation in ccagtggtcccacttcagctggcggaag Cumulin-like GDF9 (SEQ ID NO: 16) CL_GDF9_H369N_S Reversal of N369H mutation in ctggggtgggacaactggatcgtgg Cumulin-like GDF9 (SEQ ID NO: 17) CL_GDF9_H369N_AS Reversal of N369H mutation in ccacgatccagttgtcccaccccag Cumulin-like GDF9 (SEQ ID NO: 18)
(87) Production and Purification
(88) Expression and purification of the hGDF9 mutants was undertaken using transfection of HEK-293T cells and immobilised metal affinity chromatography (Co-IMAC) as described in Example 1.
(89) Activity Testing
(90) The activity of the hGDF9 mutants was tested, along with wild-type Pro-hGDF9 and the hGDF9 G391R mutant (Example 2), using the Smad-2/3 responsive luciferase reporter and assay described in Example 1. Expression of the luciferase protein was assessed by measuring luminescence immediately after the addition of the substrate D-luciferin (Invitrogen Corporation).
Results
(91) Expression of hGDF9 Mutants with Reversed Mutations
(92) To assess the expression of the different cumulin-like GDF9 mutants, conditioned media was collected from the transfected HEK-293T cells culture, concentrated 5× and examined via Western blotting under reducing conditions with an antibody specific to the GDF9 mature protein (mAB 53/1; Oxford Brookes University). The results are shown in
(93) Activity Testing
(94) All of the hGDF9 mutants with reversed mutations were purified via Co-IMAC and assessed for activity using COV434 granulosa cells transfected with a Smad-2/3 responsive luciferase reporter (pA3-Lux) and the transcription factor FAST2. Transfected cells were treated with a dose range (3.1 ng/mL to 50 ng/mL) of wild-type Pro-hGDF9, Pro-GDF9_G391R and different Pro-cumulin-like GDF9 variants for ˜20 hours. Expression of the luciferase protein was assessed by measuring luminescence immediately after the addition of the substrate D-luciferin (Invitrogen Corporation). The results are shown in
Discussion
(95) It was found that in order to achieve the activity and maximal response from the cumulin-like GDF9 (Mutant 1) mutant protein, all three of the S363R, K366G and N369H amino acid substitutions (as found in BMP15) were required. Of these, the most important mutation contributing to both expression and activity was identified as K366G. The mutant where this had been reversed (ie Pro-cumulin-like GDF9_G366K) displayed a substantial reduction in expression. More importantly, the Pro-cumulin-like GDF9_G366K mutant displayed less than half the potency of the original Mutant 1 form. It was also found that the reversal of the S363R mutation resulted in a mild decrease in expression and activity. Therefore, it is considered that this mutation also contributes towards the good expression and activity properties of the cumulin-like GDF9 Mutant 1 protein.
(96) Reversal of the N369H mutation (Pro-cumulin-like GDF9_H369N) resulted in a small increase in expression, suggesting that this mutation actually has a negative impact on expression. However, more importantly, the Pro-cumulin-like GDF9_H369N mutant was observed to be highly active. In fact, at most of the doses tested (3.1 ng/mL to 25 ng/mL), this protein showed a comparable level of activity to the Pro-cumulin-like GDF9 (Mutant 1) protein, and only at the highest dose tested (50 ng/mL), was the Pro-cumulin-like GDF9_H369N unable to deliver the same level of activity. Nevertheless, it is considered that the Pro-cummulin-like GDF9_H369N may still be suitable for applications such as those described herein (eg for in vitro maturation (IVM)), noting that it has been reported that the ability of Pro-cumulin to improve IVM outcomes of porcine cumulus-oocyte complexes (COCs) is not significantly different whether the dose used is 20 ng/mL or 100 ng/mL (Mottershead et al. supra), suggesting that the effect of dose during IVM is likely to only be relevant between 0-20 ng/mL.
Example 4 Use of Pro-Cumulin-Like GDF9 in In Vitro Maturation (IVM) of Oocytes
(97) The potential to use a Pro-cumulin-like GDF9 according to the present disclosure to promote follicle development and oocyte maturation and quality (oocyte developmental competence) can be assessed with a granulosa cell proliferation assay and by treating cumulus-oocyte complexes (COCs) during the oocyte in vitro maturation (IVM) phase, followed by in vitro fertilisation and embryo culture and assessment of subsequent blastocyst yield and quality.
(98) Materials and Methods
(99) Granulosa Cell (GC) Proliferation Assay
(100) A murine granulosa cell [3H]-thymidine incorporation assay was performed using standard procedures as previously described (Gilchrist et al. 2004). In brief, mural GCs were collected from C57BI/6 mice 44-46 h after gonadotropin priming. Cells were then cultured at 37° C. in 5% CO.sub.2 in protein-free medium at 2×10.sup.5 cells/ml with treatments (ie 1.56 ng/ml, 3.125 ng/ml, 6.25 ng/ml and 12.5 ng/ml of Pro-cumulin-like GDF9 (Mutant 2)) for 18 h followed by a further 6 h with 15.4 kBq [3H]-thymidine (PerkinElmer Life Sciences; Waltham, Mass., United States of America). Granulosa cell [3H]-thymidine incorporation was assessed using a Microbeta microplate counter (PerkinElmer Life Sciences) as an indicator of cell DNA synthesis.
(101) Bovine IVM
(102) Bovine cumulus-oocyte-complexes (COCs) were collected from antral follicles from abattoir-derived ovaries in HEPES-buffered tissue culture medium-199 (TCM 199) supplemented with 10% foetal calf serum (FCS; Life Technologies Corporation; Carlsbad, Calif., United States of America) and 4 mg/mL fatty acid-free bovine serum albumin (FAF-BSA; MP BioMedicals; Santa Ana, Calif., United States of America). COCs with an intact cumulus vestment and homogenous cytoplasm were selected and washed in HEPES-TCM-199 supplemented with 50 mg/mL kanamycin, 50 mg/mL heparin and 4 mg/mL FAF-BSA and subsequently washed twice in HEPES-TCM199. COCs were then matured in groups for 24 h (wherein each group is treated with either vehicle (control), or 5 ng/ml, 10 ng/ml or 100 ng/ml of the Pro-cumulin-like GDF9 (Mutant 2)) in bicarbonate-buffered TCM199 supplemented with 0.1 IU/mL hCG (Merck Serono International SA; Darmstadt, Germany), 1 IU/mL recombinant human FSH (Organon International; Oss, Netherlands), 1 μM cysteamine, 10% (w/v) FCS, and 4 mg/mL FAF-BSA under embryo-grade mineral oil in Nunc 4-well dishes (Thermo Fisher Scientific, Inc; Waltham, Mass., United States of America) at 38.5° C. under 5% CO.sub.2 and 20% O.sub.2. Following the in vitro maturation, oocytes (n=20 per well) were fertilised with sperm from a single sire (Semex Pty Ltd; Melton, VIC, Australia) at a final concentration of 1×10.sup.6/mL in in vitro fertilisation medium supplemented with amino acids (50 μL) under mineral oil in a 96-well plate (Thermo Fisher Scientific) at 38.5° C. under 5% CO.sub.2 in air. Presumptive zygotes are recovered after 23 h, cumulus cells manually stripped and resultant embryos transferred into Nunc 4-well dishes (n=20 per well) containing synthetic oviductal fluid (SOF) medium supplemented with amino acids and 4 mg/mL BSA (500 μL per well). Embryos may then be cultured in a modular incubator at 38.5° C. under 5% 02 and 6% CO.sub.2 for 60 h.
Results and Discussion
(103) Granulosa Cell (GC) Proliferation Assay
(104) Results obtained with the murine GC proliferation assay are shown in
(105) Bovine IVM
(106) Preliminary results obtained from treatments of bovine COCs are shown in Table 5 below. Particularly at 100 ng/ml, the results indicate that treatment of the COCs with the Pro-cumulin-like GDF9 improves the frequency of oocyte fertilisation (% oocyte fertilised) and numbers of occytes compacted on day 5 (% oocyte compacted). It is anticipated that it will also be shown that the treatments with the Pro-cumulin-like GDF9 will also improve the number of blastocysts formed (% blastocysts) and hatched blastocysts (% hatched blastocysts) in the subsequent stages of the IVM.
(107) TABLE-US-00006 TABLE 5 No. of Fertilised Compacting Com- Oocyte Embryo Embryos on Fertilised pacted Treatment No. No. Day 5 (%) (%) Control 72 48 36 66.8 49.6 10 ng Pro- 119 69 49 56.6 40.2 cumulin-like GDF9 20 ng Pro- 92 55 40 60.8 44.8 cumulin-like GDF9 100 ng Pro- 101 73 48 76.9 53.1 cumulin-like GDF9
(108) Throughout the specification and the claims that follow, unless the context requires otherwise, the words “comprise” and “include” and variations such as “comprising” and “including” will be understood to imply the inclusion of a stated integer or group of integers, but not the exclusion of any other integer or group of integers.
(109) The reference to any prior art in this specification is not, and should not betaken as, an acknowledgement of any form of suggestion that such prior art forms part of the common general knowledge.
(110) It will be appreciated by those skilled in the art that the agent or method(s) of the present disclosure is not restricted in its particular form or application described. Neither is the agent or method(s) of the present disclosure restricted to any of the preferred embodiment(s) with regard to the particular elements and/or features described or depicted herein. The agent and method(s) may also be the subject of numerous rearrangements, modifications and substitutions without departing from the scope of the present disclosure.
REFERENCES
(111) Albuz F K et al., Hum Reprod 25(12):2999-3011 (2010). Al-Musawi S L et al., Endocrinology 154(2):888-899 (2013). Chand A L et al., Hum Reprod 22(12):3241-3248 (2007). Chen X et al., Nature 383(6602):691-6% (1996). Di Pasquale E et al., Am J Hum Genet 75(1):106-111(2004). Dixit H et al., Menopause 12(6):749-754 (2005). Dong J W et al., Nature 383(6600):531-535 (1996). Fauser, BCJM et al., Human Reprod Update 17(6):829-847 (2010). Gray A M and A L Mason., Science 247(4948):1328-1330 (1990). Gilchrist R B et al., Biol Reprod 71:732-739 (2004). Gilchrist R B., Reprod Fert Dev 23(1):23-31 (2011). Gilchrist R B et al., Reproduction 142:647-657 (2011). Gilchrist R B et al., Reproduction 152(5):143-157 (2016). Korchynskyi O and P ten Dijke, J Biol Chem 277(7):4883-4891(2002). Li Jj et al., Mol Enducrinol 29:40-52 (2015). Li Q L et al., Mol Cell Biol 28(23):7001-7011 (2008). Marchal R et al., Theriogenology 57:1523-1532 (2002). Mazerbourg S et al., Mol Endocrnol 18(3):653-665 (2004). McGrath S A et al., Mol Endocrinol 9(1):131-135 (1995). McIntosh C J et al., Biol Repd 79(5):889-896 (2008). McMahon H E et al., 149(6):2807-2815 (2008). McNatty K P et al., Reproduction 129(4):473-480 (2005). McPherron A C and S J Lee., J Biol Chem 268(5):3444-3449 (1993). Mi L Z et al., Proc Natl Acad Sci USA 112(12):3710-3715 (2015). Mottershead D G et al., J Biol Chem 290(39):24007-24020 (2015). Nagarajan R P et al., J Biol Chem 274(47):33412-33418 (1999). Otsuka F et al., J Clin Endocinol Metab 91(11):4713-4716 (2011). Patino L C et al., J Cin Endocrin Metab 102(3):1009-1019 (2017). Peng J et al., Proc Na Acad Sci USA 110(8):E776-E785 (2013). Peng J et al., Biol Reprod 91(6):7 (2014). Simpson C M et al., Endocrinolog 153(3):1301-1310 (2012). Smitz J E et al., Semin Reprod Med 29(1):24-37 (2011). Sugimura S et al., Dev Biol 403:139-149 (2015). Vanderhyden B C et al., Dev Biol 140:3017-317 (1990). Vitt U A et al., Bio Reprod 67(2):473-480 (2002). Yoshioka K et al., J Reprod Dev 54:208-213 (2008).